00 lq00 lq0l|0lꏸA000. .. lost+foundgREADMEiof binME! boot dev$ etcvmunixeny sysx mntx libx mdecf mnt1o.mailrct tmplr.cshrct.logint.profile usrfiVERSION.rhosts.kermrc userrtoyset varetuunixa0lwA&آ&آ0...0 lꩪA 00(0( . ..MAKEDEVl MAKEDEV.local MAKEDEV.43alconsole43 kmeml meml nulll ttyl ra0al ra0bl ra0cl ra0dl ra0el ra0fl ra0gl ra0hl rra0a rra0b rra0c rra0d rra0e rra0f rra0h rra0g xp0a xp0b xp0c xp0d xp0e xp0f xp0g xp0h rxp0a ttyp0 ptyp0 ttyp1 ptyp1 ttyp2 ptyp2 ttyp3 ptyp3 ttyp4 ptyp4 ttyp5 ptyp5 ttyp6 ptyp6 ttyp7 ptyp7 ttyp8 ptyp8 ttyp9 ptyp9 ttypa ptypa ttypb rxp0b rxp0c ra1a ra1b ra1c ra1d rxp0d rxp0e swap drum ra1e xp1a xp1b xp1c xp1d xp1e xp1f rxp0f rxp0h xp1g xp1h rxp1a rxp1b rxp1cra1f ra1g ra1h rra1a rra1b rra1c rra1d rra1e rra1f rra1h rra1g hk0a ptypb ttypc ptypc ttypd ptypd ttype ptype ttypf ptypf rxp1d rxp1e rxp1f rxp1h rxp1g hk0b~ hk0c} hk0d| hk0e{ hk0fz hk0gy rxp0gx hk0hw rhk0av rhk0bu rhk0ct rhk0ds rhk0er rhk0fq rhk0hp rhk0go ingreslockaln rl0asm rl0bsl rl0csk rl0dsj rl0esi rl0fsh rl0gs/ rl0hs. ttyl1- rrl0a, rrl0b+ rrl0c* rrl0d) rrl0e( rrl0f' rrl0h& rrl0g%4klog0 fl*A |0㙚00f. ..e mvMEd cpMEc stripb adbpa make` ps_ as^ sh] sed\ diff[ cshZ dfY falseX trueW arV catU ccT chmodS cmpdR dateQ killP awkO echoN edM grepLhostnameK ldnaJ tpnaI lnnaH lsnaG chgrpF ddpE nmpD odpC dupBhostideA pwdid@ rmid? mkdir>size= stty< sync; mt: tee9 test8 nice7pagesize6 prsi5 rmail4 tarl3 rmdir2 time1 who0 expr/ login. mail- su,passwde+ rcpwd* walld9[) write( sort'chpasse' chfns' chshsNe& tcshs%chflags$sysctl# disklabel"|copyh0lꟲA 00=0=. ..AST4ADTaEST5EDTaCST6CDTaMST7MDTaPST8PDTaYST9YDTa AST4m EST5m CST6m MST7m PST8m YST9mDHST100lꩲA t00;0;. .. NewfoundlandAtlanticaEasternaCentralaMountainaPacificaYukon0l굲A `00909. ..EasternCentralMountainPacific Yukon East-IndianaArizonaaHawaiioal Pacific-New0lA  00202. ..Tasmania Queenslandal North Westa SouthVictoriaNSWra0lͰA 00?0?.$ .. Japan Singapore Australia NZein GB-Eire  WETin Iceland  METin Polando EETinTurkeyo W-SUn GMTinGMT-12oGMT-11oGMT-10o GMT-9 GMT-8 GMT-7 GMT-6 GMT-5 GMT-4 GMT-3 GMT-2 GMT-1 GMT+1 GMT+2 GMT+3 GMT+4 GMT+5 GMT+6 GMT+7 GMT+8 GMT+9GMT+10oGMT+11oGMT+12oGMT+13o USeinCanadaoeSystemVa  CETin UTCin UCTin Universal GreenwichEST5EDTCST6CDTMST7MDTPST8PDT ESTin MSTin HSTin localtime0$lْA y  000$. ..# dtab" getty!gettytabk  initt inetd.confalcatmanonf fsckn autoconfigalrestorfigshutdowng hostszoneinfogquotaone chown motdtermcapefastboot groupconfigt dumpg mtabgnetworkspasswdsprintcap protocols rcocrc.localremotelservicesshellss ftpdsreboottttyst utmptquotaoff~acctonf}htablef| mkfse{ mknodz mountyumountfxupdatefw vipwev croneuimplogftmkpasswdsimplogdr namedqroutedp dmesgobad144nntalkdm fstabl timedk acdjtimedci XNSroutedh arffu haltog clriofbadsecte dtab.saved pstatc fstatbtelnetdeatestnete` ntp.drift_ ntpdr^rexecdft] rwhod\ tftpd[comsatftZdcheckftYdiskpartXdumpfstWedquotaVfingerdUflcopyTgettableSifconfigRicheckgQ inetdP newfsOmkprotoNncheckM quotkL quotacheckaK pingcJreniceeckIrepquotakHrlogindkG uucpdF rmtdE routeD rshdCrxformatkB sarmAsavecorek@swaponek?syslogdk> lpcog=tunefsk<mkhostsk; arpst:disktabk9 kgmon8 trpt7 ntpd6 psdatabasea5 pacta4 passwd.paga3 passwd.dira2dumpdirir1 dumpdates0slattach hosts.equiv syslog.pidftpusersdmap3270d syslog.conf crash hosts.dir mklost+found ntpdc hosts.pag traceroutedchrootute master.passwdphonespasnetstarts tcsh6.00strgs rdump resolv.confsdev_mkdbntcpdk hosts.allowsntp.confo hosts.denys0lAW0왚00. ..dev.dirdev.pag0l)AU3/3/0...0 lЯAS0 00. .. dbetrunet0"lA-Z)KZ)K0...0$lA!C!fC!f0...0&lXdC 000...0(lAA*:YA*:Y0...0*lA k&A00. .. dvhpuboothkubootthpuboottrauboottrkuboottrluboott si51uboot rm03uboot rm05uboot si94uboot si95uboot<bruboott0,lA & 000. ..libc.aenycrt0.oeny cpp.o c2.omcrt0.onyf77pass1y f77_stringss c0sttc1st0.lueA$ a)J#a)J#0...00l01lꇟa 00002lꇟa 00003lꈟa 00004lꉟa 00005lꯖ!!2!2006 l!C!gC!g007 lNs!00008 lz!0E0E009 l!V0\V0\00: l6=!Z)JIZ)JI00;l!C!gC!g00<lQ!0000=lڠaC! gC! g00>lڠaC! gC! g00?lڠaC! gC! g00@lڠaC! gC! g00AlڠaC! gC! g00BlڠaC! gC! g00ClYɠa>+e>+e00DlJa0Ο0Ο00El! **00Fl!0000Glk!3/23/200Hlf!030300Il! 0000JlZ  D D ˚0#!/bin/sh - # # Copyright (c) 1980 Regents of the University of California. # All rights reserved. The Berkeley software License Agreement # specifies the terms and conditions for redistribution. # # @(#)MAKEDEV 4.27 (Berkeley) 4/15/86 # # Device "make" file. Valid arguments: # std standard devices # local configuration specific devices # Tapes: # ht* massbus tm03 & tu?? # tm* unibus tm11 & te10 emulations (e.g. Emulex tc-11) # ts* unibus ts11 # mt* massbus tu78 # ut* unibus tu45 emulations (e.g.si 9700) # uu* tu58 cassettes on dl11 controller # Disks: # hp* massbus rm?? # hk* unibus rk06 and rk07 # up* other unibus devices (e.g. on Emulex sc-21v controller) # ra* unibus uda50 w/ ra?? # rl* unibus rl02 # rb* 730 idc w/ rb80 and/or rb02 # rx* unibus rx211 floppy disk # Terminal multiplexors: # dz* unibus dz11 and dz32 # dh* unibus dh11 and emulations (e.g. Able dmax, Emulex cs-11) # dmf* unibus dmf32 # dhu* unibus dhu11 # dmz* unibus dmz32 # Pseudo terminals: # pty* set of 16 master and slave pseudo terminals # Printers: # ct* unibus parallel interface to CAT typesetter # lp* unibus lp11 parallel interface # va* unibus varian parallel interface # vp* unibus versatec parallel interface # Call units: # dn* unibus dn11 and emulations (e.g. Able Quadracall) # Special purpose devices: # ik* unibus interface to ikonas frame buffer # ps* unibus interface to e&s picture system 2 # ad* unibus interface to data translation a/d converter # np* unibus ethernet co-processor interface, for downloading. umask 77 for i do case $i in std) /etc/mknod console c 0 0 /etc/mknod drum c 7 0 ; chmod 640 drum ; chgrp kmem drum /etc/mknod floppy c 8 0 /etc/mknod crl c 35 0 /etc/mknod tu0 b 8 0 /etc/mknod tu1 b 8 1 /etc/mknod kUmem c 3 3 ; chmod 600 kUmem ;: untested /etc/mknod kmem c 3 1 ; chmod 640 kmem ; chgrp kmem kmem /etc/mknod mem c 3 0 ; chmod 640 mem ; chgrp kmem mem /etc/mknod null c 3 2 ; chmod 666 null /etc/mknod tty c 2 0 ; chmod 666 tty /etc/mknod klog c 33 0 ; chmod 600 klog ;; ht*|tm*|ts*|mt*|ut*) umask 0 ; unit=`expr $i : '..\(.*\)'` case $i in ht*) blk=1; chr=5 ;; tm*) blk=5; chr=14;; ts*) blk=6; chr=16;; mt*) blk=7; chr=19;; ut*) blk=10; chr=17;; esac case $unit in 0|1|2|3|4|5|6|7) four=`expr $unit + 4` ; eight=`expr $unit + 8` twelve=`expr $unit + 12`; twenty=`expr $unit + 20` /etc/mknod mt$unit b $blk $unit /etc/mknod mt$four b $blk $four /etc/mknod mt$eight b $blk $eight /etc/mknod mt$twelve b $blk $twelve /etc/mknod nmt$unit b $blk $four ;: sanity w/pdp11 v7 /etc/mknod nmt$eight b $blk $twelve ;: ditto /etc/mknod nrmt$unit c $chr $four ;: sanity w/pdp11 v7 /etc/mknod nrmt$eight c $chr $twelve ;: ditto /etc/mknod rmt$unit c $chr $unit /etc/mknod rmt$four c $chr $four /etc/mknod rmt$eight c $chr $eight /etc/mknod rmt$twelve c $chr $twelve if [ $i = ut ] then /etc/mknod mt$twenty b $blk $twenty /etc/mknod rmt$twenty c $chr $twenty fi ;; *) echo bad unit for tape in: $1 ;; esac umask 77 ;; hp*|hk*|up*|ra*|rl*|rb*) umask 2 ; unit=`expr $i : '..\(.*\)'` case $i in hp*) name=hp; blk=0; chr=4;; hk*) name=hk; blk=3; chr=11;; up*) name=up; blk=2; chr=13;; ra*) name=ra; blk=9; chr=9;; rb*) name=rb; blk=11; chr=23;; rl*) name=rl; blk=14; chr=32;; esac case $unit in 0|1|2|3|4|5|6|7|8|9|10|11|12|13|14|15|16|\ 17|18|19|20|21|22|23|24|25|26|27|28|29|30|31) /etc/mknod ${name}${unit}a b $blk `expr $unit '*' 8 + 0` /etc/mknod ${name}${unit}b b $blk `expr $unit '*' 8 + 1` /etc/mknod ${name}${unit}c b $blk `expr $unit '*' 8 + 2` /etc/mknod ${name}${unit}g b $blk `expr $unit '*' 8 + 6` /etc/mknod r${name}${unit}a c $chr `expr $unit '*' 8 + 0` /etc/mknod r${name}${unit}b c $chr `expr $unit '*' 8 + 1` /etc/mknod r${name}${unit}c c $chr `expr $unit '*' 8 + 2` /etc/mknod r${name}${unit}g c $chr `expr $unit '*' 8 + 6` if [ $name != hk ] then /etc/mknod ${name}${unit}d b $blk `expr $unit '*' 8 + 3` /etc/mknod ${name}${unit}e b $blk `expr $unit '*' 8 + 4` /etc/mknod ${name}${unit}f b $blk `expr $unit '*' 8 + 5` /etc/mknod0OlV  D D ˚0 ${name}${unit}h b $blk `expr $unit '*' 8 + 7` /etc/mknod r${name}${unit}d c $chr `expr $unit '*' 8 + 3` /etc/mknod r${name}${unit}e c $chr `expr $unit '*' 8 + 4` /etc/mknod r${name}${unit}f c $chr `expr $unit '*' 8 + 5` /etc/mknod r${name}${unit}h c $chr `expr $unit '*' 8 + 7` fi chgrp operator ${name}${unit}[a-h] r${name}${unit}[a-h] chmod 640 ${name}${unit}[a-h] r${name}${unit}[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; rx*) unit=`expr $i : '..\(.*\)'` name=rx; chr=30; blk=12; case $unit in 0|1|2|3|4|5|6|7) /etc/mknod ${name}${unit} b $blk `expr $unit '*' 8 + 0` /etc/mknod r${name}${unit}a c $chr `expr $unit '*' 8 + 0` /etc/mknod r${name}${unit}b c $chr `expr $unit '*' 8 + 1` /etc/mknod r${name}${unit}c c $chr `expr $unit '*' 8 + 2` /etc/mknod r${name}${unit}d c $chr `expr $unit '*' 8 + 3` ;; *) echo bad unit for floppy disk in: $i ;; esac ;; uu*) unit=`expr $i : '..\(.*\)'` name=uu; blk=13; case $unit in 0|1|2|3) /etc/mknod ${name}${unit} b $blk `expr $unit '*' 2 + 0` /etc/mknod ${name}${unit}a b $blk `expr $unit '*' 2 + 1` ;; *) echo bad unit for uu cassette in: $i ;; esac ;; dz*) unit=`expr $i : 'dz\(.*\)'` case $unit in 0|1|2|3|4|5|6|7) eval `echo $unit | awk ' { u = $1 } END { for (i = 0; i < 8; i++) printf("/etc/mknod tty%02d c 1 %d; ",u*8+i,u*8+i); }'` ;; *) echo bad unit for dz in: $i ;; esac ;; dhu*|dh*|dmf*|dmz*) case $i in dmz*) name=dmz; major=37; count=24; unit=`expr $i : "$name\(.*\)"` case $unit in 0) ch=a ;; 1) ch=b ;; 2) ch=c ;; 3) ch=e ;; 4) ch=f ;; 5) ch=g ;; *) echo bad unit for $name in: $i ;; esac;; dmf*) name=dmf; major=22; count=8; unit=`expr $i : "$name\(.*\)"` case $unit in 0) ch=A ;; 1) ch=B ;; 2) ch=C ;; 3) ch=E ;; 4) ch=F ;; 5) ch=G ;; 6) ch=H ;; 7) ch=I ;; *) echo bad unit for $name in: $i ;; esac;; dhu*) name=dhu; major=34; count=16; unit=`expr $i : "$name\(.*\)"`; case $unit in 0) ch=S ;; 1) ch=T ;; 2) ch=U ;; 3) ch=V ;; 4) ch=W ;; 5) ch=X ;; 6) ch=Y ;; 7) ch=Z ;; *) echo bad unit for $name in: $i ;; esac;; dh*) name=dh; major=12; count=16; unit=`expr $i : "$name\(.*\)"` case $unit in 0) ch=h ;; 1) ch=i ;; 2) ch=j ;; 3) ch=k ;; 4) ch=l ;; 5) ch=m ;; 6) ch=n ;; 7) ch=o ;; *) echo bad unit for $name in: $i ;; esac;; esac eval `echo $ch $unit $major $count | awk ' { ch = $1; u = $4 * $2; m = $3; cnt = $4 } END { for (i = 0; i < cnt; i++) if (i < 10) printf("/etc/mknod tty%s%x c %d %d; ",ch,i,m,u+i); else printf("/etc/mknod tty%s%c c %d %d; ",ch,87+i,m,u+i); }'` ;; lp*|va*|vp*) case $i in lp*) name=lp; major=15;; va*) name=va; major=10;; vp*) name=vp; major=6;; esac unit=`expr $i : "$name\(.*\)"` case $unit in 0|1|2|3|4|5|6|7) /etc/mknod $i c $major $unit; chmod 666 $i ;; *) echo bad unit for $name in: $i ;; esac ;; pty*) class=`expr $i : 'pty\(.*\)'` case $class in 0) offset=0 name=p;; 1) offset=16 name=q;; 2) offset=32 name=r;; 3) offset=48 name=s;; 4) offset=64 name=t;; 5) offset=80 name=u;; *) echo bad unit for pty in: $i;; esac case $class in 0|1|2|3|4|5) umask 0 eval `echo $offset $name | awk ' { b=$1; n=$2 } END { for (i = 0; i < 16; i++) printf("/etc/mknod tty%s%x c 20 %d; \ /etc/mknod pty%s%x c 21 %d; ", \ n, i, b+i, n, i, b+i); }'` umask 77 ;; esac ;; np*) class=`expr $i : 'np\(.*\)'` case $class in 0) offset=0 name=0;; 1) offset=16 name=1;; 2) offset=32 name=2;; *) echo bad unit for pty in: $i;; esac case $class in 0|1|2) eval `echo $offset | awk ' { b=$1 } END { for (i = 0; i < 4; i++) printf("/etc/mknod np%02d c 39 %d;", \ b+i, b+i); }'` ;; esac ;; dn*|ik*|ps*|ad*|ct*) unit=`expr $i : '..\(.*\)'` case $i in ct*) name=ct; chr=18;; dn*) name=cu; chr=24;; ps*) name=ps; chr=27;; ad*) name=ad; chr=29;; ik*) name=ik; chr=31;; esac case $unit in 0|1|2|3|4|5|6|7) umask 0 /etc/mknod ${name}${unit} c ${chr} ${unit} umask 77 ;; *) echo bad unit for ${name} in: $i ;; esac ;; local) sh MAKEDEV.local ;; esac done 0Ul ; YŸ YŚ0rm -f swap; ln hk1a swap chgrp kmem swap chmod 640 swap rm -f ttyi6 ttyd0; mknod ttyd0 c 3 22 rm -f ttyi7 ttyd1; mknod ttyd1 c 3 23 rm -f ttyi8 ttyd2; mknod ttyd2 c 3 24 rm -f ttyi9 ttyd3; mknod ttyd3 c 3 25 rm -f ttyia ttyd4; mknod ttyd4 c 3 26 rm -f ttyic ttyd5; mknod ttyd5 c 3 156 rm -f ttyh1 dir-shasta; mknod dir-shasta c 3 1 rm -f ttyh6 dir-rose; mknod dir-rose c 3 6 rm -f ttyh7 dir-namsan; mknod dir-namsan c 3 7 rm -f ttyid dir-ps; mknod dir-ps c 3 157 rm -f ttyie cua0; mknod cua0 c 3 158 rm -f ttyif dir-scgl; mknod dir-scgl c 3 159 chown uucp dir-* chmod 660 dir-* # Cua* can't be owned by anyone real who wants to use the dialer if the mode # 060 below and the dialer group is to work. Note that the uucp programs # must be in the dialer group. chown 32767 cua* chgrp dialer cua* chmod 060 cua* 0Wlꁕ %//˚0#!/bin/sh - # # Copyright (c) 1980 Regents of the University of California. # All rights reserved. The Berkeley software License Agreement # specifies the terms and conditions for redistribution. # # @(#)MAKEDEV 4.27.2 (2.11BSD GTE) 1995/06/17 # # Device "make" file. Valid arguments: # std standard devices # local configuration specific devices # Tapes: # ht* unibus tu77 & te16 # tm* unibus tm11 & te10 emulations (e.g. Emulex tc-11) # ts* unibus ts11 # tu* tmscp (tk50/tu81) # Disks: # br* unibus Eaton br1538 or br1711 # hk* unibus rk06 and rk07 # ra* unibus uda50 w/ ra?? # rk* unibus rk05 # rl* unibus rl01/rl02 # rx* unibus rx02 # si* unibus cdc 9766 w/ si 9500 # xp* unibus rm02/03/05, rp04/05/06, diva, eagle, cdc9766, fuji 160. # Terminal multiplexors: # dl* dl-11 units other than the console # dz* unibus dz11 and dz32 # dh* unibus dh11 and emulations (e.g. Able dmax, Emulex cs-11) # dmf* unibus dmf32 # dhu* unibus dhu11 # dmz* unibus dmz32 # dhv* qbus dhv11 # Pseudo terminals: # pty* set of 16 master and slave pseudo terminals # Printers: # lp* unibus lp11 parallel interface # va* unibus varian parallel interface # vp* unibus versatec parallel interface # Call units: # Special purpose devices: # dr* unibus dr11 # ram* memory disk # dn* dn11 dialer # ingreslock Ingres lock driver. umask 77 for i do case $i in std) /etc/mknod console c 0 0 # /etc/mknod kUmem c 1 3 ; chmod 600 kUmem ;: untested /etc/mknod kmem c 1 1 ; chmod 640 kmem ; chgrp kmem kmem /etc/mknod mem c 1 0 ; chmod 640 mem ; chgrp kmem mem /etc/mknod null c 1 2 ; chmod 666 null /etc/mknod tty c 9 0 ; chmod 666 tty /etc/mknod klog c 22 0 ; chmod 600 klog ;; ht*|tm*|ts*|tu*) umask 0 ; ctlr=`expr $i : '..\(.*\)'` ctlr=`expr $ctlr '*' 64` case $i in ht*) blk=0; chr=6;; tm*) blk=1; chr=7;; ts*) blk=2; chr=8;; tu*) blk=12; chr=23;; esac # Maximum of 4 controllers in a system case $ctlr in 0|64|128|192) # Maximum of 4 units per controller # for unit in 0 1 2 3 for unit in 0 1 do zero=`expr $ctlr + $unit + 0` four=`expr $zero + 4` ; eight=`expr $zero + 8` twelve=`expr $zero + 12` sixteen=`expr $zero + 16` twenty=`expr $zero + 20` twentyfour=`expr $zero + 24` twentyeight=`expr $zero + 28` /etc/mknod mt$zero b $blk $zero /etc/mknod mt$four b $blk $four /etc/mknod mt$eight b $blk $eight /etc/mknod mt$twelve b $blk $twelve /etc/mknod nmt$zero b $blk $four ;: v7 compatibility /etc/mknod nmt$eight b $blk $twelve ;: ditto /etc/mknod nrmt$zero c $chr $four ;: ditto /etc/mknod nrmt$eight c $chr $twelve ;: ditto /etc/mknod rmt$zero c $chr $zero /etc/mknod rmt$four c $chr $four /etc/mknod rmt$eight c $chr $eight /etc/mknod rmt$twelve c $chr $twelve if [ `expr $i : '\(..\)'` = tu ] then /etc/mknod mt$sixteen b $blk $sixteen /etc/mknod mt$twenty b $blk $twenty /etc/mknod mt$twentyfour b $blk $twentyfour /etc/mknod mt$twentyeight b $blk $twentyeight /etc/mknod nmt$sixteen b $blk $twenty ;: v7 compatibility /etc/mknod nmt$twentyfour b $blk $twentyeight ;: ditto /etc/mknod nrmt$sixteen c $chr $twenty ;: ditto /etc/mknod nrmt$twentyfour c $chr $twentyeight ;: ditto /etc/mknod rmt$sixteen c $chr $sixteen /etc/mknod rmt$twenty c $chr $twenty /etc/mknod rmt$twentyfour c $chr $twentyfour /etc/mknod rmt$twentyeight c $chr $twentyeight fi if [ `expr $i : '\(..\)'` = ut ] then /etc/mknod mt$twenty b $blk $twenty /etc/mknod rmt$twenty c $chr $twenty fi done ;; *) echo bad controller for tape in: $1 ;; esac umask 77 ;; rk*) # The 2.11BSD rk driver doesn't support partitions. We create # a single block and charater inode pair for each unit and # call it rkNh. umask 2 ; unit=`expr $i : '..\(.*\)'` case $i in rk*) name=rk; blk=6; chr=15;; esac /etc/mknod ${name}${unit}h b ${blk} ${unit} /etc/mknod r${name}${unit}h c ${chr} ${unit} chgrp operator ${name}${unit}h r${name}${unit}h chmod 640 ${name}${unit}h r${name}${unit}h ;; rx*) umask 2 name=rx; blk=8; chr=17 mknod ${name}0a b ${blk} 0 mknod ${name}1a b ${blk} 1 mknod ${name}0b b ${blk} 2 m0\l~ %//˚0knod ${name}1b b ${blk} 3 mknod r${name}0a c ${chr} 0 mknod r${name}1a c ${chr} 1 mknod r${name}0b c ${chr} 2 mknod r${name}1b c ${chr} 3 chgrp operator ${name}[01][ab] r${name}[01][ab] chmod 640 ${name}[01][ab] r${name}[01][ab] ;; ram*) # Note, this must come *before* the "ra*". The entry "rram" is for # auto fscks when ram is mentioned in /etc/fstab. umask 2 /etc/mknod ram b 3 0 ln ram rram chgrp operator ram chmod 640 ram umask 77 ;; br*|hk*|ra*|si*|xp*|rl*) umask 2 ; unit=`expr $i : '..\(.*\)'` case $i in br*) name=rp; blk=11; chr=20;; hk*) name=hk; blk=4; chr=13;; ra*) name=ra; blk=5; chr=14;; si*) name=si; blk=9; chr=18;; xp*) name=xp; blk=10; chr=19;; rl*) name=rl; blk=7; chr=16;; esac case $unit in 0|1|2|3|4|5|6|7|8|9|10|11|12|13|14|15|16|\ 17|18|19|20|21|22|23|24|25|26|27|28|29|30|31) /etc/mknod ${name}${unit}a b $blk `expr $unit '*' 8 + 0` /etc/mknod ${name}${unit}b b $blk `expr $unit '*' 8 + 1` /etc/mknod ${name}${unit}c b $blk `expr $unit '*' 8 + 2` /etc/mknod ${name}${unit}d b $blk `expr $unit '*' 8 + 3` /etc/mknod ${name}${unit}e b $blk `expr $unit '*' 8 + 4` /etc/mknod ${name}${unit}f b $blk `expr $unit '*' 8 + 5` /etc/mknod ${name}${unit}g b $blk `expr $unit '*' 8 + 6` /etc/mknod ${name}${unit}h b $blk `expr $unit '*' 8 + 7` /etc/mknod r${name}${unit}a c $chr `expr $unit '*' 8 + 0` /etc/mknod r${name}${unit}b c $chr `expr $unit '*' 8 + 1` /etc/mknod r${name}${unit}c c $chr `expr $unit '*' 8 + 2` /etc/mknod r${name}${unit}d c $chr `expr $unit '*' 8 + 3` /etc/mknod r${name}${unit}e c $chr `expr $unit '*' 8 + 4` /etc/mknod r${name}${unit}f c $chr `expr $unit '*' 8 + 5` /etc/mknod r${name}${unit}h c $chr `expr $unit '*' 8 + 7` /etc/mknod r${name}${unit}g c $chr `expr $unit '*' 8 + 6` chgrp operator ${name}${unit}[a-h] r${name}${unit}[a-h] chmod 640 ${name}${unit}[a-h] r${name}${unit}[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; dz*) unit=`expr $i : 'dz\(.*\)'` case $unit in 0|1|2|3|4|5|6|7) eval `echo $unit | awk ' { u = $1 } END { for (i = 0; i < 8; i++) printf("/etc/mknod tty%02d c 2 %d; ",u*8+i,u*8+i); }'` ;; *) echo bad unit for dz in: $i ;; esac ;; # # we may want dmz and dmf someday... # dhu*|dh*|dmf*|dmz*) dhv*|dhu*|dh*) case $i in # dmz*) name=dmz; major=37; count=24; # unit=`expr $i : "$name\(.*\)"` # case $unit in # 0) ch=a ;; 1) ch=b ;; 2) ch=c ;; 3) ch=e ;; # 4) ch=f ;; 5) ch=g ;; # *) echo bad unit for $name in: $i ;; # esac;; # dmf*) name=dmf; major=22; count=8; # unit=`expr $i : "$name\(.*\)"` # case $unit in # 0) ch=A ;; 1) ch=B ;; 2) ch=C ;; 3) ch=E ;; # 4) ch=F ;; 5) ch=G ;; 6) ch=H ;; 7) ch=I ;; # *) echo bad unit for $name in: $i ;; # esac;; dhv*) name=dhv; major=24; count=8; unit=`expr $i : "$name\(.*\)"`; case $unit in 0) ch=S ;; 1) ch=T ;; 2) ch=U ;; 3) ch=V ;; 4) ch=W ;; 5) ch=X ;; 6) ch=Y ;; 7) ch=Z ;; *) echo bad unit for $name in: $i ;; esac;; dhu*) name=dhu; major=4; count=16; unit=`expr $i : "$name\(.*\)"`; case $unit in 0) ch=S ;; 1) ch=T ;; 2) ch=U ;; 3) ch=V ;; 4) ch=W ;; 5) ch=X ;; 6) ch=Y ;; 7) ch=Z ;; *) echo bad unit for $name in: $i ;; esac;; dh*) name=dh; major=3; count=16; unit=`expr $i : "$name\(.*\)"` case $unit in 0) ch=h ;; 1) ch=i ;; 2) ch=j ;; 3) ch=k ;; *) echo bad unit for $name in: $i ;; esac;; esac eval `echo $ch $unit $major $count | awk ' { ch = $1; u = $4 * $2; m = $3; cnt = $4 } END { for (i = 0; i < cnt; i++) if (i < 10) printf("/etc/mknod tty%s%x c %d %d; ",ch,i,m,u+i); else printf("/etc/mknod tty%s%c c %d %d; ",ch,87+i,m,u+i); }'` ;; # extra DL-11 units not including the console. unit numbers start at 1 because # the console is always unit 0. Seven units (1 - 7) are defined for the 11/93 # and 11/94. Device name is "ttyl?". The DH range was restricted from 'h'-'o' # to 'h' - 'k' (very unlikely that more than 64 channels of DH-11 will or could # be put on an 11. dl*) name=dl; major=0; ch=l unit=`expr $i : "$name\(.*\)"` case $unit in 1|2|3|4|5|6|7) /etc/mknod tty${ch}${unit} c $major $unit; ;; *) echo bad unit for $name in: $i ;; esac ;; # we may want va and vp someday... # lp*|va*|vp*) lp*|dn*) case $i in lp*) name=lp; major=5;; dn*) name=dn; major=21;; # va*) name=va; major=10;; # vp*) name=vp; major=6;; esac unit=`expr $i : "$name\(.*\)"` case $unit in 0|1|2|3|4|5|6|7) /etc/mknod $i c $major $unit; chmod 666 $i ;; *) echo bad unit for $name in: $i ;; esac ;; pty*) class=`expr $i : 'pty\(.*\)'` case $class in 0) offset=0 name=p;; 1) offset=16 name=q;; 2) offset=32 name=r;; 3) offset=48 name=s;; 4) offset=64 name=t;; 5) offset=80 name=u;; *) echo bad unit for pty in: $i;; esac case $class in 0|1|2|3|4|5) umask 0 eval `echo $offset $name | awk ' { b=$1; n=$2 } END { for (i = 0; i < 16; i++) printf("/etc/mknod tty%s%x c 11 %d; \ /etc/mknod pty%s%x c 10 %d; ", \ n, i, b+i, n, i, b+i); }'` umask 77 ;; esac ;; dr*) unit=`expr $i : '..\(.*\)'` case $i in dr*) name=dr; chr=12;; esac case $unit in 0|1|2|3|4|5|6|7) umask 0 /etc/mknod ${name}${unit} c ${chr} ${unit} umask 77 ;; *) echo bad unit for ${name} in: $i ;; esac ;; ingreslock) mknod ingreslock c 25 0 chown ingres ingreslock chmod 200 ingreslock ;; local) sh MAKEDEV.local ;; esac done 0c!l~@BDFH<0k<0k0 HP v%wTTTTTTz7GGGwF7 7 7 7F7F 7 F    nFF  T  @F  tF0 5^F0< x  f ~\Sx   B~z FFFFB  *E E8E EE ,E tE HEU@`# E@`|E -tEF (VE <7FESe~& EE@7EU4D E& ~  D&f   Dw TDD& Wp (H wHDw 4DD& Wp (H w(Dw DD Wp *HwDw CD Wp ,HwCw CDN& Wp 2H wCw CD Wpu0H Wpu(H Wpu&H@ O xHNf& !%wvCNf& edex G r2 2    )Ie F &<:tv 1I w BwBw B5 JB-CJ BH@5  Wp%.H"WpA.H@ @`H-WpA.H@ @` WpA.H@ @`HWpA.H@ @`%J E^Bt7PTB7TB JBtE5:BE50Bff&BBWpf&HHIBJ eAWpN&Hfej F Kfej F A fej F  Kfej F N fej F  Kfej F N fej F  Kfej F ZA@ -\ALA5FA K Ne Nejfe F Nfe F NeK  Nejfe F Nfe F NeK  )fe C 5&Ne G fej ? @ae&fe xE%Nej Gfefej xE% fe   Wp<eCu & 8   %@ _@ tAAWt@PAAPWt@PA@\R7?WpA.H@AA @`7?Hm?7??HIK ew\?w H?D 7J 7J 7J 7J    %J%Jp@ 7J   1tS % t-VJJteJw> %8J;K  w >LK@5 _ eK _ % I%I> > ~ _  m xJ%II |e vBttIK |t@ c,_%I@ f&&fK e 1BIm@IK%.Im*I% II |e vWtWtB` tSK K  wT=@ f&fK &e%H  xJ% 0f%eC_ Nf  N w w8w 7D Be X %0h!l~@BDFH<0k<0k0%%d %u%o%x%o%x & %-%s  @ ! %D%O%D  %e%c ewD7w 07D - A@  5u& ff X5eu5vff %& ff z5eAKN w6w 6D`5t~ w6t tv%    tw ^6p5prE%  wH6w 46D ( N : #( @4 "% %  E     w5D-   D-ن    ^ R  C  !w T5DC3 X3 Ze v@55 @vlTlV@ 3\s^bed3` vedeEt`3 6> @ee xE%w4w 4D ̋7L  < ̥/ˋ ˥/ !!LN&  5Nf v K#L  N v ̋@w&4w 4D e 1L  W-Ct`55A@w3 5   eA@v5u@-A-uu   ff9L De@t`55 b V^@t5,,w5,.w%A@vmTmV@ 4\t^@ 4L`b v@tp.wp,w@ 5L@ &A@v Ct@m55  ffDL %_w H2D  C >><4fPL e e4E%@ <N G55 5 5Ne ( s-ef Fw1w 1D 2#>JE55 3v5uff He5u  ,A@vlTlV@ 2\r^ed2`b vCmedlL 2-@ w0w 0D wL I%Wp<CeS˵ ff /e5u˵^\vf@   sXsZA@vlTlV@ 3\s^3 b wF0w 20 % __#_AWp<DeS̵o b_ &Z&X 4.ev4\t^̵^\vf&& e5uvmTmV@ 4\t^ed4`b7 "P v &Z&X .eu̵A mXmZ@ 4 > t @@Z@m4b Ow/tb b@med4` beZt X ` `w .  5 BeN  w. %@w .D % @0C = @ ȥ @0-%Wp<BeSʵʵʵrbr` vA r 2`\r`^r \w-A lXlZ@ 2 > r @@Z5C e = ~@w -D%C@   @-*%Wp<BeSʵʵrbr` A r 2`\r`^r \w-w -5 AWp<S  %~L AWp<CeSD ̥̋(̥( L7eL1 &H f Fԕ( &H r3 5 AWp ue5` ̥0̥9ԥ, L  w>,5 AWp ue5` ̥0̥9̥) H,sPsR $̥,5 AWp ue5` ̥0̥9ssPsRԥ)%P%R  ̋@ &  5 Lf v @ U 3 X3 Z3 b3 \3 ^@e_w +D % Wp<CeS˵w+˵  w *L w*w *NL  w% h WpAhmb@w JD  @ 5 4 bN& ( @   ww D55PWpBeh w@ O@O_, 55Nefee %E% fO es5 E% fO es5@E%@ fO e f ,% N6O  _+@0Or@t@mO  f ,% NfBO %_+@t@m0O , R2R2 2  %f ,%2 _+w .DWpCeh3 3 3 3P %& ,%ww DWpCehNefee %s se 3Nefee %ss e383 sspUpU 3  5O O5( 3 5 3 e@U @ 5 E%:  O&QO % wNf&kO e w D55PWpCehe2^ 2\"r2bNefe&` %rr %!"f ,%  w  9bw D WpCeh  w  @ 55 3 3 3PsNU%& ,%w D ed wtmPPw, O 2Pp N 5 &  %tmPPwRWp `@4|T4~V w @tA@lP0Pw ww D Oed5\5^3P5@ ˕.& ff eu.& ff eu@( 5@( 5Nefe&` %s@t@m3sb 3@tU5%U8%U0K55@ fff&P&tP ewbw ~ @ OE5 _43 xNPO%%E@EA@,P9@E _~3 _v3 _3 _f3 _n3 _3N@&P@&Q e(Q @PBed&2 02 22 x2 z2(2*2.2,2F DGQe F wZO_1O_1O_1O_1O_1`w @3P 4 4 4 tpt& & Re4 t &&P e_1N@&P@&P eP @P_1O_"2O_"2P_"2P_"2$P_"22P_"2w 4D5\5^5P ff leu ff euNefe&` % LQ@t AWt@P@]2 rb 2CtU%UU5 ff&P&RQ e wNbw 4N  w2w D 5P5 zQAWpBeQNefe&` % &^&\ 0er &^&\ jevr2brr@t2%U U @ `  @5Et5 @ t@]U@t@]U3@tU @ `(Wt@2,5t\3 v st\ 5 +5@ @tU 5E &ffQ ewZ lr 2  _\5bw "DedR%P   7& wWp `@4|T4~V w @5P5WpDeQ zQ@ a Q5  @tU 5E% %% NfQ %5@ aP@ a(@tU 5@ aWtEHww DedWpmP @5Q sxsz(*(.(sp*f& ff es,s0s2 wvw bD5P Rt@m 5jt@m 5jM@tU 35  55@ NR %w5 5t@m pjt@m pjAup @ f&&^&\ euAup @ f&&^&\ euA 5r5A 5ruNefe&` %@t3@t@]3 s sb 3s@tU5%UUs]5 ffffR e _8b_8w b N  w` w L DP5 5HR@t`1k.@t` 0 j@55@5 @t` j@t`1k5\5^@ 5@@t` jU=5@5@ @t` jU=5B ff euB ff euA r5A ruNefe&` %@p@AWtA]p@p@b  p@t` jAWt@PU%U%U55@ @&ffffNR ew@ bw & N  w$ w  D5P |R5\5^` ff < eu` ff v euA r 5A r unw  E?% nwnwnw 5Nefe&` %@t @m2@t@m2rb 2@tU5%U%UJ55  ffffR ew bw N  w w D ed555P wh @ RAWpBepw@xU  8B%  8B% Nefee %s  8B% s@ 8B%  <@NR  @x@t@mt x  x ?%&  %_n>RWp Am@4|T4~V _r>w *DtmPt0 x0 x ww DP <@ R %wWpfw& WpAw@ vee@ f&t`txx w  @5@5PAWpCepw@ 5Rs\sX3 b@@PNefee %s@U3 NefeeT %s @U3ue  N@5L5  N@5=5 3 3 @U  @   &EfR eU 5&  ffR e  @fS %w&w DWpepwuCePNefe&` %3^ 3\"3bss%!" <@wbw D t= w N %N&S %w T Ded@tA@lPt5x5xAWpewutxtzN <@@P@&?S %w@4((Af,AA*Vpt*(tp*t.&.& ff et,@"Et AA WtE@P5@ E5ef C f C N  f C ˥  w @AWp tEe@wЋ Ћ W f r @  W f r@  @ C& eJ  C@C eJ   6v   6v   6vb"  E6P6 EP ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5b   6v&  @ppC`p   6@CЋ P ы A@PЋ  ~5 & E        ~5*'$!       7 & A & BF7!f W- H7R IS5]I#".#XND#I%Z%D%N&'I(n'(N* I I~:<HRIA<>?RvBI34LQI46zQ7II<&>|RI08//OL1"Ih8h:R%I*.*,O. hTxhttmtsramhkrarkrlrxsixpbrtmsDEFAULTdevlabel: bad fnc %d Boot@ `                             II II*J v d v > 8unixbad majorno free csr slots %d%s from %s(%d,%d,%d) at 0%o (,,): : %s : %s %s: bootdev=0%o bootcsr=0%o Bad magic # 0%o Base too small, %dK min Can't load split I&D files TextDataOverlayseg type botch: %d %s %d over by %D bytes%s over by %D bytescopyunix: bad seg type %d 0123456789ABCDEF,k,o,s@tznull path .%s not found bn < 0 bn ovf %D bn void %D %s: !directory,mode %o size: %D ip %o lseek No file slotsBad device Unknown device Bad offset or ctlr, unit, part out of bounds Can't write files Exit called%s Trap in %s,bus errorillegal instructionbpt/traceiotpower failemtsys/trapweird at loc %o registers: r0=%o, r1=%o, ps=%o, nps=%o %s%d csr[0%o]: Bad PSL mode%s%d,%d: error reading labelsector %s%d,%d disklabel missing or corrupt %s%d,%d%c bad partition # or size = 0 %s: error writing labelsector warning: partition '%c' overlaps '%c' ht%d,%d err: cs2=%o, er=%o (FATAL ERROR) P` ` tm%d,%d err: er=%o cs=%o (FATAL ERROR) P ts%d,%d err sr=%o xs0=%o xs1=%o xs2=%o xs3=%o (FATAL ERROR) @tms%d: step %d failed sa=0%o tms%d STCONtms%d,%d ONLINtms%d: Fatal error sa=%o tms%d,%d: I/O err 0%o op=0%o mod=0%o /2v@ 2a7 `7` /K( w7@ 7` 7 ` J0 U112432222434343434343434343432xp%d,%d err cy=%d tr=%d sc=%d cs2=%o er1=%o type: RM02 c=%d t/c=%d s/t=%d xp%d,%d unknown drive type: %d -- using 1 cyl, 1 trk, 2 sec/trk xp%d,%d unknown SI drive model %d -- using 1 cyl, 1 trk, 2 sec/trk SMDRK%d,%d err cy=%d sc=%d, er=%o, ds=%o rl%d,%d err cy=%d, hd=%d, sc=%d, rlcs=%o, rlmp=%o Can't get rl%d,%d sts br%d,%d !ready br%d err: cy=%d tr=%d sc=%d er=%o ds=%o hk%d,%d err: cy=%d tr=%d sc=%d cs2=%d er=%o si%d,%d err cy=%d hd=%d sc=%d cnr=%o, err=%o hra%d STCON err ra%d,%d: !online ra%d: rsp %x op %x ignored ra%d,%d: err op=%x sts=%x ra%d: rasa=%o RA(%o) failed step %d. retrying ra%d,%d M_OP_GTUNT failed !)39T>CFOHW]cjmou{Nz H|~vv  #&, 69=CILOT]djlnrx}j8   !&+14 =@BKT]bjox|l  v,k ,o(,s0L3,w;vBvIKNQU[afkmoqx(  !%8+15;=B6IOSY[`fjnqsvy~  Nb C G N Q T W Z ^ c 4k n 4s 4           6    7       7    h8 h8    ! % ( + . 3 : A E I N h:V Y ~:^ ~:j m r w {         <  < nw <             &>  <> pw x x <> " ) / 2 4 9 > B G ?P S ?\ _ d i <@p s v y ~       A       8B     vB         C C    C D! ZD) D1 D8 4E@ xEH 2FO ^FV F] Ff Fo Fx G G \G $x " " #H #H #H #H #H #H #H #\S #H " " " "" ": "F "R$ "* # H4 #H> $\SJ #&HQ "#] ""e ".#n #XNu "~ "D# "% "Z% "D% #N "&' "( "n' "( #N "* "~: "< #HR "A"<> "?#R"vB&"32"4:#LQA"4M"6U#zQ\"7e"<q"&>y#|R"0"8/"/#O"L1"h8"h:#R"*."*",#O".#H #H"v"G"G#"-"6"@"I" S"!_"j"Gq"Fy"$^S$`S#HI#NI#PI$bS$rS#I#I#I#I#*J#J""F"" "C"G"xE "&$S+"2"8 ="D"J"|P" Z" c"j"s"{"2F"F"l"("F$h""8"6"""N"b"D"tD""D"!"! "%#N$h $h($h0$h8$hC$hJ#OV#Oc",m"Dr"8Dw"^F|#Q"7$j$j$j$k"8B"<@"?"N$@ ? B ` 3`!Z /  &  v p d ^ pR  ! F X:ff '%5%  5`    7 % w/a 8e P? 7`xx% d ? 5+%4 '/H#B$8 8e, P?e+7:%6   ? 5  6   xF% N N&  5N Cw@D5 Nemdf Ce ) 6% N  2  Z .% *& @& ^% % ZN* %:@& = 5@ 6f Vf %%@5 % *f@& ^%N* %*lP~ Z _nNemdf Ce _n<_N @elP~% *& @& ^%N* %AelP~ Z _H_nw HBDN  NM =% ClP~ h / jd! 8e! >? !*&e pC  f&e 6%wAw AD VWEVlWEn4 p 4p bfd؀f Ce %% %p w O/ 9    ˋ? N  8e  5r dN%T 8eH P? 7`| 8 ? 5( 6ff ?%   6Nef C W-+ N A_w t=D ]f =% %  d nf =%exf =eef =ef = 5Bf = 5Bf = 5Bf = f = &f =%(f =%*f =%.f =%,f =%:f =% <f =% =,f =% >;f =% ?Mf =%@mf =%f =  ta D F   taFDf&f 2e rf =%f = ex5 _@  _@f&@f&eaf J2e@ E% @ E  @ Ef =%@ E S xTAA EfAAVpN@&f =e&.& @f& F-ef&f 1e&.& @f& R-evG A@ ȕ*gf =%@5&@ A@,@*% A@ E;N@E&.N*)  A@ ȕ @5@ A@, @ % N `? &.& @f&@ee@ ee@ m.@ f& +eee@ f&*f 0e&.& @f& +ev?  A@ ȕ*3@5&@ A@,@*% A@ EN@E&N* `? 0f = e -r_r N @w 8w 70 ~730 = 5 05 =%w7@ & ' Nf 2 N HA=0I =%0 :g :* @  ߐ  ;%%  n  h d  ;% %n p G0 = 5fe pC Ne f V@Ae lP~Nf0#lhi  R0JR0J0 % 0 : _w 6& *%5u%C  = O 5J%  3  )ff h*%  3  3 6 0 %e 5 CNe ;!ff *%  w5w 5D ̥̋̋# w5w 5D ̥# ̋5 # wh5 w P5D5 5 tv_&  fe 8  Ne _&: 8 5 N =%_"= N 5 "?? Nf "? 4_&e%N @)5 %&ff +e t_& "?B5 5 BʋtB_& 5  "?U "?U "?Uf  =e 7 "?'5 ʋ_&%_& )f&@t aDF 5B_&NeA *%%  %NP =%r_"tr_& no "?f&ef&e 6%_&t "?z "?(N @)5   ff *e  Nf_t&_& "? N @)5  ff =e_"t(_& "?N @)5  fft._& "?N @)5  fft*_& "?N @)5  fft,_&2 "?N @)5  ff6_t:_&K "?N @)5  ffV_t<_&k "?N @)5 ffu_t=_& "?N @)5 ff_t>_& "?N @)5 ff_t?_& "?N @)5 ff_t@_&ʥa_ ʥz_ _ e5-rrf&f =e _"AWp aexuB 5 )5u f =e @pHB 5 )5u f> =e @ppB 5f "? @ p 1e%.肀 @)5  5 % qfa =e5 5 @p @ E K x`B 5 )@A1@ 1B 5 )5u@&& ff %e@A1 f =e Nfe D;% _z Z5` wf-w L-D5 & &(  ( * * =%w- , , =% ::  .(tp*t. 0 2&,& &.& $e40t2 t t  =% t& H +  v vO  =% v&  d %r &r %5 _|@ea5AWp Caex     @& e,0,2&2&0@&  "e bl@ 4 0t 2&2&0@&  "e 5-r-@ea5AWp Caex    fea@ e %@_w *i  = Nf f fff =e s  = w*w p*u z( N 5 Cw^*w J*   } S     e U ;       =e" Cw)w )D 5 rWp Baex5x@ @w)w )"Nfe `! w)" pC e5@e5}|:  e@-="Ne # 4@e5Ne # 5  f "?UB  f "?UB F# UB& "t*  "t(  "t,Ne # 5 f z$ &  e@4&*& &(& D ef& et.&,& &.&  ef& e40t2&  het4&  Tet6& ! @et8 $ *et: ' e@4<& * e@4=& - e@4>& 0 e@4?& 3 et@t 6 etv9fe >? <fe >? ?fe >? Bfe >? Efe >? `exa&@55555Ne " s%&%" 3 e i@e4rHfe >? eD50iNe "3s& fe es & fe  f& e@3 & fe Re@3 Nefe # 5 . f z$ 3 uu& fe ef&@e5VWEVlWEn_w F% 5 wt K ? 5 $w$%D#j $N A @e!O $ N (" N AԐB-fef ?%5́ @a % D-Ԇ\ w ~$˥#%  ̋ ̋˥|˥:ˋ wX$˥:˥| ˋˋ˥: Dw $D̥: ̋ ̥:w$w #0 "ˋSˋAA@ ˥@@w#˥#  ˥05 5 & fe >ee 5`u`u A@w `# "̋T̋AA@ ̥̋:̥@ w,#w #R "̋T̋AA@ ̥@ w"̥= N& # w "DC=%::\  xJ EB X@  0teP Dw@"w ,"Df J5 @ N @)w"e @ w !k u N v65 P?5fe& >;%w!w !N "5u% %uuA@wb!&  @ppC`pLw !Nef % w!w !  65/f 8@Nevf& &%@ 6   w v@ev5xt%t t@t @aAt AmpxNev &  %ч 3Nfev &      w DCB̥:̋ ҕ/Ҕˋ ̋ w " ;ew.|w& w/w w- @m7zȥ- pl> ^-XR N7%:f 8 (0 ( " f z(  z( V B(  B( ?w ̥:7 **+ w- f z(  @m7~ x 9 E5 @@l ww ,DC E5<E@e33. @;E  5 , @;% & fE `? 5  @U3 3  w~w fD      + - ̥9 Wp @@`e̥0  w w D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  wA@w lfef G%5 wX w @Nef *%w8w $Neff *%ww D A555  ԋuNeffe *%ww DC 5 5 _*,%%_L,5 %*e5  AWp `eu 0u%l5  %h%[ 0e  _,Neffff ,e   * O  A@ EN ;5% % % %Nf r: &    %_+ A@ E%Nf r: @w6N ;5 w N%c%s%[Nf ff f& /ew5 5 5 5 %e%f %o%xDe5 5 A @ EN ;% % % %- Ԑ A @ EN ; _.%+_.  _.%a%f %A_.%F_. % A@vN ;O% A@v@mAm@ vA@v5u0 %a%fW7 5`u`u C% S P Ԑ A @ E =%%.%e%E- *% ' $ ! Ԑ A @ EN ;%+%-%0%9 A@  5u% N  r: =   @e! @e! _,@t@]   xNe 1A _,Ne 1A @H@pHw DC = 5%c%0u5 %s    ;%r%c5 %[r      ;%%   r: =  D- %cw w D ̥^   % %]%-+  $%-̥]4   ̠   %]  w*w D*\5% %-%+ 5 55 55  B5eA5 %.55  B5eA5  %E%e$%+%-  Wp B`e  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& ^3e5 55w\6 m 7"w $Nf 3 w"ww Nf 3 w~wrw 4De _"5 t4 t t4 4t Ne&& :% _"5t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 <5 55 Nefe :% & %5u7  && :%  fe :%ff % fe& :%wA@E f& w jwpw \DC ``Hԋ wJ``A@w &DCB   @mAmHԋ  @mAmA@ww D Lԋw!w<w De LN P?4e e v6  P?4e# Be v Nfe >;%wDw 0-^@ 8w*N%# 8%# ~ ~w  Nef 6 ww D 5  =& 49% `5ȥ=  = @wne  w N Nef 7@wBw ( f 7@w" w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef \9,5@ 'Ne \9 %ʕ/  f ?% %% wJNef \9ҕaʋʥzʕaw BuNefef G%=@@w Ћ Ћ   Ћ Ћ  Jҋ~ @@&w W f r @  W f r@  @ C& eJ L dC@C eJ  E6P6 EPw 4 D% 5     |@w 4-  wd Sw^ mowV n:lw@ e& 7 7gw w  & f 8;ew w yw &  4  b '     ` TW ~  s`K6!  w D85U5_=5P_=  m@e4 ,5Ne & C  uN C4USt%5x @5t @5& & ?% 45@e-4  % U5EU  w E w D  +   r= wB wr 5 a U5ff ?%ށ̥a &  ?e 3     U̥r 33w D5"E@e44fef G% @U4 4  fef G%5 wB    6v&  @ppC`p   6@Cw w7  ы A@PЋ w FD:5UE5Hw* _@5uNfe & $F% _@bNe & C  uN C)U5| m- 5 & $F%St% ~ C U   & $F% S U _? @_?w DE%%"5   & $F% U wv w ^D55@ @  A 3 BE 4 4 4 4 4 ww~w  ^$5+ < &5e-2e % &     4C ww  5f 4C 7 f 4C 7vwX@ m7%e w   x    4C e-\ww D H5 e %w$  5 e- w HA Bww  N *Fww rDCDpC C pC wZw FN BEwJ ~5 & E        ~5>wlYwfw Net@f Ce  w6w.w  $U7$U7$$Ae vB7   % 55 a  a!PE -%$ w$ E `e vWt vwd@ `e @  E%<8e U?&& `e 7$U?ߔ a7 ?U ew dDE wZw FD5 BE 5N C!w5A vBB-  }ee@ !ۃ `!ւ ` `$m& E%Էmԇ%w w7*'$!     > 74& A$& BF7!W-N7& & e Ӌ  &7& e ӕ-ӕ0B~ӕ.  ӕ0~ B~&7d & Le Jӕ-0 >ӕ.2 B~ӕe$ ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_I@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& `? z   5 , @ :% & f E `?  (˥-%0     ,:% &  `? 8 5E& z   5 , @ :% & f E `?  w&w Nefef 5& Le C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& Meww  fff 5& Meww  5 %O N  = $$555Ne5& Ne5t$55'0Ne5 B& Ne57l Be0" 5%t$55 5 B5@B e$$ a=%$$7$$w %t$5 B5Ne& Ne55e0%t$7`Jʕ0%$$ʕ1  %$$˕0 ʥ9 6@~ ltx}/tmp/EdDk.aXXXXXX*HzZ  &&&&unknownSMDMSCPold DECSCSIESDIST506floppyunusedswapVersion 6Version 7System V2.11BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660BNRWb:erw%s/r%s%c/dev%s/r%s/devioctl DIOCWLABELrioctl DIOCWLABEL%s: unknown disk type %s/%s/mdecioctl DIOCSDINFOioctl DIOCWLABELwriteioctl DIOCWDINFOdisklabel: %s: No disk label on disk; use "disklabel -r" to install initial label Label magic number or checksum is wrong! (disklabel or kernel is out of date?) Open partition would move or shrink Labeled partition or 'a' partition must start at beginning of disk Bad pack magic number (label is damaged, or pack is unlabeled) ioctl DIOCGDINFO%s/%suboot/mdec%s/%suboot/mdecboot > 512 bytes - filesystem likely not bootable# %s: type: %s type: %d disk: %.*s label: %.*s flags: removeable ecc badsect bytes/sector: %d sectors/track: %d tracks/cylinder: %d sectors/cylinder: %d cylinders: %d rpm: %d interleave: %d trackskew: %d cylinderskew: %d headswitch: %d # milliseconds track-to-track seek: %d # milliseconds drivedata: %ld %d partitions: # size offset fstype [fsize bsize] %c: %8ld %8ld %8.8s%8d %5d %5d %20.20s # (Cyl. %4ld- %ld) w%s: Can't create r%s: Can't reopen for reading re-edit the label? [y]: You have too many processes forkEDITOR/usr/ucb/viline %d: syntax error typeunknownline %d:%s %d Warning, unknown disk typeflagsremoveableeccbadsectline %d: %s: bad flag drivedata%ld partitionsline %d: bad # of partitions disklabelbytes/sectorline %d: %s: bad sector size sectors/trackline %d: %s: bad %s sectors/cylinderline %d: %s: bad %s tracks/cylinderline %d: %s: bad %s cylindersline %d: %s: bad %s rpmline %d: %s: bad %s interleaveline %d: %s: bad %s trackskewline %d: %s: bad %s cylinderskewline %d: %s: bad %s headswitchline %d: %s: bad %s track-to-track seekline %d: %s: bad %s line %d: bad partition name '%c' %d %d line %d: %s: bad partition size line %d: %s: bad partition offset line %d: %s %s Warning, unknown filesystem typeline %d: %s: Unknown disklabel field sector size %d sectors/track %d tracks/cylinder %d cylinders/unit %d revolutions/minute %dboot block size %d boot block size %% sector-size != 0super block size %d super block size %% sector-size != 0number of partitions (%d) > MAXPARTITIONS (%d)partition %c: size 0, but offset %ldpartition %c: offset past end of unit %ld %ld partition %c: extends past end of unit %ld %ld %ld unused partition %c: size %ld offset %ldWarning, disklabel: %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s usage: disklabel [-r] disk(to read label)or disklabel -w [-r] disk type [ packid ](to write label with existing boot program)or disklabel -e [-r] disk(to edit label)or disklabel -R [-r] disk protofile(to restore label with existing boot program)or disklabel -B [ -b bootprog ] disk [ type ](to install boot program with existing on-disk label)or disklabel -w -B [ -b bootprog ] disk type [ packid ](to write label and install boot program)or disklabel -R -B [ -b bootprog ] disk protofile [ type ](to restore label and install boot program)or disklabel [-NW] disk(to write disable/enable label)P X \ a i n s y $$$unknownSMDMSCPold DECSCSIESDIST506floppyunusedswapVersion 6Version 7System V2.11BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660b0tyremovablesimulatedsfntnsncdtdtscsurtrcacrmilskcshstssbpxbxfxoxtxdx/etc/disktabE^^\\::n r t bf disktab: /etc/disktab/etc/disktab /bin/shPATH:/bin:/usr/binsh: illegal option -- : option requires an argument -- ///////////////////  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~: Unknown error: %d 2<Vhz'7FWk%6Lf(Bd3Tm&H[h|"6LfyRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator. ((((( AAAAAABBBBBB $t$t$HdHoHxIfIeHg`IclIsHlHLHuHDHOHXHU=(\0$l걵r_SUWY[|0|0晚0  G(  e7cce7 /   7%  ;w >  a n w h @ A iff r %5% 5` n j @tef@t& < %  ;    f  @   ;w">w > @Nfe 7 Ne 7@ae5. 5 @AWt@` @AWt@`f 7 fe  @p-w=w |=L5 5 5 @e5Nfe 7 =f 4 5* & n 6  ;=fe 4 = @YuN 75bfef $ e5%05% @tef5 @tf& 3e N@t& < wr< Nfef $ e5%5@AWt@`5@ _ x@  " x 6 N 6% NU _N@& 6eU%&fe R N! 6%5&5&5&& r2e_ _N6%Neffefef De5_ _Nb%UN_| .@ ' xN 5@e5fNef P%@e5N & fefeffe <$e %( _    -N_|N_|N_|N Z!_5)@e5  N# 6%@@&@&f( 6e _5!@e5 :  lfV_@f&^_5,u   f \ fbNk  Nq 6%Nw_@ _ x   Nf{ 6eN  V N 6%Ne 2 Nef 6eN   N 6%ff_* fff /e @f&_*N_|N_|w 7 D5 5 5 u@5 & fefe4fe <$e %@tAe4p@tum %w7w 7  Ff < ]FfKf $ e5%@p%@t J @teJ5  NQ 6%Nf}f $ e5%@p@AWt@`= w:6w &6 f  5 N 6%w55 @ AWt@` @ AWt@`f 7 @ p-@ p-Nff 6e@w v5(   6e  ;wZ5w F5DC w@5  5@5 @- 2@w 48   & f '%7 NE  Q w4& fe %uu@e5ff^ e55 T @w @4 @e5ff . %w04w 4  p  Nf %% nf z &    N ;w3w 3 @e5ff %w3w 3  Nf %%  N ;wv3w b3 @e5f  wV3w B3 *  Nf %% f  &    w3w 2 @e5f | w2w 2 *  Nf %%  w2w 2F  w2w 2:    wr2w ^2D & fefefe <$e w&2%  @a0uWtAm !w 1w- @m7ȥ- > - 7z%:f # (~ v p f  _  0    ?w41 ̥:7 "*+  w-t f  u  @m7    9 E5 @@l w2)w x0DC E5<E@e33. @;E  5 , @;% & fE 8 5  9U3 3  w/w /DCB 5Ԑ @w/w /D      + - ̥9 0$l갵r_SUWY[|0|0晚0 Wp @@`e̥0  wJ/w 2/Nef %w*/w /Neff %w/w .D A555  ԋuNeffe %w.w .DC 5 5 _%%_5 %*e5  AWp `euY 0u%l5  %h%[ Ye  _2Neffff He   * O  A@ EN D&5% % % %Nf P% &    %_ A@ E%Nf P% @w(-N D&5 w -N%c%s%[Nf ff f& ew,5 5 5 5 %e%f %o%xDe5 5 A @ EN D&% % % %- Ԑ A @ EN D& _L%+_L  _8%a%f %A_`%F_` % A@vN D&O% A@v@mAm@ vA@v5uY0 %a%fW7 5`u`u C% S P Ԑ A @ E =Y%%.%e%E- *% ' $ ! Ԑ A @ EN D&%+%-%0%9 A@  5u% N  P% =   @e! @e! _@t@]   x Ne BA _Ne BA @H@pHw )DC = 5%c%0u5 %s    D&%r %c5 %[r       D&%%   P% =  D- %cw( w (D ̥^     % %]%-+  $%-̥]4   ̠     %]  w(w (D*\5% %-%+ 5 55 55  B5eA5 Y%.55  B5eA5 Y %E%e$%+%-  Wp B`eY  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& e5 55wN&6 m 7" w &DLw&ԋ w %D Lԋw%w %N  w%w %D el&&&&Wpe f Wpe f8 H #eHw%w v%5 5  AaAE f&A@vUU5u %wB%w .%D ` w$%̥/ 55j  7&f  e %Nfe 7 x fe 7 fe 7 ԥ.̋De & T! & 7 %fe0 7% L: %,@e05e wHNe$ w:Ne( w,%r"_2 _2% _2%2_2WpfWpeme, _2@e\5 N f&thje - @ E30" - *te#5.N f&@.e@.A Ep@.A Ep -, s# -3# 0"_2 - t-#_2 -#7p7jte#5  e#7F - _6@e#7&w n" Nefe "w^"7 ^AWp@7 7  f z" # 7 #77 w "7 7 T7 R7 Rz # 7 #77w!w !~ .#̋      2  w!w ! d @55 w-w-~  t # -`  t5,h 5,j -6 /"ue#&&fe Xe3 e#p e#3w w & f e d w w ($Q@f& :e5uQ@f& he5uumumu _.eeQu  %QQ eu % ff et ff e5u< ff \et< ff eL A@e@ f& tet e  =  r  rd > r 8 8 rd ( A4 5 8u 4  A4 f&A@ 5u r  r   A4 @mAm@ 5u e4 tWpe u4  AmA f&A@ 5u  AmA 5 u ܃@ 44  ttw !wvw De LN 74e e !  74e  Be v Nfe >&%w~w j-^@  wdN @$ #%@$tww 2 .#!,& #   w 1&T$ #%7)˕,T$Nf z" w D F !     +  we% - r<N r<&@&T$ #eT$ ~ ~w  Nef H# ww D 5  =& $% `5ȥ=  = @we  w  BuNefef @%=@@whЋ Ћ  Jҋ~ @@w %Nf f fff J%e _F%g %]@ D  %0  Q% 80 -f 7 % x2c  = ?   @ ǃwww D% 5     |@w4- w @5-E@BepNff @%5N 9@U@0 @0 =  Nff @%5@5 w&@yww D85U5_~'5P_~'  m@e4 ,5Ne & ^<  uN <4USt%5 95 95& & 7% 45@e-4  % U5EU  wE w 4$ < w5 4@E%@EU5N&e 7 z&e 7 Nf&e 7%4 IN&e 7 &e 7 Nf&e 7%  (Ne& ^<  ff eee@ 4t@t"4 4t L: =_'w N L:@ L:N =wzw fDff %5u4 4 @ A f&A@EE4tmm@ 4 t  / ve@ 4tww D55ff %f&& "eff&e e &e 2 55 ww$wb5 5 w DD5#5ff T %f&& eff&e *ew&e 3'44  && ef&& 7e&e & >%%U w vD5_+Jo5ff %f&& eff&e Ze L&e 38f f ff&e V e 744  && ef&& 7e&e & >%%UUjw @@m e%fe <  &e 2 55 3ff `%f&e@ &50c &e 2 55 3 6 U44  && ef&& 7e&e & >%%&_+fffffe e _+&e % _,_+e_,  mm@ e@ f& ef&& 7efe& >%%_+ 0_*w @0 0 @0 N -77$ww D85_.Ne& ^<q fe Ve4-4-/44  &&  ef&& 7e&e & 7%%&e < &e 2 55 eww$w4 et 5-5-5 5 w ~D4 4 @ A f&A@EE4tmm@ 4 t  / ve@ 4t4-4-/44  && ef&& 7e&e & 7%%&e < ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& 7e&e$& 7%%&e$ < `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& 7e&e$& 7%%&e$ < `Btp$t t"  ff Nef&& 7e&e$& >%%UwD w 0 D5#5 5 wXwT$w  @ a@ a@m5A a@5w D 5# aB- f a@m& t5% w e aC-w ^ D@ A 5@u@e@ 5u   w, uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5lZ@Et5lz5l|u te%w L D5u-5 w2 @e@- @ a@ a@ a5@ a@@@m`&fNm 5% a@ `` e w D a@@m e  wj e  aAm HN@`@m &f 5%  aN f`f 5%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef @% 9U4 4  fef @%5 wZ    6v&  @ppC`p   6@Cw8w27 Ћ P ы A@PЋ w FD:5UE5Hw* _n95uNfe & >% _n9bNe & ^<  uN <)U5| m- 5 & >%St%  j< U   & >% S U _,8 @_08w DE%%"5   & >% U wv w ^D55@ 9  L: 3 = 4 4 4 4 4 ww~w  P$5+ &5e-$e % &     ; ww  5f ; 7 f ; 7wX@ m7%e w  x j    ; e-Nww D :5 e %w  5 e-w 9 d;ww  N >ww rDCDpC < < wZw FN =wJ ~5 & E        ~5>wlYwfw Net@f  `e vWt vwV@ `e @  >%.*e U? `e 7$U? a7 ?U ew dDE wZw FD5 = 5N <!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%طm؇%w w7f*'$!     V 7L& A<& BF7!W-NG7 & & e Ӌ  &7& e ӕ-ӕ0B~ӕ.  ӕ0~ B~&7| & Le bӕ-0 Vӕ.J B~ӕe< ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_NB@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& 8 z   5 , @ :% & f E 8  (˥-%0     ,:% &  8 8 5E& z   5 , @ :% & f E 8  w&w Nefef 5& vEe C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& Eeww  fff 5& Eeww  5 %O N  = $555Ne5& @Ge5 %55'0Ne5 B& @Ge57 Be0" 5% %55 5 B5@B e$ a=%$7$w % %5 B5Ne& @Ge55e0% %7 `Jʕ0%$ʕ1  %$˕0 ʥ9 6@~  #).3=KS_ir{%-5>HRZfq~ +9DOZ & Znn`nL4|, '+/9B6>kernvmfsnetdebughwmachdepuserostypeosreleaseosrevisionversionmaxinodesmaxprocmaxfilesargmaxsecurelevelhostnamehostidclockrateinodeprocfileprofilingposix1versionngroupsjob_controlsaved_idsboottimemaxtextstextvmmeterloadavgswapmapcoremapunixinetimplinkpupchaosxerox_nsisoemcadatakitccittibm_snadecnetdec_dlilathylinkappletalkmachinemodelncpubyteorderphysmemusermempagesizedisknamesdiskstatscs_pathbc_base_maxbc_dim_maxbc_scale_maxbc_string_maxcoll_weights_maxexpr_nest_maxline_maxre_dup_maxposix2_versionposix2_c_bindposix2_c_devposix2_char_termposix2_fort_devposix2_fort_runposix2_localedefposix2_sw_devposix2_upestream_maxtzname_maxconsole_deviceAanwMust specify -w to set variables top%s: class is not implemented secondkern.prof = not supported in 2.11BSD Use pstat to view %s information Use ps to view %s information %s: %.2f %.2f %.2f Use vmstat or pstat to view %s information Use netstat to view %s information Illegal top level value: %d name %s in %s is unknown %ld%s: value is not available %s: specification is incomplete %s: type is unknown to this program %s: hz = %d, tick = %d, profhz = %d, stathz = %d %s = %s%d %s = %s 0x%x %s = %d %s: %d -> %d %s = %s %s: %s -> %s %s = %ld %s: %ld -> %ld %s: unknown structure returned %s: unknown type returned ipicmpigmptcpudpidpforwardingredirectttlmtuforwsrcrtmaskreplchecksumthird%s: no variables defined for this protocol fourth.%s: incomplete specification %s level name %s in %s is invalid usage: %s %s %s %s sysctl [-n] variable ...sysctl [-n] -w variable=value ...sysctl [-n] -asysctl [-n] -A/var/run/devwarning: %s????^ : illegal option -- : option requires an argument -- ppzVVVVVVVVVVVVVFF^SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecX \ mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %dH P Z t  $ 6 B X d p &>Kap| *;Z{3Rby %Fh} 0Fhz3RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/usr/bin:/bin:/usr/ucb:/usr/local:/usr/new:/etc$$$$%$$$%%%%%%%%%%% ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired $ % %zAd`AolAx*Bf8Be*AgBcBs:Al:ALAuADdAOpAXAU=(\0%l&=?ACER0R00    e7cce7  / ~  7%  Dw ~  f d @ ? R n  f .ff d%5% 5`m% ue0,7(fef %5u %%N1 &  w   fe % NC &  @ 7 7 5 T P 5,V &'N ^ DwT` E%@'N&  l & L `7P @e &   E% & ܁w  N R N `Qc $  d  d 5  e 9e `5 d  & e & & ^N `5N X J & @w E%@ e  5E% e Le `5w  @e5f %   Dw~w j zh p fs e V wJw 0 <>]62@ 5@@ww    Dww D70 5  \ 5  \  \ 5  \  \ 5  \  \ 5  \  \ 5  \  \   @w w DC   u_ʋ_ʥn oe5  a d> sa u_w %   _U_ _U_  %   _ _  5 %   _U_ _U_ %   _ _U_ _  _U_ % " %   _ _U_ _  _U_, %  < % _V  _ _R %   _ VUS P  KUH` % p %   /U, ()z %      % _V   Ufe  _ _Zw DC w  5@5 @- 2@w w w w w f8w-.( @m7ȥ- > - 7"%:f (  f       ?w ̥:7 x*+pj `w-ZT L f  0 @m7^" N 9 E5 @@l ww  DC E5<E@e33. @;E  5 , @;% & fE  5  U3 3  wX (w w > DCB Ԥ@w0 w  D Lԋw w DC % 5 ̥+̥- %$ ! ̥0 ̥X̥x % ̥0 ̥X̥x 5 5 % 0 e e  ff eee@ 5u %  = A@  w A@w De LN t4ee p  t4e Be v Nfe %wn w Z -$@ wT N^ %^ w ( BuNefef %=@@w Ћ Ћ w D 4 4  fw w  f P %  P "4 4 wz w f D 4-&4-!4 4   &e & V%4    w me   s lt  &wJw @5-E@BepNff %5N @U@0 @0 =  Nff %5@5 w@@yww D5"E@e44fef % U4 4  fef %5 w   @ppC`pwwЋ PЋ w FD:5UE5Hw* _5uNfe & H% _0%l&=?ACER0R00 bNe &   uN ")U5| m- 5 & H%St%   U   & H% S U _ @_w DE%%"5   & H% U wv w ^D55@    3 f 4 4 4 4 4 ww~w  $ 5+ &5e-e % & ^    X ww  5f X 7  f X 7wX@ m7 % e w       X e-ww D  5 e % wr  5 e-Xw l ww  N Nww rDCDpC "  wZw FN fwJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  ` U7R U7H F >Ae vB*7 ,  "% 55 a  a!PE -%  w$ " `e vWt vw@ `e @  "%e U?tt `e 7b U?V a7H @B?:6U ew dDE wZw FD5 f 5N "!w5A vBB-  }ee@ !ۃ `!ւ ` `rmd& E%VmP%w w7*'$!      7& A& BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   wCan't fchdir() back to starting directoryRfinvalid flags: %sinvalid flag: %s.Can't open ..can't fstat .chflags: %s: %s usage: chflags [-Rf] flags file ... uappnd,uchg,nodump,sappnd,arch,schg, ,archarcharchivedarchiveddumpdumpsappndsappndsappendsappendschgschgschangeschangesimmutablesimmutableuappnduappnduappenduappenduchguchguchangeuchangeuimmutableuimmutable: illegal option -- : option requires an argument -- : Unknown error: %d(:JVhz+?^m| &Dc$Br-Gc{(<Pcr & 9 R t RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB r doxfegcslL uDOX"U0&lkmgR0ǯR0ǯ0 8Ad/@:?@7@7@> e7cce7P /  7%  bw @5 f5 FA5 |,@wvw b @5 f  N f5 @5 |,@w&w Aupu@5 f5 @5 |,u = @wʬw N "5 ww N 6} Hrww FOPU78OPU7.OP,OP$OAe vB%PO- OO L j  LN7 N$!-N L-N%P -N%P L w꫷ N%N55 a  a!SE І-jN Le vWt wNN @BN `e ‚2N  @%-N1 L NNe U?MM `e 7MPU?M_ a7M-M L-MMM?MMU e_w ƪDME -~M: L  LZM5` LE -@M->  4CD % h5+fe  *Mfe  $Nfe  GFfe  gFfe  w4w  :|ww D %EE5uNefe t   > R V  Nf XNf ff :%ww t @wrw \Ne|t@: :e@E7w@ w (_ @7^=DGn? _0 7 H= 7 \@7dAEt@L: :eFEPPPEt@&: :eFEPPPEtt@: :eFEPPPF|t@9 :e<<E&6Et4 :e -Eut4 :e F}tp4 :e  7 jN 4 w w ܞ"2F82F80G82F87 8C6787 :7777 ww _05 5  27   TNef@3 :e 8 4 W-A@ Nf0&l EmgR0ǯR0ǯ0 et3 %5  @@m0Ne :=7ZV t   w̝w & !@eFPPPEU Ne t2 :e wtw Z 7 F t2 :e w<w &5C, 5C&- 5 b &5N H! D5 5 Nef@2 :e    w474 vJI2F ĸ%8JIe2F758JIe2F757 >878 ֤78 %  |7b4 3@Nefe  5% @ @ `5 @7(5@ r yr 5 2FJI ĸ%42FeJI7742FeJI77 4 4677 642F5 _,@& d -@& dn2Ffe d4,@& d  B%Q2Ffe  fe Z 42F4 Ne Ը jfe0 %uy Ne2F w3 Sw3  17 B7 532F5  Ը _r32F2F ܸe  N2 7@2 F37@3_C-  32F2F ܸe5 5 xn "` ]H-@& d S6-@& d>-@& d H-@& d7  (1  >-@& d H-@& d C-   @22F2F ܸe$1_ Σ_ 22F2F ܸe_12F2F ܸe  h0__ tC1 _  _711 " /_ _  B  ^0__ _, _ _  *12F2F ܸe  0__ _ _  _8 _2   _w t  %   pZJ , .wTw @D55  @=@w L5%F07@0ՀEm$/E55Ne& @E5N t/C.w D5  ! ZJ @ZJ ZJE  ZJ N  I f % > + Z%Er+ Z%Ne~fZ+ :efe>+ %%l2  #  Lww ..2F5 @E 5 w.@E 5   ..|. v.E 5 b.\.E 5 J. B.B.<.  2.5 @h Z5 2Ff *-2F2F ܸe  x~ w-- u--@5`-- _fw-@w\ w : 7                   8                  wTw @Nf %w:w & }=@ /% #Ne L% =w}Nf@& %@?R=@= @  Nf@&= w | wz @ 7ff ew 8  @%5 @ 7u ff eww }%u @x5@ @  @ A1@5 8@  %  @0 @   2 @0 N :=A1+@ @p @ %  @ A1N ff@& e wܐw Ȑ@E@mE%5"%C @EDE%5%D@ECE%5N wxw ds   N  wFw 25 u}Pu @x5@ @ 1B @=@Ap@0 N (Nfe  %@  u@5 @  wrw ^ #@ %  @ @   2N 2ww  L5}@0 @0 @0 @ww Ҏ f"1Pf V%%N  ww ZUNf 0 L@% N @&f 8@f ! 5@ @@"P@0P@  @&P !%N@&f V%w}@ w %_ @"P @0P P  w @f ! 5@ % @"P@0P@  @&P !% N @& 0 @ N@& 0 w ڌ '  Ne.f @p- NfX S%e f8 S% wzw f!@^P @@P^;@\P @^P@w. @ 5@  |!@^P @?P@AU@e\ @\P @\P  @ 5@   @ 5 @pP@\P @AWtEe0pP @AWtEe0pP @AEe0pP_!w DCe̋ wNew ĊDCeNfe v ww DCeNfe r ww p@@-@wn@ ȋ w JNf d wHw 4u5= @ 0 5@ 0 @ AEp@ pu @ 0 @ 5^!} 5 @e5e5uu5&u-2 @ 5*=  @ 5\ @U= u- @ 5%\=@e5@e5_t&=Nf fe "'%5_'}- _&5@#f N@  A AAm @`& b}e _' [_d&@ U@5@- ]f x# [ u-] Z u-} @5 @E= -@5%] @E= e@5 %] ?@ U@E= @ 5_$ *@ U5 _*%5uu@  A H\  @ E= =N fe z) wچw Ɔ wƆNfffefe X'ew :5  uu] G=Nef $#@ 5+@/%@E%@@E%Nef N#@E%@/ =@ N f z) w/}  uu/}  N f ffff (e w d@ 55=7 !N "5@  !f@ @ 5w 5 N ֒51..DeC@f ff *e@-Nf f f X'e5N r@=w n -@ee 5 fwPwd@0 @ K `@ A$ -7@ ed5 fwe2@Bo5 }ee = @0  2@ u@ ȋ@@5NN f55u@ A H@@o aH @@o a _)w DCBT wN & *e  ̋ԋ ̋  @   5 5E@-  5 ue E%u5E%u-w @  AA @`D  2e @ 2= ww Ё )@e5e@5%~N@ &$fe 4T%Ne :=77  >7 L L H ) :=)  HBvt :eTC w6w "D & - w w DN& B.  #N+& de5  & -    ww DN& .  #R+& de5  & B.    w^w @DN& .  V+& d eN& . Pww ~DN& >/  X+& deN& . @xw~w ~DN& /  Z+& deN& >/ A @@wt~w \~D N& ^0 & 7 5Le%%UN& ^0 5@  x% d 5 2 2@w} d    95w }D N& V1 & 7 5de \+& dUeN& ^0 5@  x% 9&  % 5 2 2N w| 9&  % 9&  % 9&  %w |DN& 1 58@R </@H)eN& V1 < 9 9 & : t5 2 2N w|w {D5 N& 2 & 7;5eN& 1 5@+  x% 9&  e5 2 2N w{ 9& x w T{D5 N& ~3 & 7\5eN& 2 5 @ %4 * / 2 2N wz 9&  Vpu 95H |, 9  5r5 95I |, 9  5rw jzD:5 " |,^+& d2eN& ~3  95 2   _L5eN& ~3  95 2@@ `+& db+& d_$5eN& - 5  ȥ)" |,eN5 555@e5f+5 e5 }3 |, n+&e d59 Nfe , < N 7 8 < @C) L  9 _3_3d+& d& 7) :=wxe˥-_6U <_6| |,& 7 Ne& r  |,e5  T 5r + x&f T 5N 2N_3f Tf TlNef vd ҂ x%Nef rN 2)_H5@E%@E%@@E%@E%@E%  -R 5_H5  T _L5w vD Ce) :=) 33) 5@rB :=  Ne \ fef d%5 @ |, & f leNe tN |w&vw vDC =5- _8̥+'̥-#55 5_8̥(̥)̥!̥~ ̥^ ̥"_8&P̥*̥/̥%F5̥|̥< <>̥>5-̥= ="̥!=~ ̥<̥>w u~5_7w tD̥̋-̵E 5 " |, wtw t @ȥ /C.* L 55 @E 5  Cf "  9%wFtWp @A@`e     l:w sD Le ,@33  zJ :=3333 b \ wsw |sD t  2 2wjsw Vs 5 5 5 C.* L  ^  & Y%Ef& Y%e (@ȥ-#5 r tN |,  @ - h  NC.* L  5NfffeP ~;ew~rw jr  5  N f f <%@5 % @  N f ff@& ~;e N f f <%wqw qDa T^  Je 5C+ .@% %  A1p@  @@&@&d e @@&r %:   S  wqw pDC   wp̋w p =  wpw pD CӋ L@wpw |pDe wxpw dpD S M Se wHpw 4pD  w0pw pDC@wpw pNf x & = @wow oD  2e N 2wow oD & t &  := @wow oDC wtoA @ ԋ w Jo C CDԋCӋ@A@`  L5CԔ CԔ@wnw nDC && e &  =  = wnw nD ̋ wnw |n -- - -% ꪄ %wZnw Fn   7 w8nw $nDC   & v ! wn & @ !w mDC   % & v wm  & T@ w mDC `t%  T@  wjm% w JmDCB  Ԕ~wNU^ tC%?2U@/ 5@ 5% h"NU\ tCtEe0@] tCtEe0@] tCEe0N] D"E ^  P r f  : Z NN] \ E XE%  wFiw 2iD   !     %n d5EU \ Ewhw hDE? %N whw hLwhw h%L, %N" F  8  &XLL& f%LBw@hw ,hL A l A& r Ne r NeA F wgw gNe& r NeX r NeXfe F  fe l AfefeA Gewgw gD 5 e M < 5N& & N%wHgw 4gDC& FL e&e FL , ,llt llt llt l l""t l$$l&&t $l,,l..t ,l00l22t 0l44l66t 4l88l::t 8l<<l>>t <l@@lBBt @lDDlFFt DlHHlJJt Hw.fw fDC'   f& f_ef&d   f& j_ef&'  f& _ef&d  f& _eee@ ee@ ee@ 5uC+ 5' @ f&@ f& ^ef&d @ f&@ f& ^eee@ 5uZ @   ʥ%  tC ʋ tCwd D 3 x( K eeff %   ff ff ]ef& ]e5u ff ]ef& ff Z]ef& ܺe *((* f&z e.,,. 5uff  & ff f& \e  ffmm@ f&ll@   ffmm@ mm@ f&ll@ ll &$$&_0J" "_0J2002_0J6446_0J><<>_0J:88:_0JB@@B_0JFDDF_0JJHHJ_0Jw aNffe L%ff >[ef&ff e waw a@Br`J `@Br`r 2`@,,@B@eH @@B wFaw 2a@B Br @B Br2@  @e@Bp ew`w ` &Qt@f :e %Netf :e wt` w N` l7 f&Qtf :ew8` w ` Newt@f :e w`@w _ @7w_w _ 5 5 5 5 5 5 D ̥%  @]  ̋w_ ̥- ̥0̥.0 ̥*/e@5 ̥.  ̥*>e@5 ̥# ̥l 55?Y̵ E 5  &|5̵ E 5  ̵ E 5  &|5̵ E 5   @ 5 5  @"E5(Q@ %_tS a_`S c_R d& o_Q s_R u_Q x_Q5 5 5 5 5 _RN e@55 e@5 A@  5u ff DWee0@ fe Ue   ӕ-@(Q@5  @@] @  @]  %(Q _O@ _ONU  e@55 e@55 %u ff Bee0@ fe RBe Z W%o" ff LBee0@ fe Be   01%x- ff BeB% e0eW fe Ae ݂  ӕxӕ0@(Q@  @@]   @]  %(Q _O _ONU e@N] _Oe@ &@5  @@] @   @]  ˋB- _O@ _ONU e@5_ONU%w jZ wlZw XZ@e5e@5e@5wf~S N%? wZw Z@e5e@5ftC N%wYw YNftC N%wYw YwjNf~S N%?T PwYw Y wY@w jYDe5're l50Nf % = S  _W-< "m |, n |, N &|5n |,    o |,  > 2_W p |,5 @E 5 +n |, 5 N &|5: a p  : N &|5 %%;q |, p a  r |,pe Ne ,Ne 5 uu@A@5e@A@5 e<  f A@ f&< f Pef& f Peee@ ee@ 3s 3, 3, , ,  ,>3wrVw ^V& <%E5uNe ,X_Y5- _Y5-_YR_X ^_X5-_X5-_X  27 )@e55 5N :==@p@pueu@Aepu7 > 2Ne \ fef d%5 @ |, & f leNe tN | _W0   n_ r_ _7 vff |;%wTw TD 7D ? a$a~$ %a0$a0$whTw TT7 x7 v7 twTTw @TzX & :%5uC, 5_^uN =  r N @ Ne X5 Ne ,< ff JMef&A@ &%_^ _^wNe~{ r {  _^-jӖ-dӘ_^wTwP { 5{*@B@0 >0 @u _\_\ufefe$ %5 ]@p@p>@B_\fefe % @p@p>@0 B_\fefe f%fefe- f%@p@p>@B\@BVD 5fefe$ f%fefe- f%@p@p>@Bfefe f%@B}@Ap@8@p,fef %%,_[N 5 _])f d )@& d]@5BT)f dNef d Nef d8Ne$@& d )@& d"@ > @x@ >@5B52 R^@0@UBu e  @ȋ @ _\ff 6%wO@5BN R^Nefe @5Bw OC- 5a5 Ne> 5 @ 5 %@N] tC  tCw0O @ r y*.Nef S%Ne@BE ΂ x".Nef# UEC+ T-@5% %  p  @@&ff5 e_^@@&fC e_^@ @&@ &fW@@ &@& fiNe$_^@- N{  _^@e-5.5@E 5  :5@@] tC _^}:f Z 5_^@E 5  p@E"E@-e-5 @@] tC _^@E 5  @E"E _R_ _` _R_ _4` _R_NU% tC_^  _^ __ _@` _^ _^ _^ @BE _^ x. _B_ __ _J_ @@ &1fN__w |KC, 5l |,N = S7 p7 n7 lb@0u w0Kw K  @wKw KCjCeCCCCaCC^UM& & fe Se$Ne :=)  & nfe SeNe :=) wxJw dJ"ffe ĸ%@e5   = IC, %TCfe @%TC Ne, d%feTC @%  :=5̋Ne  N 2wINe& e  efefe ĸ%*fe l%fefe l%Ne @ae54.=ffe l% fe 70%e %ɕe 4 5fe %5 fe f%%N 4 %_Zd _Zdw ^H% @wPHw D @  w6D@5Q} =%Q=eQw C DeC5 dԔ_5Nfef ĸ%@wCBe@e5 @e R @e Ғ ˥/ˋ   ˥/& fe e %B˥/ˋԔ ˋNef |  w BDCCˋ? ;"EE@ EE@ e&e | & | ˋ& |wPB EE@ ̋ˋ & |w Bu   @EAE@ @ wANfe u/f fe l% fe T N f }w bA 5 w2  ̋ ̥/ & 5  2 5 .wA7jN nwZ f 2 f% N n N hD N @e!چԐB-fef %5 @a % D-ņ\ w F@ m:-2 f% h ̥tbc^efe Ce˥: ˋ 8% 22Nefe l %7 Ce ˥: A@`5%3 f%@` & w7 wD?w 0?˥#%  ̋ ̋˥|˥:ˋ w ?˥:˥| ˋˋ˥: Dw >D̥: ̥̋: w>w > oʋRʋAA@ ʥ@w>ʥ#  ʥ0 CpDe`=w >> őT̋AA@ ̥̋:̥@ w >w =\ őT̋AA@ ̥@ w=̥= N& @p w =DC=%::\  x2EB 3@  =0teP =Dw=w =uZe5 B _r7_r%%_rC  r y23`5x@`5x@_r@_r@ @` _r@` %%      =3e L % Z   _r r f r te r f   # &P3 M   !@% %d  rdU0 rdB r U0 r U0@@5 _Hq@_Lq  _Rq  $_,q83w>;Ԑ@ _ qe& Zew ;D [=Wp @@`e=Wp C̥. =e` =̥*  upC ̋  B%:4 @3 r` r  wR:w >: %  4  % 8& v w:w 9 De t4 tt 4 4 Ne&& % w9  eu @w9 w9)w9Hܦ ;ew8 w80/Qw8w D9x@e5@e57 =Ne^3 r `3f w9uut3f eNefe rpw3Nef u-$u- N r_Nv3_RvN ֒5N r3}-(N ֒5N r3Nef Nefe v u-u-N rNfe dv 3 dv 5u-u-uu3f eNe 5_(u3_tNf @_tw 7DC  ̋`$%# w`7%w6w6(w6Zw6*J w6w 7   L  w7 5 ff L% 50  8 ew 6  uN 5&f %5ew6 25  $f d & 0   w 46 p  @e5ff l%5ew6 5  w-   4 w 5 lf  \ &  %7Fpw53b dV354f  7 w B5 xwH5w 45 t  w65ww 5  7   7 w4w 4wкw4w 4  @ E w4n 5% %Ve 6%  e Z 4e 7$ 4& 74&  &|74&  &|74& 74&  |7w4&  |7w4& 7!4& 7$4& 7v_2yw 3J } w3  d7 ^(  55 ff .e55 } Dee& ,%ee& ,%ee& ,%ee& ,%e7nw 2  _"|'4b d_{R_{345 & f %5= |5u fff 0Ww80w 0?fef %5 w0 w 0%Vww zxt7rlWpwhAwp\Amu% Nf ~ @m:5uBm"B-"C-Dm 5TD-um@5@- w/ ӁNf mu-Bm B-т̒C-Lw d/ @@5@Z  vwpJAmDu-@6B *@5  N C! 5ԒS DCUC-f m5D-/+D-!Cmx@5&@5%3-\f ~ 5u0B55.*5R DD-N& m-N& ~ -_~w-w -D*\5% %-%+ 5 55 55  B5eA5 =%.55  B5eA5 = %E%e$%+%-  Wp B`e=  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& e5 55w,6 m 76"rȇw +D 5u@-A-/A@E5u@E55  ff&  r 8 8 rd ( A4 5 8u 4  A4 f&A@ 5u r  r   A4 @mAm@ 5u e4 tWpe4u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 /5ttw !w \w w De LN 4e05e  4e35 Be v Nfe 0%w w  -@ H5wN55n %n€e& ;ew<w u@t5o5o@ 5oNefef % (3A@u5Btro2o@ Aupo fef % u-u-u-@ww & f yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_5P_  m@e4 ,5Ne &   uN f4USt%?5? &5 @ &5& & % 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff %ށ̥a &  o5ff %f&& eff&e Ze L&e Z8f f ff&e V e 744  && ef&& eC ff e5u4 t "-t t"  ff ef&& @Et5l>5l>u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm ,% a@ `` e w D a@@m e  we  aAm HN@`@m &f ,%  aN f`f ,%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef % &U4 4  fef %5 w    6v&  @ppC`p   6@Cwzwtw D & & & wlYwfw Net@f :e  w6w.m& E%m%w w7*'$!      7& A& BF7!֒W-7’& & e Ӌ @@ &7& e zӕ-tӕ0B~`ӕ.  ӕ0~ B~@@&74 & Le ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .lu@Bw* J@B V_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& z   5 , @ :% & f E  (˥-%0     ,:% &  8 5E& z   5 , @ :% & f E  w&w Nefef 5& e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& ^eww  fff 5& ^eww  5 %O N  = Lp555Ne5& ޵e5p55'0Ne5 B& ޵e57< Be0" 5%p55 5 B5@B eLp a=%Lp7Lpw %p5 B5Ne& ޵e55e0%p7`Jʕ0%Lpʕ1  %Lp˕0 ʥ9 6@~ _ j_ z|_ z_ zt_ z_ zN_ zb_ z6_ z_ z_ z_ z_ z_ zf_ z_ z_ z@_ z_ z:_ zR_ z_ zD_ z_ zL_ z_ z_ z_ zv_ z_ z_ z,_ z_ z_ z_ z_ z_ z_ z_ z&_ z_ zh_ z<_ zL_ z_ z^_ zD_ zv_ zH_ z_ zh_ z_ z_ z,_ z_ z_ z_ z_ z_ z_ z_ z_ z_ z_ zL_ z2_ z`_ z_ z`_ z0_ zB_ z_ zP_ zZ_ z_ zt_ z_ zl_ z_ z`_ z_ _ $_ z_ zz_ ~_ _ _ z_ n_ _ _  _ p_ _ _ zd_ v_ _ _ (_ _ R_ $_ _ x_ _ 6_ z_ L_ _ _ _ h_ R_ _ _ _ ,_ _ _  _ |_ _ _ _ _  _ _ p_ P_ 2_ _ _ @_ H_ _ _ _ f_ _ _ @_  _ |_ D_ _ _ _ _ _ $_ |_ >_ _ x_ _ t_ R_ _ _ `_ _ _ _ |_ _ _ ._ F_ _ _ _ _ _  _ _ _ Z_ _ _ _ &_ z_ z._ zv_ z_ B_ _ D_ _ R_ P_ _ r_ z_ zP_ _ _ _ z_ z_ _ 0_ 8_ _ _ t_ _ ,_ H_ _ _ _ _ j_ ^_  _ _ _ h_ J_ _ _ _ _ _ P_ X_ _ _ _ _ _ D_ _ _ _ _ R_ _ _ h_ _ _ _  _ _ _ _ _ (_ _ _ _ :_ _ _ H_ (_ *_ *_ _ _ >_ X_  _ 2_ _ _ _ 2_ _ Z_ w w0 DC ww Da-- aȒ -7a܆ww DΆa-Ɔ a -7᠆7 w`w LD%2F2F ta -b7\w"w DCB  , w̵E 5 ̵ L̵E 5  Z ك ̵̂E 5 ̵ ̵E 5 L Z w HDCB + w8̵E 5 ̵ ̵E 5 ܁ Z ق ̵̓E 5 ̵ 8̵E 5  Z w DCB + wv̵E 5 ̵ Ȁ̵E 5  Z ق ̵̓E 5 ̵ v̵E 5 Ȁ Z w DCB  ``# ww DCB ̥^-)̥$ ̥- 5 AWp @@`e5̥0̥9 @@  ww D5 5@e5 _<  $_ *_ ^_fe e5:$=@e5:n@e@-Nfe N 2Ne A5 @Ae@mA@-z_<l@Ae@`A@& $Ö%@Ae@A@7`2@Ae@A@7`N@effe $Ö%@Ae@@mwf 5@e@-N 2ue_dĵ_N & @&_8_2 & fe e5_N˥: ˭}_5 ˥0˥9.˥- '5 ˥ ˥ ˥:- 2%@ 5 !v}@m 5˥-AWp @@`e5r-   75 N@&& %   _<:-* $^_2:09- $^_ $-_ 0_ 9_ 5 @5@5 , Q-5 Nfe XÖ%- 09 $@ 5Nfe XÖ% * u u- Nf_6& _6 @ _Dw D     > %2Fʥ ʥ ʥ>2 0-~/̥ )̥ &%2F#  %2F aȥ\ r  -R~ r% ̭zww "~ %2F ̥ ̥ ̭z̭z J hww 7 | %2F} } < ww ^ { ww pŀdN}m}-}%}%|%~| Z "n} j}7p} %T|#$%J|%B|P} ZH} "0} ,}4} 0}  %| 8 ww N |a-| "| |   ww v @e2F-|N w|%2F|2F|wRw >$ @ 5 t|b| -`| "N| J|7P| %W @Bd)8|@e7(|"|  |Wp B`ew| ww ŀ @ 5 d%W @B {{  {Wp B`ew{ @e7{{ wBw .|{x{  W @Bdw\{Wp B`ewJ{ 2F2{ w { {?{ww ?zww ?zww -zz z?zww ?z |dwx:w@5 -|}@ @&2F ĸ%} N2F 7n}2F e2F78z%2F  &z"z  z%2Fz2Fzzzw 5?y {2FFH ĸ%y2FeFH7{Pvdw~my{'@ w{@ @&2F ĸ%|@5 -j{p|N2F 7^|2F e2F7(y%2F  yy  y%2Fy2Fxxx ` w ?xxz7 z*FH2F ĸ%zFHe2F7xxx z"u @ wzdw8@5 -rzx{@ @&2F ĸ%R{ N2F 7>{2F e2F7x%2F  ww  w%2Fw2Fww ^fQ % w~Qf  w Zwww2F7^%^^2FQ f%p^0Qw$w 5 ?Jw \y  7 Nydw By2FFH ĸ%w2FeFH7ys X@5 -x @ fe  :=A1@ \   @5wxy@ @&2F ĸ%zy N2F 7fy2F e2F70v%2F  vv  v%2Fv2Fvuu_w 5 5 ?u wdZ^r "(@ fe  :=A1@ \ uu@5 -w  FH \ FH2F ĸ%LwFHe2F7,u7 >w$u$uww*wu.x@ @&2F ĸ%x N2F 7w2F e2F7t%2FȆ  tt  t%2Ft2Ftw B 6?t wBw .?pt w2w ?`t w"w  .]2FJI ĸ%0t2FeJI7ow %3F.o(o5popwdw %2Fnnn%2Fn2Fn F wdw %2Fndwn2Fn %7n w T-nnmnn-nnnn w>dw $-fnfndw$dnRnPn %7Fn w -4n4ndw2n nn b–%7n x w  nmm %5m u-wm-mmmmw~@E 5  i@E#E=w 4mnmlm %5^m u-5@E 5  `i@E 5  8i@E#E= u-wl-llllw~@E 5  h@E"w <lvltl %5fl u-wHl-BlBl:l:lw@E 5  Nh@E"E=w kk ww kkk7k > ww k  W @Bdwxkkt7k w L 4Ne L5 4%@ w, w Xk ww 2FBk  ww  j ww  j ww  k Z ww | ww h ww v wzw f -jj j-jjjj wLw 8 tjtj w2w  -^j^j?Xj- @ 5 % df @# @ 5  :f @"E?i i T wdw 2F ̵ dwE 5 -i 2dl jw L h1wPw < wbf& e@@@fNm Ի @@@fNmfNmNNf Ի NNff %u-5NNf + (N u- Nf @@@fNmNNf Ի ww $a p_ 5 4aLBOE5  ; 56  @ 5@  Y  @ 5@   Ye   ̋2FOE5  ; 56  @ 5@  &Y  @ 5@   Xe   -\N  ZwRw >N D_ m_m_H _-__7 _ _ `C D Dww 2\E5 -\\ f*_$+ @ 5@  X?@U@5^ @2 @ 5@  W@ \ @tEe0 @tEe0 @Ee0 dYww 7 t^7 r^  mb^ -^^7 &Bww ^^   8^ 仄 -A A  D Dww zD PU ʋwlʵE 5   >E7 Ew &D T w"55 Ne %|E7V( |,dE :=ZE >7 REw we)e7 e 7 e7 e ww AA@=U%* = 5 7De5= N)  wP 5C @5  |,=  %\ %%  w Be5 5    _  _ "% '" \_R `_j _  Ne)  _ %" 53% %4 |, %  |, " '  `  %``UN  %`ҕ`fe L  % %U 7Zcfe L @e55 _" wHw 4D7 Sc(7 c" 5C UßS SE5beb b w jS b bE b b7 b b beb b %$  w zwZS, |,wxw d 5 xv5 t5 r5 p 74b7.b 5z5|%{ 5|@|E%# r%?| p 5|@| _  _  $ *_ De~5_@5|_^_t r p |,P _6 pK |, rO |, Den%Ln@em! |,nAn UU An   n fenhQ %% q`'`Nen |,_n*fe~ Cn* x_ @| 5 _4 rS |, 5 xAxWp Am|eux 5|5 @| 5 N|  x nQ x p  O_)_ O |, dN_Z p |,Cn* NF. 4@v be7_@t@v 7_%{z 5|%}}3 |, w @|=%_| |,T| 5|5N| Cfe~  p! Ne~ )7 _ @|=%_|@e!LJ Ne~  B_ZNe~ A 5| =5t r_ x_%[|_De~% |%| |,@e! |,T| 5|%] De~ 4^ 2^ |,̋ |,̵=E 5 55 l AlWp @@`e5l̵ [ <_E 5  lu-tlulv̋uvt**̥* C̥--3 |, 8Bt ̵ B-v-@v 5t)E 5  E 5 Wp @@`e̵ _B-t_t v t_t̋ |, xu-txv5 t@x5t5vN|  r_@t@v  5l Nl 2_6w  %:' r\%g '^\^ < |, 7>\%q'4\ wFw 2D\ \7\\&   [  2 )[ -@ |,ww ֶw[wܶw ȶ[7 [ [ [  7 [w ~[ z[t[p[el[ w zD5  5C Lwhw TBJ5& Tt-6>R  RR H5xf7 |,% f  RN wR-=~R  xRrR H5xf7 |,%N u5 7 ^KNe ,nfe 4 @KBeG eLK- |,% E < Nfe dNfe& f% & & 7 7_w  @0 wN 5@ 5 @ 5u- N@& ne%N@neRp@& @ 7`n5 .'u- @ 5 @@ap @@a0 e feR @%w&n"ne%s |,_w  # mmB %*d ֝ Kz  .@ f %e G Sw&w 7 uN 2e N 2b7 \ uN 2e N 2l 7& 7r 7  L5  L Am  - @m w·Ї  L5  L Am  - @m www  ܀. Nf de  _2Nf kk kkkk d 7k7 k ~kxk zktknkbk d 7Pk kj 7І jj JkDk 7 jj jj "kk 7t jj kk 7Zw*/ Nf de  F%*/%6/)f d@@0 jjf dNt |, N &|A1bjXj%2/ Nuw 5 5 @e5l ~ _|@ȋ_|ȥ-s  xF/y |,eNfe fe d ii S _xfe dfe d"5 @t-T.@tR. @t R. (i8ife dfe dfe dhNefe o 5Ne  u |, u5 7%1 @ r yN/ !   # & @v |,     ! @ _ xT/    $e @ȋNfe  w |,%Df r% }w|e @ȋ fex |,%5 N &|5e @ȋNfe  w |,%Dfff ڨe& Nfew |,%e @ȋfe  x |,%N &|5e @ȋfe  x |,%N &|5e @ȋNfe  w |,%Dfw  jf9|DC55 @t\/t5.@@t^/f  @E@mȕ5 %w@E@mE%Nf  @E@mAWtH^/w @Ee@-U ~e &e ee5 Ee r%7xe@EleE@ /5 d(d% d"dEd r%Հ,e dd Ed r%ŀeww ~dww r-*-&@510% ldfdEfffPd e& r%ww5  D u-7 v "d d@ % ccE@ &@ &@ &c cc5 Ec r% @ @-w n-~_~ @-_  D7 ~_@~5%%" bbEfffbg .c(cEfffcV `%`~%J~EAE@ 6~E5 De@E@-@E7~N}} m}m}& Ի  b&b#E@ &@ &@ &`b e& r%w}w&@ %}@tAE@`A @ 5 @ @- D7 P}_ D @ @-w DC  }  D }~wE 5N@w f ^| wX-|T lafa% ``Efff 5 Nefe @Ne ABe@`5fefe f%@@m0NeZ l Ne@@me& L :f Z 5fe L li#5Nefe h> 5 Nefe =Ne ABe@`5fefe f%@@m0Ne@Y l Nefe L :f Z 5fe L Ne. t Dww jNe t̋9Ne  DX S  Zt% cAX S A Zt% A :=KC # Ne& r %Nef r % u-u-C# 5Nef r % u-u-D)&   :=22 7y7yP2 7 y jwZw F LN := 4 C&&* %NJ+ t ww u7 ~W @ 5@ l% n* v#N@&E |,% e @ȥ-}wUWUWUWw |Cfe  CE |,% w\w H C) L 55 ph5 5 %P_5V N  S 5 5rV! *f df AN m5 e5 55`5Vq @- - q Su5U  f5-"# S%-~g5U Sw,w DC*& d& A `() S ww g%P )@& A1@5-ff ww @E%/_N :=_5 f e L5ff @5 @E%/  ?@E%.@E%.1@E%.(@5 @E%/ e/f x 5= ,N 5@mE%/@@mȕ/ @@mNf > 5N 2@ /@0@w C*+ __w ,fe 7 xt C) L ̋# |, Zt $ |, :=C@  |,YN /t5 Zt -PYm  mm H5xf7 |,%pdldfdbdpN  33 4d0d3d  jww /@cԋc@ 5%5 Dԋ@@m  L5cԔ  CԔN 2uum/uNf 5w&w D & T   Zt  2K 2 Zt Bnl̥/G* A@* A9C+ 5/u(CeB/Ne Zt r 2Ne := *wTe C& L ˥/˥. Zt  2 :=qfe  2 hP-V  @ H5xfe7 |,% w 5fe Dq _JC+ ,C) L ˋ# |, Zt $ |, :=  _la%Pp-ZaB |,5 Zt -Uj  jj H5xf7 |,%<0a``0?`V@  |,ON +5 Zt -lU j  ji H5xf7 |,%C +  N  4 R`L`?H`0 jww D ԥ+5 @E 5   w_%P-_ |, w p  Cfe o _@  |,PN D |,%P%PC |,-T_&%Pn5 Zt -Sh  zhth H5xf7 |,%<0-^ j P ww D  4  2 2wxw dDC ̥/_C&* L 5/  &f e % ̐Nfe *fe L fe L  2Ne :=_ ˥/ @ A H5 ˋ˥/ ʋ_ !___  5@ A H _ !__.__"!_HC*+ _Hfe& *}%5_HNefe @@m0 ˕/˕/@ ȋ/E/ A@`@m L555@ A H @e5@ A H @ A HCm +@@m L55@e5@ A H @ A HC 2D_ʕ/!/  5 5@ A H_  _ʥ._ʥ._!_C:+ _C*+ _fe& *}%5_Nefe @@m0 ˕/@ ȋ/A/ A@`@m L555@ A H @e5@ A H @ A H_@@m L55@e5@ A H @ A H_6 ˕/ˋ_$C) L 5 5 _d/_d&f % @mȥ/_d@mȋ_dw-GNef r % wGwGwGfe 5 Nef r % A%>N a5 @m L5R -VG-LG/f x  R   2Dww ~D7X h C+  F wTw @ X u%Pu@f w@  @5%P@5-$X w -X@Ap@xW@W@pWww 5 ^GfCd* ^C) L fe Z*fe L fe Tt 5%;W7 WtY7nYTW%P  @@  @5/W N wYwtWww D5 55 7 DYNe ܼ 6YNe wJY2 |,7 GNe ,> ,7 4p :=7,p7YC* 5 /p > /o < 57 Xe5 ܼ XN 5  >oX2 |,7 4GN ,>5 >N ? 4 2N 25N , @ȋ BN 7 WWW7 WW 7(VW 7V& ި% @  z/BN* > 57W UN 55 r / UAWpAmEuEtAWtAZ@0(,* dNf  N > JWN  7 :W 2 @re  .r7 WN 2 w2w  n  nV7 Vn 27 mCV mm8 |,  |,ww D ,>BV7 Z] ft 7 V >B] _  _ xm_-zH_ _ H5_   5%Kfef %%7  @E 5@ ( U% ! N -G\  \\ H5xz |,%#N C) 5)@e5C) C) L lU=@0 % #NUu5L5f ? }5 ,>B 2U ft 7 T >-F[  [[ H5x7 |,%wx7k kk 2N :=7k7Tw D dR xR T 4 S 4 S 4 & @ R ԼwRw >C*  UQN = tC7 Qww  5 C* 5 uQ 3Z % LuE@ȥ/; 5+4 (. !.e WpAmEu@tBEBtpZN ֒N re wDw 07 Qw8w $nmnnWpd nmnrmm eww D5 5  ff fe`E@55 ̋@ww /f < 55 C*   z/N* >  .PN 55 / PAWpAmEuEtAWtAZ@0",*& d f& %  2@  & % e  2 ww 8 ffe ĸ%ffe l%@e5uNef r %@E% 5If T  @E%@ ww @5 C  N \@E% 55=&T ' \*} @ "u } @U =  @U =  d  N _e4te& 䇎 A U/ < 5C* 5@  z/ue@ȋ,*f d* > N  2$*f > 5f > N 2 N   dPJww Di [TCfe @%TC LfeTC @%TC ik |,& feTC @%wvw bDC   <& w@w ,D C 7 &4 ( ) ;+ > |%! f ` w淂  b |,3!Z+ d f `  w D5!_@ȥ(PCf _@7M7MLNe  7L7L7 L - Ne t@ |,@ȋNf duN, > =N 2 D-O)@0!D@& ;@f 5@e@-$@Ap@Ap@p@pN 2N 2TC w:w &DC  2 2 ww DC   <N& 6%wʵ w 5 D &> ( ) >& |D- rNff h%wn  b ,|t-Z+& d &N&f h%%%% ! U! 3 Nf& d%3c , w 5 D  ( ) ;D-Nff %wH    N&f %3Nf& d%3 3 w г D  ( ) |D-Nff %w  |  N&f %3Nf& %33 w 2 D &  x~/ D-Nff P%w &  N&f P%3Nf& %33 w 5 D  ( ) |D-Nff *%wd    @U5C- &UUN&f *%2C-&NUf& P%2w 5 u-D $  x/D-5  D (A )E <I >F   D- 5  f 535 @ȥ)5 5  D_"      t-/ < 5 (. )_D <_ >6 />St-eZ+& d]U5 TfN   d ,5 _  _ &  :=A Am  _ _6 i ,ff 6%3 _H 5e ,ct- ^+& dUt-/ <53  :=33 <Ut-/ <55g5 h :=3D-_L _ % ,ww D"  x/ 2e  2 2 2 2w\ | | |w @ J?%:7o/@E7o/ @57vo/ w̥%&gt`5B-A vC vCt`@5 & d 5 ew DC   = 5, |,, |,&  ww @%8L  / |,7  2  p& .Ӗ%  4 7 &+   d 4 + :=7  :=7L 4 w,w  / |,  4 ww ww C \ww DeC \; C b & - =P S%* d* dZ |,C& { &  & d% PwVw BCf l 6w|8|`h fz    ww v| Dz & ͖%Ef& ͖% & & % z& ̖%{{{w&w  {0 |,{{z{ ww {0 |, ww f{   L{@e :=6{& ({f& &%ww t5 5 @  8y & ˖%E5uf @  yff ˖%N v xff ˖%ww  &  %ww D*(D_t`5B-wA vC vCt`@5 & d 5 ew ND*(^t`3!w>e Cw DCeww% & % w-jypy-dyjy eN  Ը   $ [ x/ %  ˀw % #- d % #   %%%%%  N d% %  J?%: `0% N d%v+ d%_\ _\  J?%: `0  Af  2_\%_\ _\w D 5 5 <5  <% % %#  <%  V%  F w  <%\  <%  %'%"   5 $  N ,5 % % %    $  x/x  |, }  |,   |,   |, ґv  |, w  w0f d0f d0f dw vv   & & %uuee@ ur2 uf& % w,w uu.uL-t-  t-t-  >  2 2Fu Buww N z ww N& z vww nD 5 Bs & Ɩ%Ef& Ŗ%e _7 t ܼ t  2 |,  ,>7c ,  ~+& d eU tC” @U tC  tC v r& @Ŗ% cc >7 bww xDe5 Dr & Ŗ%Ef& Ŗ%@t S e _5) f T 5f t p+f dN O-f d-f d7 Bs7 *P 8 P6 P3 l50-f du$)f d-f d-f d.f d N 2wJw 6D b_\_ 25 s5 u =u-ue N L7_e_ _ 5 r ^ue } ==^ -^ d7 :t.-j^ d-Z^ d/ 4  7xq7 `N 6 VN RN 3^ ӑ^ 27 ^ww q5C8e \+f > N >  A5 25 Nedq ? 7Zq ~ >Nq ,>7~N 2wNۃ ˋˋʥ=N\+ >  2f >  A  2} >p ,>7}w p5Ce wڃ ˋˋʥ= ep ? 7p ,>7L} 2N 2w pD   S ) E 5 ˥8˥9 t@`e˵ˋ % |, ww  &0f A ( |,e w |, w D 5e >*& de &0 @ e %  @ e @& ז%  |,ww DueN *5 @E 5 .eE) #5@t/ Me h, kb mB sO ue |,5@u@ : N *uWpCwB  f X aF  f X pC&55 m f X E  f X    f X E f X w }  NJ |, wpw \D *  Ne& t A@A@uA  W 0  f j%C r f&; e Sww D5 5e >*& de &0@& ז%  e  |,w`  @& ז%  |,w DNe& t u A  W   uuu Ne& T$ CA  W  Y &hkC ew~ w f 8iK |,   4 5& v N 4 %|i0  4 5& v N 4  M5-@i6i& H FBvt :e 2Mww *jjbhiiiVe _7 &jN ܼ jN 57V7 X 2 |,N VA5 7 VN VA5 ,ni @ 5^i @ 5Ni @ 5TCfe @%TC 5$wi7 i& @ 7i @ 7h @ 7h7 Fg w`iw\i7 2gw*gh h h Nf ? 7hNf ? 7hNf ? 7vh UzU >wpUfeTC @%  |,ww "DDm5+@ "  # @E 5 @ @- @\ u-ч9 E 5 ='s#@et  # $  @-\ C-ć@A@ 5N 55 5 @e5 "I '* /J \J@]= !@e@-@e@-_=@  _ xl0  5    5   U   C- ./fe x 5&#8S@e5 u-@E 5 7 S)fff ffe e 57 R%RNfe %)=Nfe j%5%5 Nefe L Ne wNe @ae5fff ffe e 5  NC) f   @  5!Nfe j%5% Ne ׀@E 5  N cfefe f%@e55 @e5  Ne 5% Nff) eN >@_ 5 @ @m @ @mȋ   @ @m u- @ @m&   + N >_Nefe _  Ne fe   __fff ffe e 5_ _w ZD 18TCfe @%TC  feTC @%7 Q `7 `>e nQ 7 b ܼ b ww ^w?^w E 5 vbpb  ~\p ljf b `w RDC EE@  wB̄ ̋w DC ҋ5@ ȋ w 5! EAE@  w D C, 5C w& e w DC5 ʥ`  5` @E% ez055 N̋Kf ZF0 Z %3 1 6& . x0  ̥ ̥>  ̥ ̵E 5 ̥ ̥  ̇ww % ?ff ĸ% wx DC ̋EE@  B-w 0 5 l5 h5 `5 ^\5 X5 VCp+ 5`_0_@`5b L& |%5RuT|fL 7 \LfTfR ^%7 | DL& >%5RuT*L r7 "LfTfR &%7 KNefef %~/f Z 5$fe x 5j /fe Z 5f   /f Z 5d  w55 f  H5` ԃ5^ j@e5j f d_5 TNefe Nefe Ne,* 5T 7J$NT 2 JNe NeNe!  $` TE>@e5N NN N/NuTN NN N/N5 N@e5PuTR@P PAR RH N=P P/PNT 2Nj  C- 1 1 # ڑ?f fe I ( zI , T 2?ffj ĸ% 2 _5 fNe` h5l_Ne^ i5l__ d /N$I T 5l_ .l  C-  _ _XV_ _-Hh @h mH5lzHh-tHh_ v\_ bc H& %5RuTlH r7 dHfTfR h%5 l@bȥ/eb b b,@bȋȥ.5fbfe ĸ%*fe l%Nb 7Geb G G T 5l lX5 V h%_ 5n5 \ _< w_< _<  _( ~_Njfl k 5Z@-\"% XNVflfe % _(Nlfen uZ\_(%Z_(Njflfefen ke _( XNVfenfe % _( _pNlfj _( XNVflfe % _( tF :F% L7`F&F5 P5 R5L = LeLeRu PF 5 Pu R-E~vEe  F 5N7EeENl 5T P 5`T  f TNT Lv mE ?flv mE& ĸ% # f   dNlfe \ 5J5K?feJu mTE& l% ?Pu m4E& l% u_(Nlfj _( XNVflfe % _( Nl   _(C, Nlfj |?flfen ĸ%ulD_ ttflfen `e __(& bD e_  & d  f  r .D& (%5RuTD r7 DfTfR %%_ Rt] `+f ĸ% f$f x 5T T=T  dN fe=N fenf l%C) "%s _ f d Nenfe ~`N +f l%s_0Cfen 5T@T5Rȋ@T  N +f l%5 R@T5RNen .i5R N +f l% R j=jNefe L NRfe ~N * _H5 TC, L 5RRR @RE 5 g5 T T*w-Tr& #rm  VfePT %@P  yPYPt2rA b}erA) e A_`& %5NuPqA 7 |AfPfN ~_^ATWp @AR@`e5T R_:%7 `+f ĸ% f$f x 5T T=T  dN fe=N fenf l%@\_0  _0w DC  a 2  27 h@ww /f x  ?ff ĸ%= ?&f ĸ%Nff ĸ%ww _ f_ e` `wrN ֒w L u }   =@w$ u N .i@E=_u=Cf 5 5} @  = @5  } w N~= Nf @w8=CD ̥̋/ ~N - @ E 5 @-@-@ef ļf Lw 6 _xNfe ffe l%Ne@e5& v %d@E%'C, Nef r % &>=w@E%@@@E%@E%|@E% %@E%`#@E%@/5I* w j4 #Nfe ffe l%Nefe r@E% @E%@E%@ww DC 5 7 4  ` @-@ ` 5 B- 5`V 5r5AAm 5r55 Z5 FAupBBmB-: ` 5  ` S  `& \  `&# S% @ @-  tC u- u- 2+ tC tC u-3 Pww DC ̋EE@ ̋ ˋ  wf̋ˋEE@w :Nf | w8w $DCB̋ Ԕ w w DCBԔ ww طC* 57 h o Ch- @u @ȥ/ he wN *f >   e % e f ֒ r 2u @ȥ/ he N  e f ֒ rw D 7 pJp?pTbP^44)7 lp7 jp <5% % |@- bN rN  L 2   %Lp?o%Joo 0o7ow$w @  tC  S D-ww DC  L5@0rB :=  ww D  2 24!4wjw VDenN7nD 5%  _ @ 5P g@ r y0 5u T Ne :=wwhn C5uRn7Jn 5 \T n7nv 5 %F>_"ԕ\ Հ5__h5_h7m_       . >Txmؠ_7lmʠ_ _0   5vՀ_h'"\ R~ Հwl\c _@4 , wl_ @ 5S J\%l7l  5 %}_}_ԕ\ # } @ 5 u" +*T l_ 5_u_\_kH_J7k:_P ,De_w D k7k7k ~~ ~5  @ 5 Հ@!7 X~fk bk\k Xk5 Pk Lk Dk7>k:k  w7 (k7 &k "kk7k k7 kk ՠ <5$5 ~5 rɆw 5 zDe~ԕ$j 7j 5| <~jvjw%{fjƝ7^j %#%? z8j70j   $ * < zO , Ne~ i P zQ5 x5 57 S , 5 ei7i 5 xM 5  x =%_e5 x2i7*i 5  = %_ 5 5  x%[7eDh*7h  % h T_ %] }_h7xh֛ %:?5 vXh7Ph %g v0h7(h ^ < v% V |,j , _Ʒg%{|_g07g& %}g}3_w  z|z && f v e%U , RzLzfe Na 0zNea L azww vgr7 gh 5{wf5ƚzz@ _f5 -y -ysfy :_H -5 uyZf7Rf  <_H55%:'f|7fr  5  =%_%& :5 uBeNfefe 8і% _e 7e %*e-%-Nfefe 8і% RdeĘ7\e @@ 7Je jx%: ez7ep %: {dL7dB %}W ,7dw&w F5 7 dd 7d %g d7|dڗ  &B e* h' p q r s@ t x%  \ , @wx mnmnmefm %Zm .kTC @m@me6m.m wF $m m m m7 m m%k%j  < jOj jjNet@(l :e ^5 Z @%:T%j0 M5%'7 j$HBvt :ef v jf} % . C,  j TC i iTC 7 x%  i i _%LX_,?|X xX_,w 5 @k_-"k$k-kk -kk-kkkjwk7j7jwj jjj jw 8j@- 2F m*j`& @%5 _q _  #__ 0hp  &7B-iWt wi7i7iwii r-i.ie 5 i if = |i 2wri ^i mZi  Ri g-7f ,>7s :=7f!f^f7f7 du)f dS ^7d H7d@ȥ-%%@- l@ 7,d#@ȥ-@8@0@0 Bҋ ʕ-  cBB ,xe&  7g/ 4  7 7 aNe&  %wxbNe&  %wbb ` 4  4  4 e _Bʥ-_ ʋ_ jO_— r y07 TOD`8Oʋe .O% eN :=7` m `55  \ -_5_* |,7 N N_N_N_N_tNnN) ܽ*         _  _   _ _ __ M  4 MP M f 7M^-Rfg  `gZg H5xf7 |,%N :=7^hM ? 7_ XM ` x0_ f _ :e7 5 2 HF& fw J f % w@& ?  f & :eNf& %w DvVerXLXVXXVEX>X5 5 _ ZV @T  Ne&  _ eTCfe @% .V & 쨖%5upCfe @%7 W wW wW7W7WwWbW7\W7 U7 U 7U7 W7 ^W7 W7 WwD7W Uff r% TC 5 Uff F% C  mW 2 -WV 2fepC @%V wVw2Uw.Uw$WwWwTwVwV DwVwCwVfeTC @%  |,wcww  CWCt* L ȋNC) L fe ~*fe L fe Tt 5%+6T7 0TU7UCt* L fe @e7B0 :N wUwSw&w   SB 4  4  4 7 SCf) *f)  &  %C)  *C) ʖ%& 8 ww t>SC) L   w`w L X $N @wDw 0_ @w*w & %5u REf& % R7 R S0 d+ |, 7WA@Ef& d% V T"T&  %7 nRC7 B >B7 B >TC  *R   D D |,wBw .*A7 $ATCfe @% C7S7S)STC @Q Q & %Ef& %C t @@ |7 @ ~Q 7 lQw@feTC @%TC 7 FQ N 6Q7 0Qwb@feTC @%wV Q Q Q J Q! @ S  h f 0 4-RR -RR & Ը VT  33 27 3C   3  P ?YC)  pPC 7 dP s jP& (% d?    >P  R N?C <9X 37X .? 3@ |, PTC ? C TC C \ >C $ >C , CQ d%7> 2@ |, & PP> leC t> |7 > _ LO_ Q_ T>_ t_w PD5 e >*& d e F |, fe  fe T fe  2N& fe %  -BfW  `WZW H5xfe7 |,%ww >C, _Ne , =5  @   X5%A mNmN@ 5 __~u S_Ne rGw-Mw-M 5  2u-.u-)w-Nw- N w-Nw-M vM % Cm  e wMwMwj  %w 8 C) L 5 Nf wN 45w 7 L f & J%70N& :e f  J%7 N& :e f  J%7M& :e f M J%7M& :e Iw\w H N lwHw 4: L55Ne5& r@E%@ N :==eNe5& r@E%@ N :==eNe5& r@E%@ N :==eNe5& r@E%@ N :==eNe5& r@E%@ N :==e,* :==e= @ww P7 Ne   fe %%F7 @% 7H wЀ-  C+ L  &| + E @%UA vE@4[5@@C+  &e l e Ae&P~ @%"5@E%U UA v5U@EA vE@4UU5 5@0 ,-C+ %C+ L  &|  f&" l(l*@ &% U@\!E- 5@E@U@5_5U!, 5  V PJJD 5 5@_~& d_5 _ _5 C+ " & 5 x6_7 H r v _U ~_w 7 ~~'5"&  Pі%5uE& 55 xff "і% wpw \&  Ж%5u:A l 2 1   2ff Ж%} 1+  2++++  5 3++ 5Z+ +  w@w ,.c N %Pa%P+ PԚeК Nƚ 7a7aww ww7 ~www pwpw7 jwww `w%Zw54-   S  # S   S 7w7wwVw BD4- - 5@E@U@55 5]E55!_%L]_5_  5_M S5l S 5@ S5k S55 5-35j S5@'u@& d @C) f%&  S5@5%L\C Se&e&e 0 Ge5-1%L\ S5 %t@& d tC) %& F SD-_5@5 5} N <@w 5!%L\ S5&D--t+-t- # M C& q e} 5 ' S 5_<5, 3 1C% @ = . + 2%'% 5 tr(f S _7X`5 ,_~u_%YN L\!@  xR15N  _x & T_vN& v-Rcw  ww H5xf % %%Q& vI @E 5 -: |,4N &|5Nf v-bZw  TwNw H5xf %%%f v e _ ^^ >7 ^ff %  |,wBw .D5 5 &  %5u\5UE UE!  B &  evt :e5& v ff "%wvw b$ml5  GCA |,  w:w & @,f d,f d l; |,l  l< |,lw ,f d,f d@$E 5 N &|5k t- 4-  . |, k04- +@?l@ fe A  ʋlf A ( |,  @? U=. |, _w D j-bk! , 5w  w jeN LU w`w L5 "k%k@5   l+l d 5%j> |, &  %5u ` jff v%1 |, D _N rn ^jXj 5 7 Bj Nj \j47 Vj   4   4   4   4   4 k%fj@5  4  4 Nf \ @5 4 @5 & & N N& D ff <%ww z%i! |, i? |,whw T  Nevt :e N& H %'  fi7 `iww D(5 5 _55  _ xb1E% & 5 _5N d5   $ >h 2h_) :=) ` _M Z O i 4  & @ U0-& d-& d  U+& d  U & @ %% ,55 @%%%E5 5 5  _J5_J@%_J%5 0  BV &  n%7w&VN& , 5_J V_JΉȉ <%7 U_J  U Jf &  %7wU %5uffee~gzgvgrgbfee24.0\UXU 7g7g7 g7 g ʸ5 ff t%1 |, `wtewewjew\ewfwfwfwfwewZewVeTT:g 27 2g0g 27 (g&g 27 gg >7 gU7 U >U7 U >f D ff _H5 VT  %7 BT d%e5   0f+&f d 5 RdLd 5 Jd Xd67 Rd  4  4   4   4   4   4 e%^d5  4  4 Nf \ 5 4 5 & & N% 2 bc5 N @ 5 R  %7 R5 c5 `wHN f& %5 N @  N& D  8% Լ& @ 78d @ 7"d 7b @ 7d 7bc c7 Rb EpP & f& le EZUpPNeff& leEUpP 5 N fef& le_ #EpP & f& le5  5 _EpP &  -EpP & f& leC) L   % @ _ _w Q7 Q >Q7 zQ > lww D5 `_*5_*5_^Y  b @ a @ a @  5& T fe f%5 2N 2 fe -4Th  hh H5xfe7 |,%  ? 85 N `tN @ "5 % `   P   a `t f & :e_ 5& T fe f%5N 2 2` @ ` @ 5  fe M5(C,  5-Rg  g|g H5xfe7 |,%Ne vfe Tt -R5Cff d%ee  :=ff %  :=f *f dC*  P >_H8,f dC8, L (]&]_HB,f dc_H)f dCf L J, t Cf L P, t _HX,f d Cf L 7\_H)f dCf L b, t 7 G X!_H)f d&Cf L  :=  :=f h, t Ԏ 2@)f dY4-f d Cf L -n,f dYh-f d } ,f d Lq_ww DC ̵E 5 Wp @@`e ̋ԥ]  |,wVw BNf @ c 2f T A c1ww Cf N A% =@-, |,ww eDe  _5 5̵E=̥_ ̵ E=̥_5! @E=_ |,@% |,̥[  Ne& T ̋ De5& |,̋ & |,N :=5==95@M <ű' |,) :=&@R <u' |,5 |,=' |,Ne& =( #Nf 5@A @`&@& %ff % Cf "Ζ%&@& %f *f d C*  P NN 2= 2@e_Lwbw NN :=@ 2@N - w&w De5=Tu5@e<>@eT Ne - " |, ww D 4ex _v -x x  W 3x x  ?x4e :=wLw 8D%  r   r e0@?Tx Pxww D 5 ̥+ ̥- ̵E 5   |, E 5 Wp @@`e̵̋  |,  ww rNf  )wbw HD  f w4N&  w DC@& d   wؿw Ŀ LL4 C&f d%ww D7 NU ܼ DU 5 >2 |, >7 CNff %wZw FD @@ f d  >.   a L aN :=33 333 & %@  ,ww Ch-  Cf l C8, !JT^FTCB, 7ZCX, 4T,TC) 7 RCn, 7 Q Ch-  uww D  ^ @&  7Se wƽw Cf N A ^ww D  > 2   2! 5 ` 2f %ww ) :=f ww Den* AC  A   |, @ ww 5  Ne &f  ee%> Nep+ t wVNefe L ~,f d,fe L w DCBf@0! 5@x _  @ xt1 @  2 xn15@0@4@0 @0pDA Am10 4 @x DC5w*5@0@4@0 @0pDA Am1  5@pAp@0 @0pt5@0@4@0 @0pDA Am1%  p %  p _  _ x1  _ xz15@0@4@0 @0pDA Am1_5@0@4@0 @0pDA Am1  _5@pAp@0 @0pt5@0@4@0 @0pDA Am1%  p % __w D K & %Ef& % 0 = S tC%( tC =%) tC tC   ww |5Ne ,Ne 57KLB@  x1C* L 5\C*C*%_B @! ]_& x1 96@A@P = @ K#_>_NeL l @e5 @A@P=  = PJ_LB_a@5C+ T% %  p  @  9_@ 7 9Nef l @A@P= @A@P= @U:= Ne@& l @A@P= @A @U0= @A@P= C+ T_r@A@P= @Um= _r5 ,fe @AAaA@P = @@mn8_r _r̋_r@@P=  _r̋_r̥._r@@P= C&* L 5_r7 7 77771 l77 7.@U~= 7 @A@P = 7 @A@P = _rC&* L 5_r_r@A@P = u@1 9e C&* L 5_rfe @A@P_C-C) L 5# ffe % @`/@`  @a~@`@e55 / u- u-  /u- _r@A@P = C) L 5_r_r@A@P = C) L 5_r_r@A@P = @ 1̋&@U = Ne@& l @A@P= _r@A_@@P= Ne@ & l @A@P= @A @U0= @A@P= @U/= Ne@& l @A@P= @A @U0= @A@P= @U/= Ne@& l @A@P= _p@U0= _Ne@& l @A@P= @A @U0= @A@P= @U-= Ne@ & l @A@P= @A @U0= @A@P= @U-= Ne@& l __|Հ_rŀ_r _rC) L 5_r_r@A@P = @U%__r%@}_r @U%= @A_\ ^ @P Ne tA_!Ne@D l @e5 @A@P= _r@ D u- \ vEww @e5} uu@e5} /u-=N N >NL |, M |,N @m5} = N 2N :=w(w @ E 5 @-O@/F@-@e5fe ļN > |,@e5Ne @ae5@ A HN 2Ne :=wX@w >d@  L55= 5 @e5u} {5 u1[ ]N > {  N >w}   5 @55@ ,/ [ {  }  u-= }@ ]=     ,u=Nf N fe L }Ne :==e @ 5@ @m@-ed@ f 5@ @me85w Nd@  L55= o f D 5 +@ mn=e@ @m@-ed@ f 5@ @me85 -Dn4n 27 ,n0`f ZN :==e@ @m@-ed@ f 5@ @me85@e5= @w:uu9{f Z 5,Neff %5 N >@ 3 |, N 2%}N 2euu_|N =5 @mA Am@ ?@ @mA Am@ 5%dd@5`@@ 5@@ 5@ f 5@ @m5@ @m5u} u @ @mHu-@ 5`e@e5 }ee _4@ = ~euu@_Nf =Nf w 4u@  xt2w|N >( |,@w N ,Ne :=5+f > 5N 2Nf > 5N 2e N >N A :=5w 5 5 5 C+  7uNe& ff #e  xz2w|Ne +  |,Ne +5 |, L 5Ne + wUe N ,>5Ne +@w C+  7؜7 8{u5 Ne ܼ {?N := Aw`N 2) :=Ne 5 5z/ @  Nff Ɩ%N A5N 2@5z 05z@e5N h55nzN > wz2 |, N@ NfN A5Nw ^  N ,>7h =7h hhw<C+  7h5yN N ,>55 B5yN h55yN > N = 70h *h@7hw d  L7h? g7 g7 gww rDˋ whw TDˋŀwNw :D 6˥~˥=Ux˥{}7Px @ 5 {`ww  2g,g >d  L7g? g@e7Dx7Fx7 g7 g6x 0xD̋ - x$x fwb R΄ ̥` ˥\ ˋ ˋ˥`ˋ`4 |,  :=5@mNf   5w "5   55 5 5 5 @e5+5 Ne dfe ,_jN f ? v ? ( ee >7 e7 w uŀ Ne  W@ |,Ne \ fef d%5 W@ |, @U 4  4  4  & f le N 2N   5 FBefef %%%| %   5 ӀN X \w5 @mAAmAEH 5!  E%  % %  N] RΘw Ru Lu Hu Bu |,4u 0uwxw d R -ced c 7ct :=cecw c mc c mc ttt tww DC_ * ?  ["@EA@ _[ˋ ̋ &  @ w5 7[%˥]"EA@ EA@  5 ] -@EA@  5]3 |, E5@ w DԋCӋ@A@` 5e2bw ,b*b-ed  b 7bb ma a mae&f / CԔ CԔwVw BDCEE@ ԋ w0 EE@w E5 %  @ @ 5 5 Jr @#E5%?E@ww DLe5ӕAӕ-E5?5 5@ 52 q/5& 5@ 5 qU@5 U@E 5@ U@5  qӕMӕ-E5 5@ 5 `q ' % % % %  %%  Lewӕ^%ӕ?U@w b D5 5C̋0̥^   55̋@@]@mE  5 555} @ww   5 u  &AN A@@Ei@-e=wlFf0P@xJ e)u @E 5 a"F F@e` _@E 5 @ef@e0@?_FNe 5Xx@-  eNe 5mM_@-_Ճ e_@E 5  "@E 5 89_6tA@`e _@E 5 @E 5 _h  @E 5 _6Wp @A@`e _  Ne 5^ @ cC@-  eNe 557 Y_6}_@_d5.f f  _hf f  Z4f f  Gf f  4f f !f f  Np  _:D   U UE_w X H &0C5 5 @E5%-"as%D @ @m5 @E %-@ @m , _rv ._e ._dl _ _Ne$@ @m& 5Z_ ! _@ZE@mE%5NZ @ZE@mȕc@ @m NZf T@ @m  Ne\@ @m& 5X:fZ l @ZE@mȕ5+@ @m 5V @Z  @VfZ NZf  @ZE@m AVHwNw :d@%Nef @E@mE- fe %e N ww  f we N  w u@ @  wv@E%\_۵ @E r y~2GC ?;  B E%0%7  te@P % E      u}@                 @E%^ ?@E5w u  /Ne tA u@E%\@E%^@E= =@ww vu"  ^ @ 2u+7@E 5@ . f'^ ?@U@= " = @w^\\  "f" @E 5 } @E 5@ \ @tEe0= @tEe0= @Ee0w ! 5 5 @ApCC N fC ޖ%u %N fC ޖ%9 5 5 @ApDD N fD ޖ%u %N fD ޖ%T ) wVw Bu5u5@@mE%u-_Nefe o  _@@mE-u-1fefe ٖ%&Ye %C7Nefe   @CEf6fefe Zٖ%&fefe Fٖ%& eNefe   @DEf %ww  S ( Z   ) M  Sx ww  S e ww pD ? :' _ _ _X S_ _G& >5Ne %_%_5 %Q@CE%5 @DE%5?@e5% @E=e 8 |, _} u} =fe  %_5#,d  аD5 _ 5 5 fe  5b_㳜C5_E5 5 fe 5f  S e _f  f _ f f f  R$_f  #p5Ne %d%N\ _f _ 5 5 @ApCC N f u %N f 5  @ ApDD N f u %N f ) w@w ,DC 5DEEC@aE% _ N  _@aE,  , %De %CJ N   C&K @P& &A %D @P Nfe  %D @P& z &fe eE N   D& %ww =5B@m5  @ 5!@w5 u- -u- )˵EJ^@ E%\\ҕ\E ˋB-ނB-ҕ D- %B- w  & ff e5=@ww u@ 55 @@mC r e0Ȑ A r 5 @@mȕ- @@mN wnw Z5 N 5@@m5@@mAAmH@@mH u-ww D>e  & & & & ) e _7 \ ܼ \   2 |, ,>7"K ,5  @ a @ aȥ-@ a _5 5 >Z & %E5u == 27 <)@e5 52 :==@p@pu 52 :==@p@pu 5N :==@p@pue5@Aepu fef d%5 <@ |, & YYf leNe tN | X_ff %_5 5 _@ a 5 @m 5/@-=Nef r %2u-  tC fN@ a&) e-VL`  `` H5xf' %i@E%@gu-  tC fN@ a&) e   tCN1  u@e5 @U = @%/ @ŀ= & & & & fe e @ 5N 2 @ a _u-  tC fN@ a&) e vGpG >7 hGww D JD pG Lww D D le \ww  D L@fe @fe Nefe T w^w JD@e5@e5@e5@e5@e5@e5)R-7  N = SC& 55Ne e ww   / x 5   / x 5  5 5 U 5lNf % Nf % wNT4-  w DTCfe @%& p%5uTTC  & T  <feTC @%wJTff "%wvw bJ  >T U ~) :=f) S w6w " fu5 W  Ne ,A@e@ 5 u  vi l @wֿw ¿& `%5u BD** d%X D UC*  * d%7 Cff %wVw B& ॖ%5u C** d%y C TC*  * d%7 xCff %w־w ¾ & `%5u DC** d% Q C TKC* CC* L C 5 Ne ,< ff Էef&A@`` &% w`w` * d%7 Bff %ww ̽ 5 TCfe @% t4n4 27 f4) 5N :==%@55@Bep, 5N :==@p5@Aup@ABepNe \ fef d%5 3@ |, TC  & QQf leNe tN | TP7 NP A feTC @% fwbw N5 Cn) 5@5 N &|Wp<u bu5 W Ne ,A@@A 5u  u @ 5N sw»w 5 5 C- _C2 L 5@5@ȥ;_zu-_z@ -f d_J@5@ȥ- 5$f i5  @ 5 @5@ȥ-    5_J**f d@5 @ȥ;u- \ Y  QfeO %Yy 5 fehO %  ) D ;D-=;00 2 2@5@ȥ;u-@ȥ;@5u-_+" @00 2 2NI S @5u-ww C2 L 5C, L 5C, L 5_J@5@ȥ;cu-_@ uNf 5Nf 5  #9  K lf A  Nf N @5@ȥ;u-@ȥ;@5u-" @ NI S @5u-ww *,N 5N 5  5Nf _uN 2 =*f  5 =2,f Nf u@5@ȥ ȥ; 5 =+f @f  5 =^+f @f  5@@me =5u~ / . @ A H u@ A H@f  5 =+f @f Ne 55u% @ A H 5}@f wuN 2Ne =5u% @ A H@5@ȥ ȥ;u-@Ap@ApN 2u@5N 2w 4@p@Ap@p@pww DC̋ ˋ̢  ˋ̥ ̋wڳ̥̋  ̥̋  w Nf d ww  H8< L7:86828Wpm(8u5 wpA A r WpAmu@AA@Nf d @ u@e5u-ʂN 0wN :=7Wpm7 7Wpm7ef& B 5 d7Wp \7mV71>H7B7 b}e-:767e 07,7WpN7 77@_w LC) L 5) 5f@5& % @@mȥ/@@mȋ @@m=)w5 ;AWpm6AuNAWpmv6f@5& % @@mȥ/@@mȋ@@m=AWpm,6A@ - 6 w V$e  P,C \7 D,_7 FN ܼ F N 52 |, N ,>7v55 , @5& 5-8rM  lMfM H5xf7 |,%TCfe @%TC _@e55 5 %fef %5ut5 @@mAAmp u-@e5 @= % @0@e5 @E 5 =  L5N :==@0 Cffe 7 3feTC @%wD/bin/sh/bin/tcsh*?_-.[]~=NOREBINDLANGLC_CTYPE/dev/SHLVL1HOMELOGNAMEUSERTERMunknownEMACStPATHUnknown Error/etc/csh.cshrc/etc/csh.login/etc/csh.logout new New mailMail/usr/local/usr/ucb/usr/bsd/bin/usr/bintcsh: Trying to start from "%s" PWDdirs%d ~%s%c~%s [] [|+] [+]$?<$?#$#-*htrqxe<<$\`Syntax Error%s is not allowedWord too long$< line too longNo file for $0$? not allowed hereIncomplete [] modifier$ expansion must end before ]Bad : modifier in $ (%c)Subscript errorBadly formed numberNo more wordsMissing file nameInternal glob errorCommand not foundToo few argumentsToo many argumentsToo dangerous to alias thatEmpty ifImproper thenWords not parenthesized%s not foundImproper maskNo such limitArgument too largeImproper or unknown scale factorUndefined variableDirectory stack not that deepBad signal numberUnknown signal; kill -l lists signalsVariable name must begin with a letterVariable name too longVariable name must contain alphanumeric charactersNo job control in this shellExpression SyntaxNo home directoryCan't change to home directoryInvalid null commandAssignment missing expressionUnknown operatorAmbiguous%s: File existsArgument for -c ends in backslashInterruptedSubscript out of rangeLine overflowNo such jobCan't from terminalNot in while/foreachNo more processesNo matchMissing %cUnmatched %cOut of memoryCan't make pipe%s: %sUsage: jobs [ -l ]Arguments should be jobs or process id'sNo current jobNo previous jobNo job matches patternFork nesting > %d; maybe `...` loopNo job control in subshellsSunc fault: Process %d not found%sThere are suspended jobsNo other directoryDirectory stack emptyBad directoryUsage: %s [-lvn]%sNo operand for -h flagNot a login shellDivision by 0Mod by 0Bad scaling; did you mean "%s"?Can't suspend a login shell (yet)Unknown user: %sNo $home variable setUsage: history [-rht] [# number of events]$ or < not allowed with $# or $?Newline in variable name* not allowed with $# or $?$? or $# not allowedIllegal variable nameNewline in variable indexExpansion buffer overflowVariable syntaxBad ! formNo previous substituteBad substituteNo previous left hand sideRight hand side too longBad ! modifier: %cModifier failedSubstitution buffer overflowBad ! arg selectorNo prev search%s: Event not foundToo many )'sToo many ('sBadly placed (Missing name for redirectAmbiguous output redirectCan't << within ()'sAmbiguous input redirectBadly placed ()'sUnknown variable modifierAlias loopNo $watch variable setNo scheduled eventsUsage: sched -. Usage: sched [+]hh:mm Not that many scheduled eventsNo command to runInvalid time for eventRelative time inconsistent with am/pmOut of t_c_ string spaceUsage: settc %s [yes|no]Unknown capability `%s'Unknown t_c_ parameter `%%%c'Too many arguments for `%s' (%d)`%s' requires %d argumentsUsage: echotc [-v|-s] [ []]%s: %s. Wrong Architecture!# History loopMalformed file inquirySelector overflowInvalid Error%s: . <>erwxfdzopls%job%job &/bin/loginthen/endifendswendlabel%s %o cputimesecondsfilesizekbytesdatasizestacksizecoredumpsizememoryusehoursminutesmegabytesunlimitedremove hard@aliasaliasesallocbgbindbindkeybreakbreakswcasecdchdircontinuedefaultechoechotcelseevalexecexitfgglobgotohashstathistorykilllineditlogls-FnicenohupnotifyonintrpopdpushdrehashrepeatschedsetenvsettcshiftsourcestopsuspendswitchtelltcumaskunaliasunhashunlimitunsetunsetenvwaitwhichwhileHUPHangupINTInterruptQUITQuitILLIllegal instructionTRAPTrace/BPT trapIOTIOT trapEMTEMT trapFPEFloating exceptionKILLKilledBUSBus errorSEGVSegmentation faultSYSBad system callPIPEBroken pipeALRMAlarm clockTerminatedURGUrgent condition on IO channelSTOPSuspended (signal)TSTPSuspendedCONTContinuedCHLDChild exitedTTINSuspended (tty input)TTOUSuspended (tty output)IOIO possible interruptXCPUCputime limit exceededXFSZFilesize limit exceededVTALRMVirtual time alarmPROFProfiling time alarmWINCHWindow size changedSignal 29USR1User defined signal 1USR2User defined signal 2Signal 32Signal 33 :^$*-% -$*(=~: \ };& %d:%d.%d%d[%d] %d%5d %-23sRunning Done | ) %s +-/dev/null%Uu %Ss %E %P %I+%Oio %Vov %Wsw%ld.help.1.8.6HPATH:/usr/man/cat1:/usr/man/cat8:/usr/man/cat6:/usr/local/man/cat1:/usr/local/man/cat8:/usr/local/man/cat65075110134150200300600120018002400480096001920038400blcldcdldmeifsicimipkdklkrkumdsovbDCDOICLERIlicokmanonot (empty)yes%d tabsmetabaudrowslinescolsgett_c_sdumbxtCOLUMNSLINESTERMCAPno backward-charbackward-delete-charbackward-delete-wordbackward-kill-linebackward-wordbeginning-of-linecapitalize-wordchange-casechange-till-end-of-lineclear-screencomplete-wordcopy-prev-wordcopy-region-as-killdelete-char-or-listdigitdigit-argumentdown-historydowncase-wordend-of-fileexchange-point-and-markexpand-globexpand-historyexpand-lineexpand-variablesforward-charforward-wordgosmacs-transpose-charshistory-search-backwardhistory-search-forwardinsert-last-wordkeyboard-quitkill-regionkill-whole-linelist-choiceslist-globlist-or-eofmagic-spacenewlineoverwrite-modeprefix-metaquoted-insertredisplayrun-fg-editorrun-helpself-insert-commandsequence-lead-inset-mark-commandspell-wordspell-linetoggle-literal-historytranspose-goslingtty-dsusptty-flush-outputtty-sigintrtty-sigquittty-sigtsusptty-start-outputtty-stop-outputundefined-keyuniversal-argumentup-historyupcase-wordvi-beginning-of-next-wordvi-addvi-add-at-eolvi-chg-casevi-chg-to-eolvi-cmd-modevi-cmd-mode-completevi-insertvi-insert-at-bolvi-replace-charvi-replace-modevi-substitute-charvi-substitute-linevi-zerowhich-commandyank%-15s-> %s no inputSpcLfdRetTabEscDelreturnlinefeedtabescapebackspacedeleteUsage: bindkey [options] [--] [in-string [out-string | command]] In no out-string or command is given, the binding for in-string usage: bind [KEY | COMMAND KEY | "emacs" | "vi" | "-a"] Invalid functionemacsdefaultsmggnumacsviALLEDITORVISUAL(nil)JanFebMarAprMayJunJulAugSepOctNovDecHOSTpdp11tcsh %d.%.2d.%.2d (%s) %s options %s%s%s%s%s%s%s%s%s%s%s%sCornell07/04/917b,dl,dir,sm%d.%.2d.%.2d/etc/utmp%n has %a %l from %m.%a%slogged onlogged off@(#)alloc.c 4.1 10/9/80assertion botched: %s allocp>=allocs && allocp<=alloctallock()q>p&&qalloctp>clearbusy(allocs[1].ptr)&&p<=allocttestbusy(p->ptr)p->ptr > allocp && p->ptr <= alloctMemory allocation statistics %s addr %06o, len %5d BUSY content is: %s addr %06o, len %5d FREE %d used, %d free, %u end /etc/tcsh6.00strgslseek of mkstr file failed read of mkstr file failed  $,4?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ly+?M_s1Re,I[m /=I]r%<`|+9Bb,Oe ! 1 N a p  ! ; F ] q  / H ` ~   * < /0000(060B001&1<1N2d2|2666555556556655655555565262626266 6   $ 6* - 2 Ĺ: ̹@ ԹH ܹM P V _ ܹg l s  } ܹ ܹx } $ , 4j< D L T : \d lt  lbr |  fF      ĺ ~TY ̺ Ժ ܺ !  F(.6$=,E4K<TDYL_TC : @ H _ s }   j G_Ceipt~+0<A^MX\{/4LSfkLJIBKDIDIjKDIJDI2KDI~KIDIVK|IDIpI JDJfJDIDIDIDIDIDIDIDIDIDIKDIDIDIDIDIDIDIKDIDIDIDIDIDIKKDIDIDIKlogoutautologout60automatica.outttyanystatus01tcshhomeusertermversionuidgidHOSTHOSTTYPEeditaddsuffixshell/tmp/shverboseechopathpromptprompt2prompt3cwd*.historysource-h~/.history~/.cshdirs/.cshdirssavedirsargvsavehist/.historynormal/.logoutjobs# > %R CORRECT>%R (y|n) unaliasaliasprecmdcwdcmdperiodictperiod-l/./../cdpathpushdtohomepushdsilentdextractignore_symlinkschase_symlinksPWD||&&|^&=!~({{ ... }}PATHdefault-n-noglobnonomatch` ... `ampmchildtimenotifyprintexitvalue( ) || && | ; ; << < >> >> ...%%%+%-%#continuecontinue_args_pause`pwd`histcharshistlitUSERLOGNAMEwordcharsTERMHOMEbackslash_quote):mailwatch/.tcshrc/.cshrc/.loginignoreeofnoclobberhelpcommandfignorerecexactlistmaxlistlinksDING!correctcmdallautoexpandautocorrectautolistmatchbeepnevernomatchambiguousnotunique nobeepvisiblebellrecognize_only_executablesnohupnicelistpathnumshowdotsthen^DlistjobslongwhormstarrmshlvlSHLVLLANGLC_CTYPENOREBINDLINESCOLUMNSTERMCAP^^^^ _&_^,_|aaa&b~D.n*@   " ' , 17z =M \@CFILOi RUX[^adg u j m\ mpsvy|f JRRBŮ2ǀ& )<>()XbbbnnbnbnnnbbnjCܹa 4f <Z˶Pʮʔ˦j˶˦,,,,,,,,,,ifwhileswitch            Xވ`;&(| '"<>X)2.*>*6*>*B*6*N*r|&.*Z`BT((((^^z҆^^*bْhh6N6D(.8&&&&&&&&&&`&&&&&&&&&&&&&&&&&r`&&&&&&&4&&&&r&&&&&&&&&&&r`&&&&8&&&^&&&&r&&&&&rT0Tnۈۨls-CFrmdebugcndebug p|plpTERMCAP/etc/termcapTermcap entry too long Bad termcap entry Infinite tc= loop Termcap entry too long E^^\\::n r t bf qrrOOPS5MS7) /getwd: can't stat /./getwd: can't stat .../getwd: can't open ..getwd: read error in ..getwd: read error in ..//3/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwdlongjmp botch longjmp botch SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec45mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d5566*6B6L6f6x666666666 77(777G7V7g7{777777788"858F8\8v888889!989R9t99999::C:d:}:::::;#;6;X;k;x;;;;;;;< <2/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 4pppdo xȰfְeȯgcsدlدL u$DOX6U=(\0f'l3RlLNPRTR0.R0.0 Sj e7cce7 / %  7%  Lw BO2 75 , a'  >/ F% L@e5l @ ? ~ ff %5%  5` @ _J x4 `5  F% L /  /  /  / u55uNe& "# Ne "#  24 f G%5L%L  F  L0 >/f4 Fe_pN 5 N F% L @-_( >/_ _(Ef 5 NG F%_p N  _p`f H'@  e F  L  @& H   F f % NNf %N 0J 0J j  x8  LN   F  F%N 64 L& & #%N 8H&ffe nD%e52 8H&&fe ND%e5f> E%fC E% & fe G%5f Nefe fH E%fM E%Nefe fR E%Xfe Nf  LwJw JpdN (25% wf 5 z F wJNf < N I  &f %5 * F N 0JN 64@N GNf  I V Nef L N  Nef L u-u-w IN 4% @6 8H& RB & FB & :B eee% @ F  L`@& |3e #  3   F wI e & %%   L: 3    %  F%f % _w pH fe 4% E 6@@&@&@f&@ f&@& @&@&@&ff Fel F wG fe 3 Nef F%:fe 3  Nfe H˕:Ne@@&@&@f&@ f&@& @&@&@&ff Fe_(w F +5 f p/e ONe 45@-%%  wFw ~F  15/f 3 5 u55 8+5 <  #  (# fff (e ONe 45@-%%  wEw ED f %  & % 4& % Z 4& % M 4& % 4 & % 8 0 4t & % ) 0 4t& % 4& % 4& % 4 & %   F  LwDw D< l! I  ^5   % %   ^5% %n wpDw VD] F  LwLDw 8D -N X%=  F w D.f 3   F   @6 F w C@q wCN X%A1r F w nCD ̋  F  5%f Few$C@p w CD̋ F ) F%  5@Ap f FewB 5%@pw lB@? wfBN X%A1 @ F w ,BNef ( w"B[ F w ANef ( wA F w A@ wAN X%A1  F w A  F  N X%A1 w`Aw LAD̋/@ && H/ 3 & H X%A10 F w@ >  L  F%w @  Ne +5 @&@ & |3e7 wz@w f@ @ 0  w\@  "Ne D0Ne +7  f J& T P& %% J 5 & J& 83 5 & J& &! 5%0k'lolLNPRTR0.R0.0%%%  %del%eA r A rd A r % 5 m 5`u`u %$A r A rd A r nA An 5`u`u A 5`u`u Qff ,6e5u* 55 @pH_@w R>N f F% _N? f F%@J f F%@X f F%@e f F%@ f& %z f F%@f& % f F%@  f F%@ f F%@  f F% @& %   f F% & % ""  `@& H@  @  f F% & % 0  f F%1 & % C 3 f F%wz ^-XR N7%:f 3 (0 ( " f , k ,     ?w9 ̥:7 z*+f w- f ,   @m7& ~ x 9 E5 @@l w1w b8DC E5<E@e33. @;E  5 , @;% & fE HH 5  IU3 3  w7w 7  Z7e@w7w r7 " *N7    *N7 7 bwV7w B7 7RwF7w 274  *N7   *N7   6 2Ne & L %N L7A r& L 7lf, 0J  0JR *N7 J +˥/ˋ ˥#˥#ˋ˥#ˋ  4%   0JwD6w 06 r   6 7^X Gw6w 6 HB 0J7 :w6w 5DC  ̋̋w5w 5    6 7 EJ 4%7H:&  78:&   7"T:&   &  T %,&  ̋ Lw*5w 5 `  \ L  w5 F 5 ff L% 50>  8 w 4  uN 8H5&f %5w4 5  f H  0   w .4 p  @e5ff l%5w4 @5  w-4 <  4 w 3  G  &  7%7w3  H 5 f 6 7 w <3 `wB3w .3 t  w03ww 3 ^X 87 P  LF 0J7 >w2w 2w*w2w 2  @ E w2 ^55% % 4%   3  % 7 & % 7 & %  7 & %  7x & % 7n & %  0 7PwN! & %  0 7>w<$ & % 7$' & % 7* & % 7_w 1  w1  7  = =55 ff (e55v Df`& E%e& E%e& E%e& & E%e7w 0  _-  H_8_<9 5 & f G%5= 0 5u fff Ge5 #u 1f G%50 :=$N Jw/w /D      + - ̥9 Wp @@`e̥0  wv/w ^/D5 5      + -! ̥9 f& ff &eee@ ee@ 5u̥0 A@  w.A@wB.w8.w .D d +7Z -P ) s 3  33 a r w wj.+& f Gew ".fef O%5 Zw. w -DC˥=  8H5Ne& 1   w- 8H@-KҔ"5 e  ,@e  HN 7@e  L5@ f E%w@ m0 u ʋʥ=@me LA mj @ m\ ʥ=ҕ=Ҕw , Nef 1 D m ew,w ,Nf # w,`w+w+w+w f,Nf ># wd,~w+w J,4De _$ t4 t t4 4t Ne&& <4% _$t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 $ 55 Nefe P4% & %5u7  && <4%  fe P4%ff % fe& <4%w*A@E f& w *hw*w *DCN ``Hԋ w*``A@w *DCB N @mAmHԋ  @mAmA@wJ*w 6*N 8H 5 L5 w"*Nff E%@w )DC @-w) ʋ 5 w )D Lԋw)w )DC 8 w)5 7$@  55@- 7 5!w D)DC  / 7 555  5  55@- 47z@w(w (N + &w(w (D el&&&&Wped f WpeN f > |3e>wp(w \(5 5  AaAE f&A@vUU5u %w((w (D  w (̥/ 55  8H&f t e %Nfe &H  fe G fe G ԥ.̋De & . & G %fe0 G% J %,@e05e 2'wNe$ 2'wNe( 2'w%r_' _'% _'%2_'WpfWpeme, _'@e\5 N 2'f&t^`e -< @ E3&$ -  *te%5.N 2'f&@.e@.A Ep@.A Ep - s% -3% &$_' - t-%_' -t%77te%5  e%7p -: _'@e%7Pw T% Nefe 0wD%7 AWp@7* $7 & f 0 % &H %77 w $7 7 7 7  % &H %77w$w $@ 1̋  z'  z'  2  w$w z$  @55 w-w-  t % -  t5,^ 5,` - %$ue%&&fe Xe3 e%p e%3w#w #& f e  w#w # &Q@f& e5uQ@f& e5uumumu _,eeQu  %QQ eu % ff 8et ff re5u< ff et< ff :eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpe u4  AmA f&A@ 5u  AmA 5 u ܃@ 44  ttw !w\ w De LN 8H4e e >/  8H4e  Be v Nfe 4%wd w P -@ * wJ N 6& |3%6&e& ;eww  u@t5J&5L&@ 5&Nefef P4% (3A@u5BtrL&2J&@ Aup& fef P4% u-u-u-@w^w J fe 0@w< @pHA@tww  1!,& 3   w 1& ' x1%7m˕, 'Nf 0 w D  !     +  wne% - r<N r<&@&} ' |3e ' ~ ~w  Nef 1 ww D 5  =,& 4% `5ȥ=  = @we  w f Nef l2@wZw @ f l2@w: w "D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef ,4,5@ 'Ne ,4 %ʕ/  f G% %% wbNef ,4ҕaʋʥzʕaw  BuNefef O%=@@wЋ Ћ   Ћ Ћ  Jҋ~ @@&w< wSwmownd4lw e& 7 D7yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_65P_6 , m"@e4 ,5Ne & L  uN L4USt%5 I5 I5& & G% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff G%ށ̥a &  Ge 3     U̥r 33w 4$ L \ w5 4@E%@EU5N&e &H &e G Nf&e G%4 IN&e &H &e G Nf&e G%  (Ne& L  ff eee@ 4t@t"4 4t J *N_7w N J@ JN *Nww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  ? ve@ 4tw"w D55ff %f&& "eff&e e &e B 55 wNwJ>'w5 5 w D5#5ff T %f&& eff&e *ew6&e D'44  && ef&& Ge&e & O%%U w D5_;o5ff %f&& eff&e Ze L&e D8f f ff&e V e 744  && ef&& Ge&e & O%%UU8w @@m e%fe XL  &e B 55 3ff `%f&e@ &50c &e B 55 3 F U44  && ef&& Ge&e & O%%&_;fffffe e _;&e % _<_;e_<  mm@ e@ f& ef&& Gefe& O%%_; @_:w @0 0 @0 N =77B'ww D85_>Ne& Lq fe Ve4-4-/44  &&  ef&& Ge&e & G%%&e XL &e B 55 ewwF'w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  ? ve@ 4t4-4-/44  && ef&& Ge&e & G%%&e XL ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& Ge&e$& G%%&e$ XL `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& Ge&e$& G%%&e$ XL `Btp$t t"  ff Nef&& Ge&e$& O%%Uw w r D5#5 5 ww J'wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& vE% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm E% a@ `` e w D a@@m e  w e  aAm HN@`@m &f E%  aN f`f E%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef O% IU4 4  fef O%5 w    6v&  @ppC`p   6@Cwzwtw D I & & Ge 4E05Ew7" Ћ P ы A@PЋ w FD:5UE5Hw* _I5uNfe & O% _IbNe & L  uN L)U5| m- 5 & O%St%  L U   & O% S U _pH @_tHw DE%%"5   & O% U wv w ^D55@ I  J 3 *N 4 4 4 4 4 ww~w  $5+ V &5e-8e % & v    L ww  5f L 78 f L 7~wX@ m7 %e w       L e-ww D 5 e %w  5 e-pw 0J Kww  N Oww rDCDpC L XL wZw FN *NwJ ~5 & E        ~5>wlYwfw Net@f Le  w6w.w  xh'U7jf'U7`h'^f'VAe vBB7 D  :%4 55 a  a!PE -%f' w$ N `e vWt vw@ `e @  N%e U? `e 7zf'U?nٔ a7` XZ?RNU ew dD.E wZw FD5 *N 5N L!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%ɷmɇ%w w7*'$!     F 7<& A,& BF7!W-S7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_Q@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& HH z   5 , @ :% & f E HH  (˥-%0     ,:% &  HH 8 5E& z   5 , @ :% & f E HH  w@(#) Copyright (c) 1988 The Regents of the University of California. All rights reserved. @(#)chpass.c 5.10 (Berkeley) 3/26/89: :,<V B K O S" Yb ` g q ~  BJVLoginPasswordUidGidClassChangeExpireFull NameOffice PhoneHome PhoneLocationHome directoryShella:chpass: %s chpass: unknown user: uid %u chpass: unknown user %s. chpass: %s /etc/ptmpchpass: password file busy -- try again later. chpass: %s: %s; wchpass: can't write %s; rootchpass: root uid should be 0.chpass: warning, unknown root shell./etc/master.passwdrchpass: can't read %s; chpass: can't fork; chpass: mkpasswd failed; %s unchanged. /etc/master.passwd/etc/passwd/etc/passwd.dir.dir.pag.pag.orig/etc/passwd/tmp/passwd.XXXXXXw+chpass: no temporary filechpass: edit failed; chpass: no changes made; chpass: line too long. chpass: unrecognized field. chpass: line corrupted. chpass: illegal character in the "%s" field. chpass: gecos field too large. %s,%s,%s,%schpass: line too long; %schpass: corrupted entry; %s%s:%s:%d:%d:%s:%ld:%ld:%s:%s:%s %s:%s:%d:%d:%s:%ld:%ld:%s:%s:%s /etc/mkpasswdmkpasswd-pEDITORvi:::::::::::chpass: bad password list. re-edit the password file? [y]: usage: chpass [-a list] [user] @(#)field.c 5.8 (Berkeley) 3/16/89chpass: empty login field. chpass: login names may not begin with a hyphen. chpass: can't save entry. chpass: '.' is dangerous in a login name. chpass: upper-case letters are dangerous in a login name. chpass: can't save password entry. chpass: empty uid field. chpass: illegal uid. chpass: %d > max uid value (%d). chpass: empty gid field. chpass: unknown group %s. chpass: %d > max gid value (%d). chpass: can't save entry. chpass: illegal date for change field. chpass: illegal date for expire field. chpass: can't save entry. chpass: empty home directory field. chpass: can't save entry. /bin/shchpass: %s: non-standard shell. chpass: can't save entry. @(#)util.c 5.9 (Berkeley) 3/27/89JanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%s %d, 19%dTZ , ,#Changing user database information for %s. Login: %s Password: %s Uid [#]: %d Gid [# or name]: %d Change [month day year]: %s Expire [month day year]: %s Class: %s Home directory: %s Shell: %s /bin/shShell: %s /bin/sh,Full Name: %s ,Location: %s ,Office Phone: %s ,Home Phone: %s /bin/shPATH:/bin:/usr/binshj : illegal option -- : option requires an argument -- /bin/sh/bin/csh/etc/shellsr/etc/grouprr /etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d $.HZl| )8I]q(>Xv4Vt%F_y:MZn(>XkRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator!)-59,=AhEIMQUY]aimqu yTZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d. ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired N'r'r'PdPoPxxQfQexPgRQc^QsPlPLPuPDPOPXPU0(l#M J000/usr/bin/sort0)l:5,.024R0 R0 0 @(  e7cce7  /  7%  | w #B 5u   55 Ne R5% 8x j  | @7 %7J _U  a  , _B | _B 7 }x j  | Ne   | 5x j  | /f  7Z _    f _ _"  ~ 5% 5 t  %-  _  a5 5  % u-T %   % B  : 7    f֝T       Ne 5    5 ,  e%_      x je | %   x je   Lx j  |    `  7~ bx j  |   d fe  @@& fe |" je  @fe& P% ! @a0Ne Be_ʥ ?  @ ȕ 3 5&  @,@ % ~ @ Ej f E&V   %_ < 6 @ ȕM3$ 5&  @,@M% @ EE&M   @ ȕ-35& @,@-% v@ Eb^E&N-  E _ ʥ ʥ ʥ =  @ _T5& @,@x@% @ E_TE_L_H  @ ȕ^35&~ x@,@^% Z@ EFBE&2^  $ @@xf  (5 @,@&@@x% _2@@xE&  ʥ  @5 5 J  | _<_w hx j  | w^w JH j  | wBw . d 3 *    d f   &  e |  P!  dww  N &   ww t De t4 tt 4 4 Ne&& % w:  eu @ w/Wwrw DC AupB 4  & %b x5% 傎& %`@ @m A 6&@w|  w ^l fef D$%5 wJ w 2Nf w0ww D Lԋww N R  ww D el&&&&Wpe2f Wpef feww 5 5  AaAE f&A@vUU5u %w^w JD w@̥/ 55 &f  e %Nfe  fe f fe f ԥ.̋De &  & J %fe0 P%  %,@e05e p wvNe$ p whNe( p wZ%rP_ H_ % <_ %2_ (WpfWpeme, _ @e\5 N p f&t24e - @ E3 - *tel5.N p f&@.e@.A Ep@.A Ep -Z s -F3 6_ -& t-r_ - 7*7$tel5  e7 - _ @e7w  Nefe wz7 AWp@7 7  f *   77| w $7 F7 7 7   7P7Jww  ̋    2  ww   @55 w-w-  t p -  t5,2 5,4 -d uel&&fe Xe3 epVe3ww & f eww  Q@f& ~ e5uQ@f& e5uumumu _eeQu  %QQ e0)l>5,.024R0 R0 0u % ff et ff e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeZu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw&!ww De LN 4ee |  4e Be v Nfe r%ww -@ wN  f% ^e& ;eww 8u@t55 @ 5Nefef % (3A@u5Btr 2@ Aup fef % u-u-u-@ww  fe @wr @pHA@tww : !,&    w  1& %7˕,Nf * w D   !     +  we% - r<N r<&@&K  fe ~ ~w $ Nef  ww D 5  =& % `5ȥ=  = @we  w  BuNefef D$%=@@wpЋ Ћ   Ћ Ћ  Jҋ~ @@w hN "! HNef !?@E% 8X 2 "*L-X   e f Ne u-u- wb   w D D 4 4  "w4 w  f J %  P Z!4 4 w w D 4-&4-!4 4   &e & P%4    w me   s lt  &w W f r @  W f r@  @ Swx $lwh e& 7 7 gw: w  & f lew w yw w D85U5_5P_  m@e4 ,5Ne & !  uN Z!4USt%` 5Fl @5Bx @5& & P% 45@e-4  % U5EU  w\ E w : D 2 +   r= wB w 5 a U5ff J%ށ̥a &  Ve 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef D$% @U4 4  fef D$%5 w2    6v&   6@Cw8w27 Ћ P ы A@PЋ w FD:5UE5Hw* _&5uNfe & #% _&bNe & !  uN Z!)U5| m- 5 & #%St%l  "! U   & #% S U _ @_w DE%%"5   & #% U wv w ^D55@ @   3 " 4 4 4 4 4 ww~w  2$` 5+ &5e-e %P &     ww  5f 7 f 7wX@ m|7z` p%P e w  Z L    e-0ww D ` 5 e %P w  5 e-w   ww  N #ww rDCDpC Z! wZw FN "wJ ~5 & E        ~5>wlYwfw Net@f T!e  w6w.w  JU7HU7JHAe vB7   % 55 a  a!PE -j%H w$ Z# `e vWt vw8@ `e @  Z#% e U? `e 7HU? a7 ?U ew dDE wZw FD5 " 5N Z!!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7*'$!     b 7X& AH& BF7!*W-(7w 8uDAB %u f& & e w5 5  W- W00~u5  .luX Bw* J@B |_&@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w???@(#)write.c 4.13.1 12/31/93Usage: write user [ttyname] /etc/utmprwrite: Can't open /etc/utmpwrite: Can't find your tty write: Can't stat your ttywrite: You have write permission turned off /dev//dev/write: %s not logged in%s on that ttywrite: %s logged in more than once ... writing to %s write: No such tty wwrite: Permission denied Message from %s@%s on %s at %d:%02d ...  Write failed (%s logged out?) write: Timeout opening their tty EOF Try again SHELLSHELL/bin/shsh-c! SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d(:JVhz+?^m| &Dc$Br-Gc{  ( < P c r & 9 R t RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator   ,  h    # ' + / 7 ; ? C G TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/dev/ ((((( AAAAAABBBBBB 0TT<%d"%o.%x%f%e$g%c%s$l$LD%uH%D&%O2%XZ%U0*l/R0 R0 0 @$f x e7cce7& /   7%  w 6 f :  & D %5 NF 2    7wD 7 7Nef  N d7xNpf %N  r, LBWp,m<ef <%.&&Wp,mff e e 7%7. @& P% *@ P  %  %  F 2  t0 l X R N. %.  Wp,Bm6e z%  @  ww N     %#f P a & J %%U& J %% & %5& J %-j %# \5% P%F 2 w: P    & % w wDw DC+ 5  a  r5 w: w U5ff %̥a &  `e 3     U̥r 33WwRw D Lԋww N  rww D el&&&&Wpef Wpef8N eNw\w H5 5  AaAE f&A@vUU5u %ww D `w̥/ 55j &f ` e %Nfe  xfe p fe p ԥ.̋De & D  &  %fe0 %  %,@e05e w^Ne$ wPNe( wB%r8_" 0_"% $_"%2_"WpfWpeme, _"@e\5 N f&tnpe - @ E36 - *te5.N f&@.e@.A Ep@.A Ep -B s -.3 6_" - t-_" -77zte5  e7V - _&@e76w @ Nefe H w07 tAWp@7 7  f   77 w 7 .7 j7 h7 hz  77ww ~ d̋      2  wzw f z @55  w-w-  t  -v  t5,n 5,p -L 5ue&&fe Xe3 epe3ww & f etww t .Q@f& e5uQ@f& e5uumumu _ eeQu  %QQ eu % ff L et ff ^ e5u< ff  et< ff & eL A@e@ f&  et e  =  r  rd > r 8 8 rd ( A4 5 8u 4  A4 f&A@ 5u r  r   A4 @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw!wH\wBw De LN 4ee  4e Be v Nfe r%wJw 6-h@ w0NF %Fw  fe H @w @pHA@twDw  d!,& 2   w 1&Z <%7˕,ZNf w \D F  !     +  w(e% - r<N r<&@& Z eZ ~ ~w  Nef ~ ww D 5  =& z% `5ȥ= ~ = @w@e  w  BuNefef N %=@@ww       w/ P  ,5   &  6@ ,w l d   J 7PJ wVw B :4 7 ,w<w (D 0*l/R0 R0 05 %" 5x@ #w %̥\" %%#J % % % 0% % %  w D=& 2  w w r j   J 7V _.J x% % % %  %#77 7 7| 7 r7 p_ & z% % % % U:K % % N & z% % % % E( & z% % % % U & z%  v7 ̋# ̥#7̋7  & 2   w Ћ Ћ   Ћ Ћ  Jҋ~ @@w j hN , HNef ?@E% 8( n2 *L-(   e p Ne Ju-u- J w  J w D 4 4  w w  f  %  P d4 4 wr w ^ D 4-&4-!4 4   &e & %4    w me   s lt  &wB w  & f lew w yw &  4  b '     ` TW ~  s`K6!  w  D85U5_45P_4  m@e4 ,5Ne &   uN d4USt%. 5: J5F J5& & % 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff %ށ̥a &  `e 3     U̥r 33w D5"E@e44fef N % JU4 4  fef N %5 wt    6v&   6@Cwzwtw D J & & `e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _05uNfe & % _0bNe &   uN d)U5| m- 5 & %St%: f , U   & % S U _ @_w DE%%"5   & % U wv w ^D55@ J   3  4 4 4 4 4 ww~w  $. 5+  &5e-e % & d     ww  5f  7& f  7^wX@ m7. % e w        e-ww D . 5 e % wx  5 e-^w  &ww  N ww rDCDpC d  wZw FN wJ ~5 & E        ~5>wlYwfw Net@f ^e  w6w.w  f U7X U7N L DAe vB07 2  (%" 55 a  a!PE -%  w$ d `e vWt vw@ `e @  d%e U?zz `e 7h U?\ a7N FH?@<U ew dDE wZw FD5  5N d!w5A vBB-  }ee@ !ۃ `!ւ ` `xm& E%m%w w7*'$!     & 7& A & BF7!W-$7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu& Bw* J@B |_"@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w???/dev//etc/utmpCannot open /etc/utmp Broadcast Message from %s@%s (%.*s) at %d:%02d ... rMessage too long sleeperTry again SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecX\mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %dHPZt$6BXdp&>Kap| *;Z{3Rby %Fh} 0Fhz 3 RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator , h   TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/etc/ttysrronoffsecurewindow=/dev/ F!d,!o8!x!f"e g!c!s!l!LN!uR!D0!O M%f B%5N nI_@5 5 5 5 _lA @mAm@ 5 u @@5umN& xF%5     6   JuDm }- N@&f M%@- 5 @eu u-u-  N@&f M%@- fff e  6f %N nI  5 Nef 0  6f %  6f __w *96Nef K H 63  w 9f f A @mAm@ f& L0ef& l0euu}-@  MN KA1@ C }@w j8 z _,_n j* 7_a jE%N fffl jEe` H (N fff8 jEew7w 7d8 jE  Jw7w 7y8 jE  Jw7w(7|w"7w7w 7w- @m7ȥ- > - 7%:f / (v n h 8f 6 8 6 88  8  ?w6 ̥:7 *+  w- 8f 6 8 @m7  9 E5 @@l w.w 66DC E5<E@e33. @;E  5 , @;% & fE &G 5  HU3 3  w5w t5 ^ f Fe  f F N& F \ 6w"5w 5  2 7 ~Fw]$w4w 4 lf I7 ^7 w4w 4 L  2 78 r. *1%5#f   wX f  5=  f  N n( \*7 7j7&   ̥̋ ̥ %&    bw3w 3D CKw3 ˋ 5 w3w z3R 5N 45N r)wT3}& N%5u?8 jE GNf .-%@5fe@& D%u fef (-e _N nI%0 Ne 5% 8 4-ff %%= %N + @ <ff %E8 jE%w\ 4-A1`@fe@& D%ff %]8 jE%N Rkf M%5 N G ff M%N G f f M%N G f f M%fef xF%%_,N 4- N nIN nI_Ne 5 f d* Nlfe .%Ne G &fe v) &fef 60e%o 4-Nfe 6K  C r vf&A r t@aUU C r vf&A r t@aUU7 n & & fe *e%  C r vf&A r t@a&50 8 jE  fefef V*e5N nI  4-5 _B}N \*5%%%_8 jE _4fef xF%%_4fe M% _4ff %@_(w .5 5   -%5+N \*5fef #% %0 %N nI @N nIwp.w \.|DCe%@5̥.e ̋   2 5 Nff fef ^!e N I QN I%G L A5 N x#5|8fe| G fe| F fe| 2 5Ne~@ & K  @|p-5N Iw"-w -BN@fe *1% YDe̥ ̥ ̋e  ̥ ̥ ̥  ̥ ̥ 5̥ ̥ ̥ ̋ 5 N fef 6"% NNf F wP,w 6,% Nf F_#WNff R/% KNf F@@mȋ= : +A P* %h)7. / 7N HD e ̋@@m  F wr+hw*w X+   L  wJ+ 5 ff L% 50  8 w *  uN G5&f %5w* 5  f F  0   w p* p  @e5ff l%5wD* 5  w-   4 w ) JD ~F : &  t6%7$pw)0b FV<5Of 2 7 w ~) $w)w p) t  wr)ww R)  77   I7 w8)w $)ww*)w )  l f@ E w)L 15% %4 *1%   /Q , 7T& , 7W& ,  n(7Z& ,  n(7]& , 7`& ,  (7wc& ,  (7wf& , 7pi& , 7bl& , 7T_z%w '( h) w'  d7 ^ d< <55 ff je55 h) D& D%e& D%e& D%erlf`& D%e7Lw &  _j(ob F_'R_'{5 & f rF%5= (5u fff Fe5 #u 1f xF%50 :=pN nIw&w %D      + - ̥9 Wp @@`e̥0  w%w %D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  w"%A@w$w $De LN G4ee-   G4e Be v Nfe $1%wx$w d$DeEE&E&E& .e w0$Ww#cw#jw#w $D  !7 -  s 3  33 a r w w#+& f Fe]w"w l#Nf + wj#~w"w P#4De _, t4 t t4 4t Ne&& 0% _,t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 , 55 Nefe 0% & V%5u7  && 0%  fe 0%ff "% fe& 0%w!A@E f& w !w!w !D Lԋw!w !DC R w!5 7>@  55@- 7 5!bw \w w 8!De LN G4ee6 -  G4e! Be v Nfe $1%w w -@ 6w N#4 .%4aw e& ;eww ^ u@t5H5J@ 5Nefef 0% (3A@u5BtrJ2H@ Aup fef 0% u-u-u-@ww  BuNefef N%=@@wvЋ Ћ   Ћ Ћ  Jҋ~ @@w D nI4 4  Mww  f rF %  nIP K4 4 ww D 4-&4-!4 4   &e & xF%4    wDme   s lt  &wr<Swhmow`n0lwJ e& 7 L7Dgww2"B$I I7Iw j & f 1ewbwyw&  4  b '     ` TW ~  s`K6!  w D85U5_25P_2 . m$@e4 ,5Ne & K  uN K4USt% 5, H58 H5& & xF% 45@e-4  % U5EU  wE w pD h +   r= wB wR5 a U5ff rF%ށ̥a &  Fe 3     U̥r 33w   uff Xe55 Dfe& D%e  & D%e& D%e<@A@ 7rn5%  <R& D%mDm@   ww D@et5r%=r D R t6 7; P   wHe =r r̋=rNet F Net Fe  @et5Net G5&f 4%  77  ܰw DC . p t6 7% P . 2!f TD%    r܀w<u5&f % Rt 77 l w 4$ K  w5 4@E%@EU5N&e G &e F Nf&e rF%4 IN&e G &e F Nf&e rF%  (Ne& K  ff eee@ 4t@t"4 4t nI M_6w N nI@ nIN Mww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  > ve@ 4tw"w D55ff %f&& "eff&e e &e @ 55 ww~Pw5 5 w D5#5ff T %f&& eff&e *ew6&e B'44  && ef&& Fe&e & M%%U w D5_:o5ff %f&& eff&e Ze L&e B8f f ff&e V e 744  && ef&& Fe&e & M%%UUw @@m e%fe 6K  &e @ 55 3ff `%f&e@ &50c &e @ 55 38 jE U44  && ef&& Fe&e & M%%&_:fffffe e _:&e % _:_:e_:  mm@ e@ f& ef&& Fefe& M%%_: ?_9w @0 0 @0 N <77Tww D85_=Ne& Kq fe Ve4-4-/44  &&  ef&& Fe&e & xF%%&e 6K &e @ 55 ewwXw4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  > ve@ 4t4-4-/44  && ef&& Fe&e & xF%%&e 6K ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& Fe&e$& xF%%&e$ 6K `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& Fe&e$& xF%%&e$ 6K `Btp$t t"  ff Nef&& Fe&e$& M%%Uw w r D5#5 5 wBw>\wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& TD% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm D% a@ `` e w D a@@m e  w e  aAm HN@`@m &f D%  aN f`f D%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef N% HU4 4  fef N%5 w    6v&  @ppC`p   6@Cwzwtw D H & & Fe 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _H5uNfe & M% _HbNe & K  uN K)U5| m- 5 & M%St%,  K U   & M% S U _NG @_RGw DE%%"5   & M% U wv w ^D55@ H  nI 3 M 4 4 4 4 4 ww~w  $ 5+  &5e-e % &     J ww  5f J 7l f J 7wX@ mB7@ 6%e w       J e-ww D  5 e %w  5 e-w I Jww  N Mww rDCDpC K 6K wZw FN MwJ ~5 & E        ~5>wlYwfw Net@f Ke  w6w.w  zU7xU7zxAe vBv7 x  n%h 55 a  a!PE -0%x w$ M `e vWt vw@ `e @  M%e U? `e 7xU?ʔ a7 ʎ?U ew dDbE wZw FD5 M 5N K!w5A vBB-  }ee@ !ۃ `!ւ ` `mD& E%6ķm0ć%w w7*'$!      7& A& BF7!W-,V7lw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_zP@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w hb ~Fw]w|w h LF I7 >  77 7 wLw 8  k 2 7 l *1%5#mf BR  pf BR ZN rRf&|ƈnf ̥ ̥ 7N47Hs& BR  ̥̋ ̥ %Zv& BR   *wLw 8w w>w *D CKw ˋ 5 w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff .e A f&A@vee@ 5u 5 @ W-@D Ae Bḁ.@e@- @D@pHe _R̋@pHeA Be vC ̂ xzuuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw DCB P  5 , :% & E& &G z   5 , @ :% & f E &G  (˥-%0     ,:% &  &G 8 5E& z   5 , @ :% & f E &G  wT@(#) Copyright (c) 1983 The Regents of the University of California. All rights reserved. @(#)rcp.c 5.20 (Berkeley) 5/23/890 : : shelltcprcp: shell/tcp: unknown service rcp: unknown user %d. dfkprtxrcp%s%s%s -r -p -d../usr/ucb/rsh%s %s -l %s -n %s %s '%s%s%s:%s'/usr/ucb/rsh@%s %s -n %s %s '%s%s%s:%s'/usr/ucb/rsh@%s -t %s/bin/cp%s%s%s %s %s/bin/cp -r -p.%s -f %srcp: %s: %s. rcp: invalid user name %s /bin/shsh-crcp: %s: %s rcp: %s: not a plain file T%ld 0 %ld 0 C%04o %ld %s rcp: %s: %s rcp: %s: %s T%ld 0 %ld 0 D%04o %d %s ...%s/%s: name too long. %s/%sE rcp: lost connection rcp: ambiguous target unexpected lost connectionmtime.sec not delimitedmtime.usec not delimitedatime.sec not delimitedatime.usec not delimited%s expected control recordbad modemode not delimitedsize not delimitedout of memory %s%s%s/rcp: can't set times on %s: %s rcp: %s: %s rcp: %s dropped connectionrcp: can't truncate %s: %s rcp: can't set times on %s: %s rcp: %s: %s rcp: protocol screwup: %s rcp: fstat: %s rcp: malloc: out of memory w%crcp: out of memory. usage: rcp [-p] f1 f2; or: rcp [-rp] f1 ... fn directory : illegal option -- : option requires an argument -- /etc/servicesrr# ,/ socket: All ports in use rcmd: socketconnect to address %s: Trying %s... %dwrite: setting up stderrselect: setting up stderrselect: protocol failure in circuit setup. acceptsocket: protocol failure in circuit setup. /etc/hosts.equivr/.rhostsr$/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwdError 0Unknown hostHost name lookup failureUnknown server errorNo address associated with name: Unknown error %d.%d.%d.%d: Unknown error: %d0:Tfx  % 5 D U i }   # 4 J d  & @ b 1 R k  $ F Y f z  4JdwRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired `\\OdOoOxVPfdPeVOg0Pc %@5 u @`3~ %  AWp0`A@mA@x3 %0 WpDtWt@`Wt@`Wt@` @`@`Wt@`utE4tE4 E4E4 % >A@xh` %  ~> %  %_ Ĝ>2`3>(` %  @`H= %@w,w ,  4 %B   tE4 % B%@  4 %B B 0%Z%9.  t5Wp`AuWp`efWp`^&Wp`q& % %   ~ %   Wp`ABP %e.%9e%Ze2 % 42 0wT+ w*w 0+DC+ 5 0 a  r5 w: w+ U5ff -%̥a &  -e 3     U̥r 33w B* H@p w<*,p !mNAtmf& !ee90@ f&tm -tm7  : Wp !w )e  vWpmvfn % #  z, wN)7 D7 B7 @-%@,(% %?@e7tm7N :  vWpmf w r( D && ( eC && eBDe5 :20$ vWpmf   6 x 7 7e7 tm7m 7rWtmwtm7@w' z, w t' vmNAff& ee90@ EFr 5u00$r`J `vE5ue-e e-A@w&w & v  r  L  w& \ 5 ff L% 50T   8 Dw Z&  uN &.5&f %5Dw.& 5  f -  0   w % p  @e5ff l%5Dw% V5 0,l`M/1357R0R0ࣚ0  w-J R  4 w Z%  -  &  %7w.%( -45Gf  7 w $ w$w $ t  w$ww $ tn 7 f  b\ 07 Tw$w $ww$w |$  6 0@ E wh$ L5% %` %  ` I`  7L&  7O&   7R&   7U&  7X&   v7fwd[&   v7TwR^&  7:a&  7,d&  7_$w :#  w4#  7  t# #55 ff e55  D`|vH& +%eJ& +%eL& +%e<60*X& +%e7w ."  _g -_~_s5 & f -%5= v5u fff -e5 #u 1`f -%50`` :=`:N ~0wx!w d!D      + - ̥9 Wp @@`e̥0  w!w !D5 5      + -! ̥9 f& ff Teee@ ee@ 5u̥0 A@  w A@www Z  H%& x 5 f 4   5Net@@ & 2euENe t@ & 2eN z,% /A@ E %Ԑ N L% %  z,  /uNe t@ & 2eN  %N 0ww D  7 -  s 3  33 a r w w+& f -ew tfef 5%5 w` w HD 3 4EtU4 4 w`wwzw D Lԋww DC  w5 7@  55@- 7 5!w xDe LN &.4ee   &.4e Be v Nfe %ww -@ wN %e& ;ew,w u@t55@ 52Nefef >% (3A@u5Btr2@ Aup2 fef >% u-u-u-@ww  fe @w @pHA@tw,w  BuNefef 5%=@@wzЋ Ћ < wRlw e& 7 7gw BI I76Iw  & f eww>yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_5P_  m@e4 ,5Ne & 2  uN 24USt%5 /5 /5& & -% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff -%ށ̥a &  -e 3     U̥r 33w 4$ 2 4 w5 4@E%@EU5N&e . v&e - Nf&e -%4 IN&e . {&e - Nf&e -%  (Ne& 2  ff eee@ 4t@t"4 4t ~0 4_w N ~0@ ~0N 4ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  % ve@ 4tw"w D55ff %f&& "eff&e e &e ( 55 wwtw5 5 w D5#5ff T %f&& eff&e *ew6&e )'44  && ef&& -e&e & 4%%U w D5_!o5ff %f&& eff&e Ze L&e )8f f ff&e V e 744  && ef&& -e&e & 4%%UUw @@m e%fe F2  &e ( 55 3ff `%f&e@ &50c &e ( 55 3 z, U44  && ef&& -e&e & 4%%&_!fffffe e _!&e % _!_!e_!  mm@ e@ f& ef&& -efe& 4%%_! &_ w @0 0 @0 N #77xww D85_$Ne& 2q fe Ve4-4-/44  &&  ef&& -e&e & -%%&e F2 &e ( 55 eww|w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  % ve@ 4t4-4-/44  && ef&& -e&e & -%%&e F2 ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& -e&e$& -%%&e$ F2 `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& -e&e$& -%%&e$ F2 `Btp$t t"  ff Nef&& -e&e$& 4%%Uw w r D5#5 5 wVwRwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& d+% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5lV@Et5lv5lxu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm +% a@ `` e w D a@@m e  w e  aAm HN@`@m &f +%  aN f`f +%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef 5% /U4 4  fef 5%5 w    6v&  @ppC`p   6@Cwzwtw D / & & -e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _/5uNfe & 4% _/bNe & 2  uN 2)U5| m- 5 & 4%St% ` 2 U   & 4% S U _^. @_b.w DE%%"5   & 4% U wv w ^D55@ /  ~0 3 4 4 4 4 4 4 ww~w  $5+ . &5e-e % &     2 ww  5f 2 7 f 2 7XwX@ mV7TJ%e w  4 &    2 e- ww D 5 e %w  5 e-w 0 1ww  N 5ww rDCDpC 2 F2 wZw FN 4wJ ~5 & E        ~5>wlYwfw Net@f 2e  w6w.w  U7U7Ae vB7   %| 55 a  a!PE -D% w$ 4 `e vWt vw@ `e @  4%e U? `e 7U? a7 ?U ew dDvE wZw FD5 4 5N 2!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%޷mއ%w w7*'$!       7& A& BF7!W-~97w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_7@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& 6. z   5 , @ :% & f E 6.  (˥-%0     ,:% &  6. 8 5E& z   5 , @ :% & f E 6.  w@(#) Copyright (c) 1988 The Regents of the University of California. All rights reserved. @(#)passwd.c 4.35 (Berkeley) 3/16/89tlpasswd: unknown user: uid %u passwd: unknown user %s. passwd: %s usage: passwd [user] /etc/ptmppasswd: password file busy -- try again later. passwd: %s: %swpasswd: can't write %s /etc/master.passwdrpasswd: can't read %s Changing password for %s. passwd: can't forkpasswd: mkpasswd failed; password unchanged. /etc/passwd/etc/passwd.dir.dir.pag.pag.orig/etc/passwdpasswd: line too long. %spasswd: corrupted entry. %spasswd: corrupted entry. %s:%s:%d:%d:%s:%ld:%ld:%s:%s:%s Old password:passwd: %s. New password:Password unchanged. Please enter a longer password. Please don't use an all-lower case password. Unusual capitalization, control characters or digits are suggested. Retype new password:Mismatch; try again, EOF to quit. /etc/mkpasswdmkpasswd-p:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     ^?192$f1]B; ߵoH@Itk屾\YeT.h=yC-kg*.i]sO5֏oQnakA6?"Ƙ¤*{׭ "'G initstate: not enough state (%d bytes) with which to do jack; ignored. setstate: state info has been munged; not changed. /etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd/dev/ttyr%s : Unknown error: %dV ^ h   2 D P f r ~  % 4 L Y o ~  8 I h * A ` p 3Tv*>Tv ,ARError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 6d6o6xf7ft7ef6g@7cL7sv6lv6L6u6D6O6X6U0-l bR0R00 N e7cce7 /   7%  `Fw I W %`%@-7 e  78 _ @  `Ffe ~B  h 7 rm @% `F _ 5 R5 8Z@& bB   e%%]@& bB ~@ A @`fe bB @ A @`  @% `F& & &%D n @ 5f  & bB( @   , H̋&fe e `F   , ̋&fe e H    `F( 2  @  `F 2   `F 7B   27*: bB z %:  %x& % & & &% X  <:   @  `F*.Nx  1 @  `Fw Fw ED ̢̋̋˥=ˋNf JB bwEw ED ̢̋̋˥=ˋwE w ~E  @m4@m4 %  :5  %w;85  %w9   Wp0`@pWp0`@p( % % 44 %0wDw D <@m3@ %@5 u &`3 %  AWp0`A@mA@x3 %0 WpDtWt@`Wt@`Wt@` @`@`Wt@`dutE4tE4 E4E4 % @dA@xN` %  @ %  %_R Ĝ@`3@` %  @`|H? %@w\Cw HC  4 %B   tE4 % B%@ h 4 %B B 2%Z%9.  t5Wp`AuWp`efWp`^(Wp`q( % %   . %   Wp`ABP %e.%9e%Ze4 % 44WPO2wB wzA  ;ewdAw AD :3! wAw A"5  @ @ap t- 5N m& bB)%N @% rNef  w6A@ @a0  m  w @  1 7 Aw@w @  D7 w@w @DC  ̋̋w@w @ f  1 7R EHB 4/%7:& . 7:& .  ^7L:& .  & . L %,& . ̋ Dw?w ?    L  w?  5 ff L% 50  8 w ~?  uN B5&f %5wR? 05  "f bB $ 0   w > p  @e5ff l%5w> 5  w-   4 w ~> jd A Z & < 1%7D(wR> bB5f 1 7 w > w>w = t  w=ww =  37    D7 w=w =ww=w =   @ E w=l /5% %T 4/%   J, j 7"& j 7& j  ^7& j  ^7& j 7& j  7w & j  7w& j 7& j 7& j 7t_j w ^<H X wX<  7 & 7 855 ff %e55 X D  & *@%e& *@%e& *@%e    & *@%e7l w R;  _Z bB_ _#5 & f A%5= 5u fff :Be5 #u 1f A%50 := N Dw:w :D      + - ̥9 Wp @@`e̥0  wB:w *:D5 5      + -!0-l bR0R00 ̥9 f& ff x1eee@ ee@ 5u̥0 A@  w9A@w9w 9  3 6 A  Wp,f&  :Be,. A%%, D Dv  } 6ҥ "6w9w 9 I@ 0%& 2 5 f   & 5Net@@ & 8GeuENe t@ & 8GeNK @% $DZA@ E %bԐ N /% % N @  $DuNe t@ & 8GeN & %N DZw7w 7D  47 - 2 s 3  33 a r w wl7+& f :Bew $7D 3 HEtU4 4 w6w 6Nf , w6PwF6`w@6w:6w 6Nf H w6~w6w 6D Lԋw6w |6DC   wp65 7 @  55@- 7 5!w 6 @e5ff %w 6w 5D5 Np# %EAEt =&_5] Ne 'Nfej )%CaejNe &Aej@ e`5  H  )%`5~  " )%` fӕ:ӕ Bej%_mo N V  )%` 5 Nfej .%`Aej@55 *@e`5^}^f@ej@A^1e^^@^fe` ./%  U %|Nfejj dI%@-`R ffejF e O58K 5h%D 4  A%5fej JB e>fej J,  NAej@f dI%N D jI & fh /%%% w@3w ,3D ww 57x%j<xj (%5N,  %74% ^ A 7$7 %' %%h %% DwX2w D2 D7w>2w *2D 7w$2bw1w 2N & w2w 1D el&&&&Wpef Wpef0x )exw1w 15 5  AaAE f&A@vUU5u %wn1w Z1D XwP1̥/ 55b B&f ) e %Nfe ~B pfe JB fe JB ԥ.̋De &  & A %fe0 A% D %,@e05e DwNe$ DwNe( Dw%r_ _% _%2_WpfWpeme, _@e\5 N Df&te -d @ E3`# -H *te$5.N Df&@.e@.A Ep@.A Ep - s"% -3"% `#_ - t-$_ -"%77te$5  e"%7 -b _@e"%7w . Nefe 'w.7 AWp@7R L 7 N  f L( "% ~B "%7P7J w 4.7 7  7  7  r"% ~B "%77w.w .h v 2̋      2  w-w - $  @55 H w-Fw->  t $ -   t5, 5, - _#ue$&&fe Xe3 e"%pe"%3w -w ,& f ey}w,w , X%Q@f& $$e5uQ@f& R$e5uumumu _eeQu  %QQ eu % ff ~#et ff #e5u< ff F#et< ff #eL A@e@ f& ^#et e  =  r  rd > r 8 8 rd ( A, 5 8u 4  A, f&A@ 5u r  r   A, @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw6*!w)\w)w *De LN B4ee V  B4e Be v Nfe ./%w)w )-@ w)Np% )%p%ew(aw(w R)w@7% ?@w:)N f w )DC_L&̥%_2& 5 r yd _2& 9% 5afe &> *@%5@e5 5>N & _J& 5LN & _J& wn(  _J&" _J&4 _J&  \&% _J&0 \&% _J&0 r  r f \&% _J&0 \&% _J&  \&% _J&  r  r f \&% _!_J&0 \&% _!_J&B & _!_J&E _!_J&0 \&% _!_J&W _!_J&` & _!_J&0e r& \&% _!_J&0e  @ r& \&% _!_J&0 \&% _J&_!b _J&_! _! & _J&_! _! _! _2& _!% _!b_j!fe &L *@%5@e5_v! _2& _! _," _2& _! _H" _2& _" _b" _2&0 el rdf \&% _J&_! _" _2&0 \&% _J&_! _# _! _2&= & _J&_! _! _*# h_$ _! _! Y% _"?_" _X# G0 \&% H_! _# _! -K 2_! ! 0 el \&% _! _" _# _#N J _!?@ < ̋_ ,_!w #%A r e0@ A r 5   %% @  L %%  &w8#w $#D w(# ?w "u@t5%5%@ 5&Nefef h.% (3A@u5Btr%2%@ Aup& fef h.% u-u-u-@wV"w B" fe '@w4" @pHA@tw!w ! 2!,& J,   w! 1&R& (%7U˕,R&Nf L( w !D l !     +  wf!e% - r<N r<&@&R& )eR& ~ ~w BuNefef (J%=@@w w  , ,  , w / h,  ,5   & bB 6@ ,w . r 4( 1 7^X Aw w  HB D7 :ww D 5 %" 5x@ #w%̥\" %%#* % % % % % %  w XD=& J,  wN w 4 x 6( 1 7d _F,X& 4/% % % %  %#7r7p )7f )7\ )7 R7 P_,8& ,% % % % UK % % N;& ,% % % % E(?& ,% % % % UF& ,%  *7 )̋#h̥#7h̋7 ` & J,  'wЋ Ћ   Ћ Ћ  Jҋ~ @@w ,hN G HNef F?@E% 8N -2 -*L-N' ~B e' JB Ne' b.u-u- b-'w b- w D D4 4  Hwtw ` f A %  DP >G4 4 w4w D 4-&4-!4 4   &e & A%4    wme   s lt  &w|.lw e& 7 7gwBI I7Iw  BuNeff (J%=@@ww  fff (/eww>yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_05P_0  m@e4 ,5Ne & F  uN >G4USt%5> $D5: $D5& & A% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff A%ށ̥a &  :Be 3     U̥r 33w 4$ >G w5 4@E%@EU5N&e ~B t&e JB Nf&e A%4 IN&e ~B y&e JB Nf&e A%  (Ne& F  ff eee@ 4t@t"4 4t D H_2w N D@ DN Hww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  : ve@ 4tw"w D55ff %f&& "eff&e e &e t< 55 wlwh'w5 5 w D5#X5ff T %f&& eff&e *ew6&e X>'44  && ef&& :Be&e & dI%%U w D5_,6o5ff %f&& eff&e Ze L&e X>8f f ff&e V e 744  && ef&& :Be&e & dI%%UUw @@m e%fe F  &e t< 55 3ff `%f&e@ &50c &e t< 55 3~ @ U44  && ef&& :Be&e & dI%%&_6fffffe e _6&e % _\6_6e_\6  mm@ e@ f& ef&& :Befe& dI%%_6 ;_V5w @0 0 @0 N 877'ww D85_9Ne& Fq fe Ve4-4-/44  &&  ef&& :Be&e & A%%&e F &e t< 55 eww'w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  : ve@ 4t4-4-/44  && ef&& :Be&e & A%%&e F ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& :Be&e$& A%%&e$ F `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& :Be&e$& A%%&e$ F `Btp$t t"  ff Nef&& :Be&e$& dI%%Uw w r D5#5 5 w,w('wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& ?% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5lT@Et5lt5lvu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm *@% a@ `` e w D a@@m e  w e  aAm HN@`@m &f *@%  aN f`f *@%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef (J% $DU4 4  fef (J%5 w    6v&  @ppC`p   6@Cwzwtw D $D & & :Be 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _ D5uNfe & dI% _ DbNe & F  uN >G)U5| m- 5 & dI%St%  G U   & dI% S U _B @_Bw DE%%"5   & dI% U wv w ^D55@ $D  D 3 H 4 4 4 4 4 ww~w  $5+ &5e-e % &     tF ww  5f tF 7V f tF 7wX@ m,7* %e w       tF e-ww D 5 e %w  5 e-w D Fww  N jIww rDCDpC >G F wZw FN HwJ ~5 & E        ~5>wlYwfw Net@f 8Ge  w6w.w  'U7'U7~'|'tAe vB`7 b  X%R 55 a  a!PE -%' w$ >I `e vWt vw@ `e @  >I%e U? `e 7'U?ߔ a7~ vx?plU ew dDLE wZw FD5 H 5N >G!w5A vBB-  }ee@ !ۃ `!ւ ` `m@& E%2˷m,ˇ%w w7b*'$!      7& A& BF7!|W-M7hw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_K@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& B z   5 , @ :% & f E B  (˥-%0     ,:% &  B 8 5E& z   5 , @ :% & f E B  w@(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)su.c 5.4 (Berkeley) 1/13/86USER=HOME=SHELL=PATH=:/usr/ucb:/bin:/usr/binz:JOroot/bin/shsu-f-Who are you? Unknown login: %s You do not have permission to su %s Password:Sorry BAD SU %s on %s%s on %ssu: setgidsu: initgroups failed su: setuidTERMrootUSERSHELLHOME-fsuNo directory -susuNo shell :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     `initgroups: %s is in too many groups setgroups/etc/grouprr/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd/etc/utmp/dev/ttyr%s /usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecPTmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d@ H R l |  . : P \ h z   6 C Y h t  " 3 R s  + J Z q >`u(>`r+RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator~#T$^$|$$$%H%f%%%%&SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y,h  TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/etc/ttysrronoffsecurewindow=/dev/=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired ''' KdKoKxKfKeJgKcKsJlJL(Ku,KD KOKX>KU0.l qR0R00 @_ e7cce72 / ~%  7%  Sw V *#5  z5 A@, ~ 5; f 1%: $  & t % 2& # 7   D  L9@ȥr 6@ȥr%@-@& Nf Nf wUw Uf / %Nf / wUw UDCˋ!wU w U> 4 b%$ %)@-' b_ f_ pW qV@ D e %$ ; 70 & j#  < v Q & f e7 5 -`(  hwT $ t7 %@$ O e > 8@@ 5: $ 5  Zf %  : $Z N Z QN :% , r yz7  _  25f %( ; 7  $ wf % QN  5 _AWpd _F5 A_F7_F +_ f v%  N  5 _ . $yAWpd < q __  _ _ $5  $ $ $ $. $K $] $g ${ $ $_  _ _f _ 5 _ _ $ 5 _ _F _ _F _F   w .Q<5 & $3%5u$ LO%5f j# f # 7  v D Nef ZT dWpu,u,_ FWp@f& e "Wp@f& e> @ Ȑ35% @,@% @ EE&~E P p j@ EV :% XTWp@pp &   e& f de Wp@d& % - Q  $ff 1%wOw O u5w7 X 7 V ' v Wp @pp O  5`u`u N N N :% @  N 7 x N :%   = @ ȕ g 5&  @,@>%  @ E  E& > P  5&  @,@ % b @ EN J E&:  P >7 7  7w T GNe0.l qR0R00f& v%  *  -Z  '  b%Z ; 7 Z & % QZ $  QwFw FDe)T ! @ %f DN  $Net 9% Y Net 9  tJ  b%N !  N feN fefev 3e fev  5 Sff %N f   SwEw Ef DN @~ wEw E _$0 =5?:  5 _$ _$@7V ^@& M%@78 2 $ \   .%7F BZ& f = &f $e wDw D! N! Nf v NC $ wDN z5Nfe %Ne  fe LO%5f j# [f # 7   N HRNe]@@&f % f&fvfer h e df %V QNer w C% f t  B vf&& r%%EEf& h%% r l d `5^P -P ?B% f& 0f P ,: % w wBw B L9 SwBw BDC ̔CԔwBw BDC ˥ ˥ ˥ ˋ wB˥ ˥ ˥ ˋԔ w RB4Nef  N~f DN% w.B%@E%w Bf DN N ffff DNef DN wA ;ew.A{w&A wAw AD  5 & & Oe5u A@wVA5 5 5@ 5`u`u w~@w @DC E5<E@e33. @;E  5 , @;% & fE P 5  QU3 3  wJ@w 6@: v f Oe  f O N& O  6w?w ? N  ; 7:4 XOw]w?w ?  Q7 7 w?w ?  ; 7 rj :%5#f   wf  5=  f  N p" z#777&   ̥̋ ̥ %2&     w>w v>D CKwl> ˋ 5 (w=w <>DE5_% _ _5`uu '& & Oe5u%%w= @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & Oe5u %%    :%%%_5 Q5 5 E4N ff & Oe W _%_%__w (Ed pE55 ffD B e55* j# DV>& M%e@& M%eB& M%eN& M%e7w 5  _l"C4 O_!$_!O5 & f LO%5=F "5u fff Oe5 #u 1Vf RO%50VV :=VN HRw4w 4D      + - ̥9 Wp @@`e̥0  w4w x4D5 5      + -! ̥9 f& ff +eee@ ee@ 5u̥0 A@  w3A@w\3WwR3w 3  3 b LO  Wp,f&  Oe, RO%%, HR HR ҥ "w^3w J3D d R07Z -P *. s 3  33 a r w w3+& f Oew 2Zfef W%5 w2 w2&& e& & r%ReR$H @  1  \ "@! @#E B Ew 1n V%w1w 1Nf x% w1~wN1pwH1w 1DCB ԋ  @w1w 1D Lԋw1w x1DC  wl15 7@  55@- 7 5!w 1N x* D&w1w 1D el&&&&Wpef Wpef 3ew0w 05 5  AaAE f&A@vUU5u %w|0w h0D &w^0̥/ 550 O&f ( e %Nfe O >fe O fe O ԥ.̋De & . & LO %fe0 RO% HR %,@e05e &wNe$ &wNe( &w%r_& _&% _&%2_&WpfWpeme, _&@e\5 N &f&te -P @ E3# -4 *te%5.N &f&@.e@.A Ep@.A Ep - s`% -3`% #_& - t-%_& -`%7t7nte%5  e`%7Jۃ -N _&@e`%7*w - Nefe 0w-7 AWp@7> 87 : f X1 `% O `%77 w B-7 7 7 7 @`% O `%77w$-w -TD 2̋  &  &  2  w,w ,  @55 4 w-2w-*  t % -   t5, 5, - ܝ#ue%&&fe Xe3 e`%pe`%3w,w ,& f eGhKw+w + %Q@f& 2#e5uQ@f& `#e5uumumu _+eeQu  %QQ eu % ff "et ff "e5u< ff T"et< ff "eL A@e@ f& l"et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 OttwD)!w(w *)De LN O4ePe .  O4eS Be v Nfe 9%w(w (-b@ hw(NU% 3%%aw'w l( wj(&  X %5u  - x ff . %5 EU@ff % f   /e V / 5 / 5 fe& 9%ff %N / N / %xe& ;ew&w N'u@t5%5%@ 5B&Nefef Z9% (3A@u5Btr%2%@ AupB& fef Z9% u-u-u-@w&w & fe 0@w& @pHA@tw%w P&f 2!,& .7   w6& 1&& 1%7y˕,&Nf X1 w %D   !     +  w%e% - r<N r<&@& & 3e& ~ ~w :% Nef &2 w4%w %D 5  =& v7% `5ȥ=  = @w$e  w $ Nef 2@w$w $ f 2@w$ w n$D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef F9,5@ 'Ne F9 %ʕ/  f LO% %% w#Nef F9ҕaʋʥz ʕaw ^# BuNefef W%=@@w2#w #  7 7  7 w#/ L7  ,5   & O 6@ ,w " B   ; 7.( XOw"w "  Q7 wz"w f"D 5 %" 5x@ #wH"%̥\" %%#v % % % \% % %  w !D=& .7  w! w ! H   ; 74 _*7(& :% % % %  %#77 47 47 47 7 _6 & v7% % % % UfK % % N & v7% % % % E ( & v7% % % % U & v7%  r57 4̋#̥#7̋7  & .7  'w, Ћ Ћ   Ћ Ћ  Jҋ~ @@w hN fT HNef ZT?@E% 8 j82 8*L-' O e' O Ne' F9u-u- F8'w F8 w D HR4 4  Uww  f LO %  HRP T4 4 ww D 4-&4-!4 4   &e & RO%4    wRme   s lt  &w wzmnn9lwb e& 7 7gw4@B6I I7Iw  & f 9eww l fff 9ewbwyw&  4  b '     ` TW ~  s`K6!  w D85U5_;5P_;  mx@e4 ,5Ne & ZT  uN T4USt%N5&Z Q5"f Q5& & RO% 45@e-4  % U5EU  wE w pD h +   r= wB wR5 a U5ff LO%ށ̥a &  Oe 3     U̥r 33w   uff, Xe55 D'fe& M%e(  ('& M%e'& M%e)@A@ 7rn5%  )R& M%mDm@  'ww D@et5r%=r *D  N? 7;` Y  P wHe =r r̋ =rNet O Net Oe  @et5Net O5&f 4% p z@7 h ܰw DC H.  N? 76%~ Y . 2!f .M%  N  <܀w<u5&f %  z@7 w 4$ T w5 4@E%@EU5N&e O ,&e O Nf&e LO%4 IN&e O 1&e O Nf&e LO%  (Ne& ZT  ff eee@ 4t@t"4 4t HR U_h?w N HR@ HRN Uww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  lG ve@ 4tw"w D55ff %f&& "eff&e e &e I 55 ww~*)w5 5 w D5#t5ff T %f&& eff&e *ew6&e K'44  && ef&& Oe&e & V%%U w D5_Co5ff %f&& eff&e Ze L&e K8f f ff&e V e 744  && ef&& Oe&e & V%%UUw @@m e%fe T  &e I 55 3ff `%f&e@ &50c &e I 55 36f DN U44  && ef&& Oe&e & V%%&_xCfffffe e _xC&e % _C_xCe_C  mm@ e@ f& ef&& Oefe& V%%_xC vH_Bw @0 0 @0 N pE77.)ww D85_|FNe& ZTq fe Ve4-4-/44  &&  ef&& Oe&e & RO%%&e T &e I 55 eww2)w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  lG ve@ 4t4-4-/44  && ef&& Oe&e & RO%%&e T ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& Oe&e$& RO%%&e$ T `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& Oe&e$& RO%%&e$ T `Btp$t t"  ff Nef&& Oe&e$& V%%Uw w r D5#5 5 wBw>6)wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& .M% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l,5l.u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm M% a@ `` e w D a@@m e  w e  aAm HN@`@m &f M%  aN f`f M%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef W% QU4 4  fef W%5 w    6v&  @ppC`p   6@Cwzwtw D Q & & Oe 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _jQ5uNfe & V% _jQbNe & ZT  uN T)U5| m- 5 & V%St%Z L fT U   & V% S U _(P @_,Pw DE%%"5   & V% U wv w ^D55@ Q  HR 3 U 4 4 4 4 4 ww~w  $N5+ &5e-e %> &     S ww  5f S 7l f S 7DwX@ mB7@N6%>e w       S e-ww D N5 e %>w  5 e-w Q `Sww  N Vww rDCDpC T T wZw FN UwJ ~5 & E        ~5>wlYwfw Net@f Te  w6w.w  T)U7R)U7T)R)Ae vBv7 x  n%h 55 a  a!PE -0%R) w$ V `e vWt vw@ `e @  V%e U? `e 7R)U?Ӕ a7 ӎ?U ew dDbE wZw FD5 U 5N T!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7~*'$!       7& A& BF7!ԹW-_7w 8uDAB %u f& & e w5 5  W- W00~u5  .luFBw* J@B |_TY@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w  XOw]|w|w h  Q7  z@7 7 LwLw 8 n j ; 7Z lP^) :%5#f [  f [ N L[f&|ψnf ̥ ̥ 7N*7H& [  ̥̋ ̥ %4*& [   *wLw 8wtw>w *D CKw ˋ 5 w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff .e A f&A@vee@ 5u 5 @  W-@D  Ae B ḁ.@e@- @D @pHe _b[̋@pHeA Be vC ̂ xuuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw DCB P  5 , :% & E& P z   5 , @ :% & f E P  (˥-%0     ,:% &  P 8 5E& z   5 , @ :% & f E P  wT/tmp/maXXXXX/usr/spool/mail//usr/spool/mail/xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxdead.letter forwarded From ( @ ???r+wmail: %s: cannot open for writingrhdunknown option %crNo mail. ? usage q quit x exit without changing mail p print s[file] save (default mbox) w[file] same without header - print previous d delete + next (no delete) m user mail to user ! cmd execute cmd illegal HOME/mboxmboxamail: %s: cannot append invalid command ! r+wcan't rewrite %sNew mail has arrived. remote from %s Bad letter type %d to copylet.puke -s-sendmail/usr/lib/sendmail/usr/lib/sendmailFrom%s%s %swmail: cannot open %s Mail saved in %s null name mail: can't create proc for remote uux - %s!rmail \(%s\)uux - %s!rmail %swUsage: mail [ -f ] people . . . localhostbiffudpmail: can't send to %s amail: %s: cannot append %s@%ld mail: %s has more than one link or is a symbolic link mail: /etc/servicesrr# ,/ /bin/shsh-c/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd/etc/utmplongjmp botch longjmp botch SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec"mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d :Jbl*6HWgv'6BUf| A X r  ( ? c . C V x . @ R f | RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator/@//bin/shsh-cm q y } , h   TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d./etc/ttysrronoffsecurewindow=/dev/ ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired :)6*6*XdfXorXx0Yf>Ye0Xg YcYs@Xl@XLXuXDjXOvXXXU*/etc/hostsr# \\]4]0/l]x000 @apd e7cce7 / %  7%  Yw \p  z9   z9  z9  & & #% & &  efe  .fe `? 5 555J h pAP T  Y8 ? f-  rP T  Y .v `? N X% XJmff %%F@ 5` w5 5 Ne}t& bZe t & bZeN& X2%t@& bZe ut& bZet& bZe t& bZe W5N X % ?5fe <%@e5/f ~? 7 w  H)%5 5 Net& bZe 5 h hfe U N -BNe l 7 2rfe U b 75   D   H5   p- 5 _  _P T% _r X&ec \Vp& & #%* 5Nf   & & #%N Uf Y  U@4  %%  l  t & bZe TAeWpN #_ X&e    & ^& e %C < x(EP T  T      Y   R2  y ^25      fe r: |  Fl5,5,   T2D @A %W u! e .5 el@&@ & e  F5,5, @  T2@A %W u! e .5 el@&@ &d e,fe Y Ne 2:lfe f;% Z Pfe f;%@fe f;%Ne lN  ,gt& bZe d5&f ^%f X ~ "r   Z& eF0& UNet& bZe @e7`& r!%& r!% @  &t f;% t r!% r!%  r!%d h X&eP    X&e n  X&% 2  $fe @ ! X&e wROw >O  N 5w0OAw O fe& U%% Y  NDP T% T} wNw N #N YwNw N -5"! R U% AWp,f& & dUe,f& \% X  \ U% ,f& \% Xw6Nw "N De t4 tt 4 4 Ne&& ~A% wM  eu @w8Mw2Mw M  @m4@m4 %  R5  %wSP5  %wQ "  Wp0`@2p0/lYx000$Wp0`@Jp< % % 4b$ %0wLw L j@m3T %@5 u X`3 %  AWp0`A$@$m0A@x3 %0 WpDtWt@`Wt@`Wt@` @`@`Wt@`utE4tE4 E4E4 % TA@x` %  T %  %_N ĜTJ`3T@` %  @`HS %@wKw vK  4 %B   tE4 % B%@ d 4 %B B F%Z%9.  t5Wp`A$uWp`e$fWp`^<Wp`q< % %   * %   Wp`ABP %e.%9e%ZeH % 4Ho h g Fw - 7%:f `? ( Pf  P  P  P  ?wG ̥:7 n*+ztZ jw-d^ VPf  P: @m7, &$ 9 E5 @@l w?w "GDC E5<E@e33. @;E  5 , @;% & fE U 5  NWU3 3  wtFw `F & 'f U &&wLFw 4F"5  @ @ap t- 5N m& U)%NP T% rNef ": ^2wE@ @a0  m  w |E RD 0D 7 "UwfEw RE  W7 |wLEw 8EDC  ̋̋w&Ew E J TD 0D 76 E,V ^B%7:&  7:&   7`:&   &  ` %,&  ̋ XwvDwCw \D 0  , L  wND  5 ff L% 50  8 w C  uN U5&f %5wC 5  f U  0   w tC p  @e5ff l%5wHC 5  w-   4 w B  "U  &  E%7wBf Ur5f 0D 7j w B wBw tB t  wvBwXw VB .( DF7    W7 w& %  l7 w& %  l7w & % 7& % 7& % 7_w @  w@  7  K :K55 ff` n*e55F  D60& TS%e& TS%e& TS%e& TS%e7w ?  _  U_t_x5 & f U%5=b l5u fff dUe5 #u 1 f U%50   := N Xw?w ?D      + - ̥9 Wp @@`e̥0  w>w >D5 5      + -! ̥9 f& ff 5eee@ ee@ 5u̥0 A@  w&>A@w=Ww~=w =  5%& n 58 f *!  z9 5Net@@ & bZeuENe t@ & bZeNP T%P NWB A@ E %J Ԑ N B% % P T P NWuNe t@ & bZeN z9 %8N WB w@e  hZ5@ f TS%w@ m0 u ʋʥ=@me hZA mZ @ mL ʥ=ҕ=Ҕw h: Nef ; D m ewJ:w 6:Nf # w4:Pw9&& e& & l%ReR$ @  1  \ "@! @#E B Ew 9 \%w9`w8w8w j9Nf # wh9~w8pw8w H94De _0% t4 t t4 4t Ne&& ~A% _0%t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 J% 55 Nefe A% & %5u7 ` && ~A% P fe A%ff p% fe& ~A%w7A@E f& @w 7w7w 7DC``Hԋ w7``A@w 7DCB  @mAmHԋ  @mAmA@wH7w 47D Lԋw,7w 7DC @ w 75 7,@  55@- 7 5!w 6 @e5ff |&%w6w 6D5 N # X&%EAEt =:_D)5] Ne 2:N* fej <%CaejNe ./ Aej@ "3e`5  ز 9  <%`5  <  <%` zӕ:ӕ Bej%_(mo N 2A  <%` 5 Nfej A%`Aej@55 *@e`5^}^f@ej@A^1e^D ^@^fe` XB%  U H)%Nfej~ \%@-`R ffejZ 3e O5LK 5h%D 4 F U%5S fej tU e>fej `?  NAej@f \%N X \ & fh 4B%%%w3w 3D ww 57%~<V V f;%5b,  3%7H%  U 70,7 %' X2%%VT  d*%% X&w2w 2 X7 w2w 2D 7w2bw,2w 2N . *w2w 2D el&&&&Wpev f Wpe` f d 25 5  AaAE f&A@vUU5u %w 2w 1D  w1̥/ 55  U&f V* e %Nfe U  fe tU fe tU ԥ.̋De & R2 & U %fe0 U% X %,@e05e *wfNe$ *wXNe( *wJ%r@_0+ 8_0+% ,_0+%2_0+Wpf Wpeme, _0+@e\5 N *f&t  e - @ E3L& - *te'5.N *f&@.e@.A Ep@.A Ep -J s( -63( &L&_0+ - t- '_0+ -(7 7te'5  e(7܃ - _4+@e(7w 6/ Nefe r:w&/7 |AWp@7 7  f : ( U (7d7^ w .7 67 r7 p7 p ( U (727,w.w . ;̋  +  +  2  wp.w \.  @55 w-w-  t ' -~  t5, 5,  -T K&ue'&&fe Xe3 e(p e(3w-w -& f e  w~-w j- D(Q@f& $e5uQ@f& $e5uumumu _,0eeQu  %QQ eu % ff $et ff T$e5u< ff #et< ff $eL A@e@ f& #et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpe u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 # ttw*!w>*\w8*w *De LN U4e$ e& 2  U4e'  Be v Nfe XB%w@*w ,*-@ < w&*N) \( <%\(ewz)awt)w )wF@7<% ?0@&w)N f `3w )DC_8̥%_8 5 r y _8 9% 5afe & TS%5@e5 5N P9 _8 5N P9 _8 w ) `3_8 `3_8 `3_8  8% _80 8% _80 r  r f 8% _80 8% _8  8% _8  r  r f 8% _4_80 8% _4_8 P9 _4_8 `3_4_80 8% _4_8 `3_4_8 P9 _4_80e r& 8% _4_80e  @ r& 8% _4_80 8% _8_4 `3_8_4 _4 P9 _8_4 _3 _3 _8 _4% _4b_3fe & TS%5@e5_4 _8 _4 _4 _8 _>4 _4 _8 _\5 _4 _80 el rdf 8% _8_4 _r5 _80 8% _8_4 _5 _3 _8 P9 _8_4 _j4 _5 h_6 _4 _,4 Y% _H5_L5 _5 G0 8% H_4 _5 _P4 - `32_4 ! 0 el 8% _4 _*5 _Z6 _5 _4? ̋_t3_4w &$~(A r e0@ A r 5   %t( @  L %t(  P9w#w #D w#   ?w #u@t5~(5(@ 5(Nefef A% (3A@u5Btr(2~(@ Aup( fef A% u-u-u-@w"w " fe r:@w" @pHA@tw"w "V ;!,& `?   w~" 1&>) f;%7˕,>)Nf : w 6"D  !     +  w"e% - r<N r<&@&>) ) ~ ~w ! Nef ; w|!w h!D 5  =& ?% `5ȥ=  = @w!e  w BuNefef R]%=@@w w  ? ?  ? w / ~?  ,5   & U 6@ ,w B  0D 7 "Uw, w   W7 w w D 5 %" 5x@ #w%̥\" %%# % % % % % %  w lD=& `?  wb w H   0D 7 _\?r) ^B% % % %  %#7H7F =7< =72 =7 (7 &_(?& ?% % % % UK % % N& ?% % % % E(& ?% % % % Ux& ?%  =7Z =̋#>̥#7>̋7 6 & `?  r*wЋ Ћ   Ћ Ћ  Jҋ~ @@w @hN 0Z HNef $Z?@E% 8 @2 @*L-~* U e~* tU Ne~* xAu-u- x@~*w x@ w D X4 4  [ww t f U %  XP hZ4 4 wHw 4D 4-&4-!4 4   &e & U%4    wme   s lt  &wSwmow nAlw e& 7 j7bgwVBHI I7Iw  BuNeff R]%=@@ww  fff RBeww>yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_D5P_D  m@e4 ,5Ne & $Z  uN hZ4USt%85D NW5P NW5& & U% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff U%ށ̥a &  dUe 3     U̥r 33w 4$ hZ w5 4@E%@EU5N&e U &e tU Nf&e U%4 IN&e U &e tU Nf&e U%  (Ne& $Z  ff eee@ 4t@t"4 4t X [_2Ew N X@ XN [ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  6M ve@ 4tw"w D55ff %f&& "eff&e e &e O 55 w.w**w5 5 w D5#5ff T %f&& eff&e *ew6&e Q'44  && ef&& dUe&e & \%%U w D5_VILo5ff %f&& eff&e Ze L&e Q8f f ff&e V e 744  && ef&& dUe&e & \%%UUlw @@m e%fe Y  &e O 55 3ff `%f&e@ &50c &e O 55 3 P T U44  && ef&& dUe&e & \%%&_BIfffffe e _BI&e % _I_BIe_I  mm@ e@ f& ef&& dUefe& \%%_BI @N_Hw @0 0 @0 N :K7x7t*ww D85_FLNe& $Zq fe Ve4-4-/44  &&  ef&& dUe&e & U%%&e Y &e O 55 eww*w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  6M ve@ 4t4-4-/44  && ef&& dUe&e & U%%&e Y ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& dUe&e$& U%%&e$ Y `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& dUe&e$& U%%&e$ Y `Btp$t t"  ff Nef&& dUe&e$& \%%Uw w r D5#5 5 ww*wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& R% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm TS% a@ `` e w D a@@m e  w e  aAm HN@`@m &f TS%  aN f`f TS%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef R]% NWU4 4  fef R]%5 w    6v&  @ppC`p   6@Cwzwtw D NW & & dUe 4E05Ew7V Ћ P ы A@PЋ w FD:5UE5Hw* _4W5uNfe & \% _4WbNe & $Z  uN hZ)U5| m- 5 & \%St%D l 0Z U   & \% S U _U @_Uw DE%%"5   & \% U wv w ^D55@ NW  X 3 [ 4 4 4 4 4 ww~w  $85+ &5e-xle %( & V    Y ww  5f Y 7 f Y 7dwX@ m78%(e w       Y e-ww D 85 e %(wj  5 e-Pw W *Yww  N \ww rDCDpC hZ Y wZw FN [wJ ~5 & E        ~5>wlYwfw Net@f bZe  w6w.w  X*U7J*U7@*>*6Ae vB"7 $  % 55 a  a!PE -%* w$ h\ `e vWt vw@ `e @  h\%~e U?ll `e 7Z*U?Nϔ a7@ 8:?2.U ew dDE wZw FD5 [ 5N hZ!w5A vBB-  }ee@ !ۃ `!ւ ` `jm& E%m%w w7&*'$!     , 7"& A& BF7!W-a7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu0Bw* J@B |__@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& U z   5 , @ :% & f E U  (˥-%0     ,:% &  U 8 5E& z   5 , @ :% & f E U  w,48<@DHLPTX\`BJanFebMarAprMayJunJulAugSepOctNovDec/dev/ttyfh:plogin: -h for super-user only. usage: login [-fp] [username] %s??/dev/ttyloginxx%s login refused on this terminal. LOGIN %s REFUSED FROM %s ON TTY %sLOGIN %s REFUSED ON TTY %sPassword:Login incorrect Too many users logged on already. Try again later. You have too many processes running. quota (Q_SETUID)No directory %s! //Logging in with home = "/". .hushloginSorry -- your password has expired. Warning: your password expires on %s %d, %d Sorry -- your account has expired. Warning: your account expires on %s %d, %d tty/bin/sh/bin/cshHOMESHELLTERMUSERPATH/bin:/usr/ucb:/usr/bin:/usr/games:ttyDIALUP %s, %sROOT LOGIN ON %s FROM %sROOT LOGIN ON %s%s/%s/usr/spool/mailYou have %smail. new login: no shell: %s. login: login names may not start with '-'. Login timed out after %d seconds /etc/motd/etc/nologin/usr/adm/lastlogLast login: %.*s from %.*s on %.*s %d LOGIN FAILURE%s FROM %s, %sS%d LOGIN FAILURE%s ON %s, %sSsu%s too long /etc/utmp/usr/adm/wtmp:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     t/bin/shPATH:/bin:/usr/binsh: illegal option -- : option requires an argument -- initgroups: %s is in too many groups setgroups/etc/grouprrZ/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd/dev/ttyr%s longjmp botch longjmp botch   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d   6 @ Z l ~  + ; J [ o ):Pj,Fh7Xq*L_l&:Pj}RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator '.6@IPYajpvzx666 7(7p7777"8L8x88SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y]aimuy,}h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/etc/ttysrronoffsecurewindow=/dev/=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired ***J^d0^o<^x^f_e]g^c^s ^l ^LR^uV^D4^O@^Xh^U020l `$R0ԢR0Ԣ0  e7cce7 /   7%  w w|wr ww -ddwR LmD̥(̥)  &  *  7w nDC&   jf&& Z 5u &  5 @  xP   5  w        w f f  N j5uN j5u@  x\A@@mAm@ 5u ff& ewA@@A ffff effff ffff w @ ( xff f f f Dw4Df f !f #f $w N jDN jC B  =ww D  ԋ & v%wjw V "  )   v%w<@aA`H @`ȋ @aȋ,w Nf  . 2 & v%    &  ww D  & e%1 f %zv& N%3~@wL w 4@ w8w $DCu 5 ”B-&̋" :)  ,D-2 ”%*%\˥{5B-ԕw@e5 757%^   $* * . [( \_5ԕԕ$  @-ԕe@-2 ԕ 5 5 @m %5”%^” % 1 %- ”%]  @taAEHj taEHj”%]5 &Nmx %e_\” _ (" )4 n_ {@%1_%9_1B- ԕ$_% +  ԕԝ _\@e@-* ԕ T _\ _5 ”5 %0 %9 AWp `eu ”%\%,% T%,@ , ”%\ԕӥ}-  T_\ EE@ _\. _\$  _w DC 7&  &  7wœ ԋ ˥& ԋw FDC # xr w.ԋ̋7HE5@t`AEAj@0e 0\ 0n b  T T  e_>  b  ԋ ԋ e b  E5@t`AEAj@0_" T P E5@t`AEAj@0 " ee 5\ n@5&f % _" Dm_ 5\ n@5DmN&f % & _8 D _" ԋԢ E5@t`AEAj@0e -@_" & _8 _" w DE7% NE7w w DCB 3  Ԥ w w z Nk % wl w X 6 h7 f7 dBee@e o w* e 5%,  77 m%@ 5 ->>C   5%,  77 e%@ e -h@5  HN C xh 40% e5%  %@ _  5@e ֆ_$ _$ _: @ v D@ v 5@7u@ 5J@ Db 5%   A p @ D @ _ xp  & &  _ 7V_ & %7>_ && & & & & & & &&&&& H &&& t & w D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@070l `$R0ԢR0Ԣ0  wZ A@w < fef %5 w( w  D Lԋw  ~ ~w  BuNefef %=@@ww D5"E@e44fef % U4 4  fef %5 w&    6v&  @ppC`p   6@C ы A@PЋ w FD:5UE5Hw* _f5uNfe & % _fbNe & V  uN )U5| m- 5 & %St%  b U   & % S U _$ @_(w DE%%"5   & % U wv w ^D55@   D 3  4 4 4 4 4 ww~w  $5+ P &5e-T2e % & 2     ww  5f  7 f  7wX@ m7%e w        e-~ww D j5 e %wF  5 e-,w  \ww  N ww rDCDpC   wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  4 U7& U7  Ae vB7   % 55 a  a!PE -%  w$  `e vWt vw@ `e @  %^Ze U?HH `e 76 U?* a7 ? U ew dDE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `Fm& E%m%w w7*'$!     Z 7P& A@& BF7!"W-D7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_P@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w     H~ `t( @j   ~ ( >  . 4 t t I   +    !"#$%&'()*,-./    & 00;(     ) $ 0 0 8v $0>FV^|&+-*/%:===<<=>>=!=matchsubstrlengthindex-*[0-9]*$[0-9]*$10[0-9]*$[0-9]*$non-numeric argument%D0000000%d%d0%dToo many '\('sRE error@(#)expr.y 4.4 (Berkeley) 5/21/84%s yacc stack overflowsyntax error%s 0 |dbonx,f:e,gcs<l<LuDfOrXU0>1l :R0ҢR0Ң0 6$ e7cce7 / "  7%  t.w 1  %@%4 T /&   &  7B :4  % *    t.  0 * t.'%  N  v*, 8 t.~% , T e%w0w 00 e  e> ֝ D %   ߲ 5 - ?% & ~ * w/w /D* VR ?NE FG@ 8 4, -,? % &  *  ݀5E - ?%  & ߼ * w0/5 w /    L  w.  5 ff L% 50  8  w .  uN *5&f %5 wz. t5  ff v* h 0   w ". p  @e5ff l%5 w- 5  w-   4 w -  *  &  %7wz-\ v*h5{f  7J w 0- w6-w "- t  w$-w8w -  .7    ,7 w,w ,w w,w ,   @ E w, 5% %, H%  , }, r 7f& r 7X& r  J7@& r  J7(& r 7& r  7w& r  7w& r 7& r 7& r 7_Vw + D  w+  7 j ` $ 55 ff@ e55& D D,  & >(%e & >(%e & >(%e$ & >(%e7w z*  _F v*__5 & f *%5=B 5u fff N*e5 #u 1, f *%50, ,  :=, N ,w)w )D      + - ̥9 Wp @@`e̥0  wj)w R)D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  w(A@w6(Ww,(w (DC AupB 4  & >(%b 5% 傎& >(%`@ @m A 6 &@w6(  w (fef <2%5 w( w 'D 3 0EtU4 4 w'w 'D Lԋw'w 'DC  w|'5 7@  55@- 7 5!w ('N  w&'w 'D el&&&&Wpef Wpef,` e` w&w &5 5  AaAE f&A@vUU5u %w&w x&D Twn&̥/ 55^ *&f  e %Nfe * lfe ^* fe ^* ԥ.̋De &  & * %fe0 *% , %,@e05e : wNe$ : wNe( : w%r_ _ % _ %2_ WpfWpeme, _ @e\5 N : f&t  e -V @ E3H -: *te5.N : f&@.e@.A Ep@.A Ep - s  -3  H_ - t-_ - 77te5  e 7 -T _ @e 7w # Nefe w#7 AWp@7D >7 @ f h   *  7V7P w R#7 7 7 7 n  *  7$7w4#w #Zr ̋    2  w"w "  @55 : w-8w-0  t  -  t5, 5,  - Gue&&fe Xe3 e pe 3w("w "& f0C1l  :R0ҢR0Ң0 euyw"w ! @Q@f& Be5uQ@f& pe5uumumu _eeQu  %QQ eu % ff et ff e5u< ff det< ff eL A@e@ f& |et e  =  r  rd > r 8 8 rd ( A( 5 8u 4  A( f&A@ 5u r  r   A( @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 }ttwT!ww : fe @w, @pHA@twzw  !,&    w 1&X %7?˕,XNf h w D ~ !     +  w^e% - r<N r<&@&-X eX ~ ~w  Nef 6 ww D 5  =& ,% `5ȥ=  = @wve  w V BuNefef <2%=@@w*Ћ Ћ   Ћ Ћ  Jҋ~ @@w hN / HNef /?@E% 8: 2 `*L-: * e ^* Ne u-u- w  w D ,4 4  0ww  f * %  ,P R/4 4 ww D 4-&4-!4 4   &e & *%4    wPme   s lt  &w~W f r @  W f r@  @ &  4  b '     ` TW ~  s`K6!  w 0D85U5_5P_ r mh@e4 ,5Ne & /  uN R/4USt%5 8,5 8,5& & *% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff *%ށ̥a &  N*e 3     U̥r 33w 4$ R/ w5 4@E%@EU5N&e * `&e ^* Nf&e *%4 IN&e * e&e ^* Nf&e *%  (Ne& /  ff eee@ 4t@t"4 4t , 0_w N ,@ ,N 0ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  " ve@ 4tw"w D55ff %f&& "eff&e e &e $ 55 wNwJw5 5 w D5#x5ff T %f&& eff&e *ew6&e l&'44  && ef&& N*e&e & x1%%U w D5_@o5ff %f&& eff&e Ze L&e l&8f f ff&e V e 744  && ef&& N*e&e & x1%%UUw @@m e%fe .  &e $ 55 3ff `%f&e@ &50c &e $ 55 3j ( U44  && ef&& N*e&e & x1%%&_,fffffe e _,&e % _p_,e_p  mm@ e@ f& ef&& N*efe& x1%%_, *#_jw @0 0 @0 N $ 77ww D85_0!Ne& /q fe Ve4-4-/44  &&  ef&& N*e&e & *%%&e . &e $ 55 ewww4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  " ve@ 4t4-4-/44  && ef&& N*e&e & *%%&e . ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& N*e&e$& *%%&e$ . `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& N*e&e$& *%%&e$ . `Btp$t t"  ff Nef&& N*e&e$& x1%%Uw w r D5#5 5 ww wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& '% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@@Et5l`5lbu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm >(% a@ `` e w D a@@m e  w e  aAm HN@`@m &f >(%  aN f`f >(%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef <2% 8,U4 4  fef <2%5 w    6v&  @ppC`p   6@Cwzwtw D 8, & & N*e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _,5uNfe & x1% _,bNe & /  uN R/)U5| m- 5 & x1%St%  / U   & x1% S U _* @_*w DE%%"5   & x1% U wv w ^D55@ 8,  , 3 0 4 4 4 4 4 ww~w  $5+ &5e-e %r & v    . ww  5f . 78 f . 7wX@ m7 %re w       . e-ww D 5 e %rw  5 e-pw , .ww  N ~1ww rDCDpC R/ . wZw FN 0wJ ~5 & E        ~5>wlYwfw Net@f L/e  w6w.w  xU7jU7`^VAe vBB7 D  :%4 55 a  a!PE -% w$ R1 `e vWt vw@ `e @  R1%e U? `e 7zU?n a7` XZ?RNU ew dD.E wZw FD5 0 5N R/!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E% ӷmӇ%w w7*'$!      7& Ar& BF7!TW-57@w 8uDAB %u f& & e w5 5  W- W00~u5  .luzBw* J@B |_4@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& * z   5 , @ :% & f E *  (˥-%0     ,:% &  * 8 5E& z   5 , @ :% & f E *  w/etc/utmp?tty??rwho: cannot open utmp%s!%-*.*s %-*.*s%.12s (%.*s)P/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwdSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecLPmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT,h  !% )TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/dev/=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 43d3o&3x3f3e2g3c3s2l2L<3u@3D3O*3XR3U0O2lT R0ТR0Т0 @~  e7cce7Z  /   7%  w ^%  fe  %  Ne@&  @      Ne& fe %! fe  5*^ " uu uu  ee@Bu NeJ  NeO  NeT  Y^ " @t ww N@f& ef&@f&[^ "e wJw 6Nef  w2w  r 5w/f \@Nevf& %@ 6    w v@ev5xt%t t@t @aAt AmpxNevj J  %ч rNfev J      w  DCB̥:̋ ҕ/Ҕˋ ̋ w 2 ;ewH  w8 w 4De _ t4 t t4 4t Ne&& % _t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5  55 Nefe % & %5u7  && %  fe %ff % fe& %wX A@E f& w . w4 w D Lԋw w  De LN 4ee"   4e Be v Nfe %w w ~ -@ wx N % w L u@t5 5 @ 5 Nefef % (3A@u5Btr 2 @ Aup  fef % u-u-u-@w tw w Nef  w w t D 5  =& z% `5ȥ=  = @w& e  w  BuNefef d%=@@wЋ Ћ  Jҋ~ @@Swmownlw e& 7 T7Lgww ,Nff ew wyww D5"E@e44fef d% ` U4 4  fef d%5 w    6v&Ћ w FD:5UE5Hw* _F 5uNfe & % _F bNe & 6   uN z )U5| m- 5 & %St%R h B U   & % S U _ @_ w DE%%"5   & % U wv w ^D55@ `   $ 3  4 4 4 4 4 ww~w  :$F5+ 4 &5e-e %6 &     ww  5f 7 f 7`wX@ m7Fx%6 e w  b T    e-8ww D $F5 e %6 w  5 e-w  < ww  N ww rDCDpC z  wZw FN wJ ~5 & E        ~5>wlYwfw Net@f t e  w6w.w  r U7p U7r p Ae vB7   % 55 a  a!PE -r%p  w$ z `e vWt vw@@ `e @  z%e U? `e 7p U? a7 ?U ew dDE wZw FD5  5N z !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7*'$!  0T2lU R0ТR0Т0   ( 7& A& BF7!W-$7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu> Bw* J@B |_0@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w@(#)time.c 4.5 (Berkeley) 7/1/83timeCommand terminated abnormally. realusersys %9ld.%01ld %s /bin/shPATH:/bin:/usr/binsh: Unknown error: %dHPZt$6BXdp&>Kap| *;Z{3Rby %Fh} 0Fhz3RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorX | | \dBoNx fe gcslLduhDFORXzU0Y3l dR0ȢR0Ȣ0  < e7cce7p  /  7%  0w j 5 %$N~t % 0eN t  N    0w wtw D Lԋww De LN `4eer j  `4e Be v Nfe %w`w L-@ wFN % w  BuNefef %=@@wywZw D5"E@e44fef % U4 4  fef %5 wn Ћ w FD:5UE5Hw* _5uNfe & 4 % _bNe &   uN )U5| m- 5 & 4 %St%h   U   & 4 % S U _ @_w DE%%"5   & 4 % U wv w ^D55@    3 R 4 4 4 4 4 ww~w  $\5+  &5e-e %L &     D ww  5f D 7n f D 7wX@ mD7B\8%L e w  "     D e-ww D \5 e %L w  5 e-w X ww  N : ww rDCDpC   wZw FN RwJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w   U7 U7  Ae vBx7 z  p%j 55 a  a!PE -2%  w$   `e vWt vw@ `e @   %e U? `e 7 U? a7 ?U ew dDdE wZw FD5 R 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m6& E%(m"%w w7R*'$!      7& A& BF7!rW- 7^w 8uDAB %u f& & e w5 5  W- W00~u5  .luT Bw* J@B |_ @  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& p z   5 , @ :% & f E p  (˥-%0     ,:% &  p 8 5E& z   5 , @ :% & f E p  w@(#) Copyright (c) 1983 Regents of the University of California. All rights reserved. @(#)rmdir.c 5.1 (Berkeley) 4/30/85usage: %s directory ... rmdir: : Unknown error: %d^fp (:LXnz-<Taw#@Qp2Ihx#;\~#2F\~4IRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enou0^3l  dR0ȢR0Ȣ0gh memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator d o x f e gz c s l L u D O X U0a4lq jprtvxR0ϢR0Ϣ0 U  e7cce7l / p/  7%  DIw ~L % N7 @ @m eue_@ r y  _ _w_   C N P$7 N C% eK BH $E (B $?   @ C% `) &        " C we  _ x t r  bK d   9 % 9  9 %$ 9  9 %  9   7N     7 _N V_ _ _ _4_ _ _4 _ _ _4 T_ _4 <S A 7V U C% }2 C _ _ _4 _ _ _  _4 _ _ _ _4 _N  w2Iw I C  wIw IKf FE'  J M C  zv `/ B7,3 B7  +   f D%  f D 7| C N 7 wTHw @H L         7fe. =ej GNe. l8X H%B & I ,(Ne >_D@ *eN <  C N 7Ne >e` `C FE@ȥ/@e5D̥/ ̋  N <  C N&Ne >5˕/ Nfe %Ne <  C Ne 7     e6 C%t7jn jwNFw :FZ w>Fw $F  Z:nNePV %%tNeS^ %%tNeVf %%t eYn %%e]z %%Ja %% x 5-d Ce    z CewDEw 0E1 ,VReu  fe ;e  fe  A@ wDw D5 *f 0"f j?   C N 7wD N F Nr   xf % fE _D  _n  @_J De@m / d3Ae@%d N C%7 7  >Ne bE  =% p NffeD =eN < N_J >5N C%N < _N C N_JN >5H E e FENe FENe& bE N B:5uN j>NeD&fe % >5fff F$eN j>N < _N >N tE%dN _N bE d ^ e@ W dN=_cf $%^_<32 > f}~ Ce& n 2e  =% p _N f D 5_< >N tE%dN C%N G_NN bE %V _ 5 <@ >D-< >;@>-. 5 <:N>e bE 1  =% p N>ef\ Ce@> @>5j> > <l 5> jw>  >@> @>~ pNf>e bE  f ` e@ f& 7e5u l fff 6e  =% p 5@vWt 7  w    TWt uBN "J5B@e5@@t @-B@@t NBff D%+* ' # r  5 u Bf p 5@ 5u N G@e@-N fK  C N 7   N C% _N N_w t>_v _2c $ % @ /A C%a 7^ p[b. $ %~ @ *"| Ce ,R Ce1PE 6 5P C% 7 $N 5%_x  / > 5_b~0f %  @ _j H0f4ld jprtvxR0ϢR0Ϣ0  0% u5ee@ f& 4e5u ffff" f3e % !N G   e _vVE * _v( ff 3ef& &%  ff t3eCfe   5 u  A@Nff HL%  C% 7  5u  r  5u _f 7N w.;w ;* t L H% 1  H% 2 H% . H% N %w:w :fe I fe p w:w ~:D  &0 H%%&&8 ee /ee= H%%w8:w $:D%w":  w :C@4e  5 - ?% & ߐE E w9w 9D/& > )  & 7˕/˕/2˥/.  & 7%& 6" 7˕/ w.9LF& 0% x *E& * ˕/ ˋ/w 8 9 Bw8w 8 9 (w8w 8 9 w8w 8D %EOV =%T^ =% Yf =%&&^n )e&&ez )ew8w 8˕ % ` %w7w 7 Hw7Nl H% LNp H% %y w 7 l f b @5  F @ < @% n@wL7w 87 @E%@&uf FEzf FE@@m.@@mo w6N tE5%%~f FEf FE%f FEw 6l DN Du5 $ ff <"eNefe %e-n-f w$6w 6 @N DIw 6w 5  D & e  w5w 5DC̋Ԥ ˋ˥/w5w 5 @aȥ  @aȋ&f e 5uwL5w 857 u- u- @w$5 A@ @A f& l,e@mAm @ ee@ 5,u.5  u u,u . f.f,8 <"e,fe0 $e  @a 0 e.u , %u-, u-.u,(u.* e*u (@a 0 %Nf@`e0& %u, u._ u(u* _A.@,_w 3  DI @aAap  @aAapw3 D-@a w p3  fe  ff C%wJ3w 63- At > %& % x& r  C   r-v  C%7`*7 $Rt @-@ t 5t m=A r7`@wn2w Z2DC  -Gt N HL%5t @- f %7 v-^t &Z HL%5t @- f %d`t ` $69t m&& C%e-* "t  HL%5t @- f %7  ƀw21w 1%^Nem@x Je7> :mV Je % C  7 R @(ef& Ee w0w |0 &t  HL%5 t @- f %wJ0w 60N C%  7 C N w 0w / dNff D% @w/5 NNff D%75`5`u-w /N 2 N% C% DI@wn/w Z/  I nE%  |v &ewt  "J7( . C% w.w .bC ԥ/ ̢5ԥ/ t $tf&b Jeԕ/̋DB ԥ/  t̔twN.w :. :5uuu u55uNef T@ N[ C%w 7w-w - N "J5  n x C 7 Z@w-w -w-w- w-)w-w -DC+ 5 lG a  r5 w: wR- U5ff D%̥a &  Ee 3     U̥r 33w ,x@e5@e57 B=Ne j? f bE wb,uuf bE eNefe j?pNef I u-$u- N j>_!*_!N >5N j>}-(N >5N j>Nef bE Nefe 0" u-u-N j>Nfe ! ( ! 5u-u-uuf bE eNe >5_ _l Nf bE @_x w *DC  ̋`%# w* w *(w*w*w *DE5_#% _D# _D#5`uu '& & Ee5u%%w* @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & Ee5u %%    @%%%_"5 G5 5 E4N ff & Ee W _"%_6#%_6#_"w z(D      + - ̥9 Wp @@`e̥0  w4(:w'w'w (DC AupB 4  & C%b @5% 傎& C%`@ @m A >&@w'  w 'fef N%5 Zwn' w V'Nef %%wN'w :'Neff %%w2'w 'D A555  ԋuNeffe %%w&w &DC 5 5 _8'%%_Z'5 %*e5  AWp `eu 0u%l5  %h%[ +e  _'Neffff 'e   * O  A@ EN @5% % % %Nf ? &    %_& A@ E%Nf ? @wL%N @5 w &%N%c%s%[Nf ff f& *ew$5 5 5 5 %e%f %o%xDe5 5 A @ EN @% % % %- Ԑ A @ EN @ _)%+_)  _)%a%f %A_)%F_) % A@vN @O% A@v@mAm@ vA@v5u0 %a%fW7 5`u`u C% S P Ԑ A @ E =%%.%e%E- *% ' $ ! Ԑ A @ EN @%+%-%0%9 A@  5u% N  ? =   @e! @e! _'@t@]   x, Ne ,A _'Ne ,A @H@pHw !DC = 5%c%0u5 %s    @%r,%c5 %[r,      @%%   ? =  D- %cw w D ̥^  ,,, % %]%-+ , $%-̥]4  , ̠ , ,, %]  w@ w , D*\5% %-%+ 5 55 55  B5eA5 %.55  B5eA5  %E%e$%+%-  Wp B`e  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& l.e5 55wr6 m 7"w :D B:5u@-A-/A@E5u@E55  ff& Ee4 4 5- 5- >5ww D 3 fKEtU4 4t w~w jD  G & & /% "J5 f& /%Uw:w &D Lԋw9ww N 4 /ww D el&&&&Wpep f WpeZ f  =eww 5 5  AaAE f&A@vUU5u %whw TD  wJ̥/ 55  tE&f  e %Nfe bE  fe .E fe .E ԥ.̋De & 7 & D %fe0 D% G %,@e05e .0w r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpe u4  AmA f&A@ 5u  AmA 5 u ܃@ 44  ttw0!ww De LN tE4e el :8  tE4e!  Be v Nfe @%ww -@ 6 wN#  =% w ^ w\&  %5u  - xff V%5 EU@ff 2% f n9e NL 9 5 9 5 fe& ~@%ff %N 9 N 9 % ߀e& ;eww @u@t5 5 @ 5"!Nefef @% (3A@u5Btr 2 @ Aup"! fef @% u-u-u-@ww & f EeB B`@ `w\w H fe :@w: @pHA@tww 4 ;!,& =   w 1&b! ;%7˕,b!Nf *; w D  !     +  wle% - r<N r<&@&b! =eb! ~ ~w  Nef ; ww D 5  =p& B>% `5ȥ= J = @we  w d Nef <@wXw > f <@w8 w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef j?,5@ 'Ne j? %ʕ/  f D% %% w`Nef j?ҕaʋʥzʕaw  BuNefef N%=@@wЋ Ћ   Ћ Ћ  Jҋ~ @@w `D G4 4  fKwPw < f D %  GP "J4 4 ww D 4-&4-!4 4   &e & D%4    w me   s lt  &w W f r @  W f r@  @ w  D% 5     |@w 4-  wD mn(@lw, e& 7 \7Tgw w B2B(4I I7Iw L  fff @ewB w yw w " D85U5_A5P_A  m@e4 ,5Ne & I  uN "J4USt%5b G5^ G5& & D% 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff D%ށ̥a &  Ee 3     U̥r 33  @A  v @A ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef N% GU4 4  fef N%5 w    6v&  @ppC`p   6@Cwzwtw D G & & Ee 4E05Ew78 Ћ P ы A@PЋ w FD:5UE5Hw* _F5uNfe & HL% _FbNe & I  uN "J)U5| m- 5 & HL%St% & I U   & HL% S U _E @_Ew DE%%"5   & HL% U wv w ^D55@ G  G 3 fK 4 4 4 4 4 ww~w  $5+ l &5e-Ne % &     XI ww  5f XI 7D f XI 7wX@ m7%e w       XI e-ww D 5 e %w  5 e-|w lG Hww  N NLww rDCDpC "J I wZw FN fKwJ ~5 & E        ~5>wlYwfw Net@f Je  w6w.w  !U7v!U7l!j!bAe vBN7 P  F%@ 55 a  a!PE -%! w$ "L `e vWt vw@ `e @  "L%e U? `e 7!U?z֔ a7l df?^ZU ew dD:E wZw FD5 fK 5N "J!w5A vBB-  }ee@ !ۃ `!ւ ` `mr& E%dȷm^ȇ%w w7*'$!      7& A& BF7!W-T7& & e Ӌ  &7d& e Rӕ-Lӕ0B~8ӕ.  ӕ0~ B~&7 & Le ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_O@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& E z   5 , @ :% & f E E  (˥-%0     ,:% &  E 8 5E& z   5 , @ :% & f E E  w&w Nefef 5& Re C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& @Seww  fff 5& @Seww  5 %O N  = !555Ne5& Te5 "55'0Ne5 B& Te57 Be0" 5% "55 5 B5@B e! a=%!7!w % "5 B5Ne& Te55e0% "7`Jʕ0%!ʕ1  %!˕0 ʥ9 6@~ @(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)tar.c 5.7 (Berkeley) 4/26/86/tmp/tarXXXXXX/dev/rmt8"Nfr2Ntr-w-s@x- r-w-sx-r-w-tx-tar: tapefile must be specified with 'f' option wtar: cannot create temporary file (%s) !!!!!/!/!/!/!/!/!/! 000 tar: blocksize must be specified with 'b' option tar: invalid blocksize "%s" tar: %c: unknown option tar: usage: tar -{txru}[cvfblmhopwBi] [tapefile] [blocksize] file1 file2... -tar: can only create standard output archives tar: sort +0 -1 +1nr %s -o %s; awk '$1 != prev {print; prev=$1}' %s >%sX; mv %sX %sr-Ctar: can't change directories to tar: can't change directories to tar: cannot change back?: tar: missing links to %s %o%o%o%lo%lo%otar: directory checksum error (%d != %d) %s %s tar: tar: %s: file name too long %6o%s/%s.tar: %s: directory read error tar: cannot change back?: ....tar: cannot change back?: tar: %s: file name too long tar: %s: symbolic link too long tar: can't read symbolic link a %s symbolic link to %s %11lo%6otar: tar: %s: file name too long %6oa %s link to %s a %s %ld blocks %6otar: Read error on tar: %s: file changed size tar: %s is not a file. Not dumped tar: %s: symbolic link failed: x %s symbolic link to %s tar: can't link %s to %s: %s linked to %s tar: can't create %s: x %s, %ld bytes, %ld tape blocks tar: %s: HELP - extract write error%s linked to %s symbolic link to %s %3d/%1d%7ld %-12.12s %-4.4s %6o %6o %6o %11lo %11lo %c %s: SCCSRCScoreerrsa.out%s %loreadtar: tape blocksize error tar: blocksize = %d writewritewritetar: tape backspace error: writetar: tape %s error: unexpected EOF tar: %s tar: blocksize %d too big, can't get memory tar: can't set time on %s: tar: out of memory, link and directory modtime info lost /getwd: can't stat /./getwd: can't stat .../getwd: can't open ..getwd: read error in ..getwd: read error in ..//*******************SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d   0 : T f x   % 5 D U i }   # 4 J d &@b 1Rk$FYfz 4JdwRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator88/bin/shsh-c;?GKSW,[_hcgkosw{ TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d. ((((( AAAAAABBBBBB ! " "NdNoNxOfOeNgOcOsNlNLOuODNONXOU=(\0~5l &'Z\^`bR0ƢR0Ƣ0 "V~ e7cce74 /   7%  w @Ce% &( x @ =fe $ >fe $ fe %Hfe % Nfe % VNefeUfe eDer&  0!  & fe $  Ne~& %Nefe  fe [ q& % fe  Nefe& Ve-fe&  @ȥ( 6ef fe& %Nfe&  fe&  e fe& T 5Nfe  fe % N 5$5 ( x%G @$ ww DC E5<E@e33. @;E  5 , @;% & fE F 5  U3 3  wLw 8D̥r̥w74  *5,+  7$@  V Ne 4  5 K xN N  w̥r<@- 2f . N N@- f . N N  f :e ̥r f L N f L N  mHw  @  m wN .& ~ %5u fe mj& %%%Pff D % m< %@Zw*J ww @D  H7| -r  s 3  33 a r w w+& f ew Nef ^%ww Neff ^%ww xD A555  ԋuNeffe ^%wBw .DC 5 5 _%%_5 %*e5  AWp `eu 0u%l5  %h%[ N e  _Neffff e   * O  A@ EN (5% % % %Nf  &    %_z A@ E%Nf  @wN (5 w N%c%s%[Nf ff f& N ewJ5 5 5 5 %e%f %o%xDe5 5 A @ EN (% % % %- Ԑ A @ EN ( _ %+_  _ %a%f %A_$ %F_$ % A@vN (O% A@v@mAm@ vA@v5u0 %a%fW7 5`u`u C% S P Ԑ A @ E =%%.%e%E- *% ' $ ! Ԑ A @ EN (%+%-%0%9 A@  5u% N   =   @e! @e! _R@t@]   xNe  A _RNe  A @H@pHw >DC = 5%c%0u5 %s    (%r%c5 %[r      (%%    =  D- %cwV w >D ̥^   % %]%-+  $%-̥]4   ̠   %]  w w D*\5% %-%+ 5 55 55  B5eA5 %.55  B5eA5  %E%e$%+%-  Wp B`e  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& e5 55w 6 m 7"b ы ~ w n D Lԋwf e& ;ew w 6 BuNefef %=@@w Ћ Ћ   Ћ Ћ  J05l &'Z\^`bR0ƢR0Ƣ0ҋ~ @@w D% 5     |@wX 4- mnBI I7Iw  fff ew wl &  4  b '     ` TW ~  s`K6!  w d D85U5_b5P_b  m@e4 ,5Ne &   uN 4USt%5F 5B( 5& & % 45@e-4  % U5EU  w6E w D5"E@e44fef % U4 4  fef %5 w w7T Ћ PPЋ w FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%   U   & % S U _n @_rw DE%%"5   & % U wv w ^D55@    3 ( 4 4 4 4 4 ww~w  $5+ &5e-e % &      ww  5f  7L f  7wX@ m"7 %e w        e-ww D 5 e %w  5 e-w . ww  N ww rDCDpC  V wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  zU7~xU7tzrxjAe vBV7 X  N%H 55 a  a!PE -%x w$  `e vWt vw@ `e @  %e U? `e 7xU? a7t ln?fbU ew dDBE wZw FD5 ( 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7@*'$!      7~& An& BF7!PW-"7<& & e Ӌ   &7& e ӕ-ӕ0B~ӕ.  ӕ0~ B~ &7 & Le ӕ-0 ӕ.| B~ӕen ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& F z   5 , @ :% & f E F  (˥-%0     ,:% &  F 8 5E& z   5 , @ :% & f E F  w&w Nefef 5& e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& !eww  fff 5& !eww  5 %O N  = 555Ne5& "e555'0Ne5 B& "e57 Be0" 5%55 5 B5@B e a=%7w %5 B5Ne& "e55e0%7`Jʕ0%ʕ1  %˕0 ʥ9 6@~ @(#)rmail.c 4.8 (Berkeley) 5/15/86Usage: rmail user ... /dev/nullFrom >From %s %sremote from somewhereremote from remote from %s!%s -ee -f%s -i/usr/lib/sendmail ''wpclose: status 0%o /bin/shsh-c4 4 >              "  ((((( AAAAAABBBBBB `doxlfzelgFcRs|l|LuDOXU=(\06l7 25<>@BDR0¢R0¢0 )b B1 e7cce7:3 /  7%  2"w l% .6   %B  @ @me72 5 &e@ȥ-_e@f R x%ew  %  &  w$ D2 @2<e@ 7e@ 7e@ȋ71 1 1N  N 7SB < jNyB <% 2"@ȥ+ e@ 7t1Nf  h1_w # ^1Z1T1  2"w#w # 90 w# w v# 1 11  <%wf#w R#4 70Ne0  @E700 w"#w # 07 P H-D>B6 0H&%H- B < P0N 0  r70(e7 0 7 /5  f  7  /_N 6_Nef  * Ne    @7Ne H 22`/7 v l wlp2 P/ R F/ /  :/n  h (/ 2 %l 2 .27 <. .= .*..ee .eefe. e @e.5,  .@, , , r. n.-- j Z 7Xw w D-e-$.)  - 123-(3 --0(3 -% - B < wR w > _-|-1_Z _Z---f @  ]| t ph -h%?\% 6 & J r  % % -<-<- Ѐ5 6 E5  - ?%  6 & 6  r ,% _Z 72 , ,`  p22b  %   -@ -2>t,  h % 7!r `,   N,H, m6, - h%  7!&  -<+wnw Z.%& V e Z ˕a%.l ˕ww B +5 23  A23@ E 23 J%(3 (3 + w %    e2E% E% %.l w P **7 *N  *!    5 * w7 %    w C p*8-\*\*+ @ < 4 05.  -  ?% 6 & 6 E r % _ >)_  [  U _t ) _ 7 7 ) )%  -))_ _ _ )U-Z 7v)-l)l)I P# JB -B ?4% , & ". H7 B *)&7 $)5 6    -$ ?% 6 & r (%( (-(( ր56  5 -?x%  j_ 6 & \6 E r wwFw D      + - ̥9 Wp @@`e̥0  wzw bDC AupB 4  & %b J5% 傎& %`@ @m A &@w  w D 3 T$EtU4 4 ww D Lԋww pN  ^ wnw ZD el&&&&Wpef WpefZb3 eb3ww 5 5  AaAE f&A@vUU5u %ww D w̥/ 55 b&f  e %Nfe P fe 8 fe 8 ԥ.̋De & 0 &  %fe0 "% %,@e05e w%Ne$ wx%Ne( wj%%r`%_ X%_ % L%_ %2_ 8%Wpf,%Wpem&%e, _ @e\5 N f&t33e -$ @ E3J9 -$ *te:5.N f&@.e@.A Ep@.A Ep -j$ s ; -V$3 ; F$J9_ -6$ t-*$:_ -$ ;77te:5  e ;7 -# _ @e ;7lw  Nefe w7 #AWp@7* 06l2 25<>@BDR0¢R0¢0*7 * f N  ; P  ;77 w 7 V#7 *7 *7 * ; P  ;77w|w h* ̋    2  w:w & * @55 " w-"w-"  t : -"  t5,3 5,3 -t" I9ue:&&fe Xe3 e ;p"e ;3wpw \& f ewHw 4 B;Q@f&  e5uQ@f&  e5uumumu _ eeQu  %QQ eu % ff j et ff | e5u< ff 2 et< ff D eL A@e@ f& " et e  =  r  rd > r 8 8 rd ( AV 5 8u 4  AV f&A@ 5u r  r   AV @mAm@ 5u e4 tWpe&u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw!ww De LN b4ee   b4e Be v Nfe D%ww -@ wNZ; %Z;w u@t5n;5p;@ 5;Nefef % (3A@u5Btrp;2n;@ Aup; fef % u-u-u-@w&w  fe @w @pHA@twRw  !,&    w 1&.< %7/&˕,.<Nf N w jD h  !     +  w6e% - r<N r<&@& .< e.< ~ ~w  Nef  ww D 5  =& % `5ȥ=  = @wNe  w . BuNefef %%=@@wЋ Ћ  Jҋ~ @@w hN " HNef "?@E% 8$ 2 *L-$ `< P e`< 8 Ne`< u-u- `6 5:B 5& & "% 45@e-4  % U5EU  w@ E w  D  +   r= wB w 5 a U5ff %ށ̥a &  (e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw |D5"E@e44fef %% U4 4  fef %%5 w    6v&   6@Cww7. Ћ PPЋ w FD:5UE5Hw* _5uNfe & 6%% _bNe & "  uN #)U5| m- 5 & 6%%St%6  " U   & 6%% S U _ @_w DE%%"5   & 6%% U wv w ^D55@   3 T$ 4 4 4 4 4 ww~w  $* 5+ ~ &5e-`e % & ~    F" ww  5f F" 7@ f F" 7wX@ m7*  % e w       F" e-ww D * 5 e % w  5 e-xw Z !ww  N <%ww rDCDpC # " wZw FN T$wJ ~5 & E        ~5>wlYwfw Net@f #e  w6w.w  W-)7*w 8uDAB %u f& & e w5 5  W- W00~u5  .lu" Bw* J@B |_'@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& r z   5 , @ :% & f E r  (˥-%0     ,:% &  r 8 5E& z   5 , @ :% & f E r  w2HB= llllflllllH ll2@(#)pr.c 4.5 (Berkeley) 12/12/84can't print 0 cols, using 1 instead. pr: bad key %s pr: No room for columns. r%s %s %s Page %d %s %s %s Page %d rpr: Too many args SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecz~mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %djr|"4FXdz *9H`m/L]|>Ut/Gh/>Rh  @ U RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator , h       TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/dev/<<<&d&o&x'f'e&g|'c's&l&L&u&D&O&X'U07l 468:R0R00  ( e7cce7 / `  7%  "w   h w@w fef %5 w w D Lԋww  $5+ &5e-e %t &     6 wTw @ 5f 6 7 f 6 7w@ mf7dZ%te w  D 6    6 e-ww D 5 e %tw  5 e-w RN wVw B N wBw .DCDpC  r ww N w ~5 & E        ~5Yw(w  U7U7Ae vB7   % 55 a  a!PE -% w  `e vWt vw`@ `e @  %84e U?"" `e 7U? a7 ?U ew ^DE wTw @D5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` ` m& E%m%w7*'$!     $ 7& A & BF7!W- 7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu|Bw* J@B |_r@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& f z   5 , @ :% & f E f  (˥-%0     ,:% &  f 8 5E& z   5 , @ :% & f E f  ww D:5UE5Hw _ 5uNfe & % _ bNe &   uN )U5| m- 5 & %St%  U   & % S U _ @_ w zDE%%"5   & % U w. w D55@   3  4 4 4 4 4 ww6>w0w Net@f e  w6ww@(#) Copyright (c) 1983 Regents of the University of California. All rights reserved. @(#)pagesize.c 5.1 (Berkeley) 4/30/85%d doxNf\eNg(c4s^l^LuDOXU08l "$&(*R0R00  > e7cce7  /   7%  > w x  %@-   >5 e% | v  >  & 8 @m& & %  N > Ne@&  @ N > w w Nef  w w   5/f @Nevf& %@ 6   80wH v@ev5xt%t t@t @aAt AmpxNev ^  %ч Nfev ^      w DCB̥:̋ ҕ/Ҕˋ ̋ w~ X ;ew w N DC E5<E@e33. @;E  5 , @;% & fE ~ 5   U3 3  w dw w D      + - ̥9 Wp @@`e̥0  w@ `w w " 4De _  t4 t t4 4t Ne&& % _ t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 $ 55 Nefe (% & `%5u7  && %  fe (%ff ,% fe& %w A@E f& w w w D Lԋw w v De LN n4ee,   n4e Be v Nfe h%w w -@ wN % w  Nef  ww D 5  =p& % `5ȥ= J = @wVe  w 6 BuNefef %=@@w Ћ Ћ  Jҋ~ @@Sw0mow(n<lw e& 7 7gwywЋ w FD:5UE5Hw* _5uNfe & B% _bNe &   uN  )U5| m- 5 & B%St%  U   & B% S U _ @_w DE%%"5   & B% U wv w ^D55@    3 ` 4 4 4 4 4 ww~w  $5+ &5e-e %p &     R ww  5f R 7 f R 7wX@ m\7ZP%p e w  : ,    R e-ww D 5 e %p w  5 e-w f ww  N Hww rDCDpC   wZw FN ` wJ ~5 & E        ~5>wlYwfw Net@f  e  w6w.w   U7 U7  Ae vB7   % 55 a  a!PE -J%  w$  `e vWt vw@ `e @  %e U? `e 7 U? a7 ?U ew dD|E wZw FD5 `  5N  !w5A vBB-  }ee@ !ۃ `!ւ ` `mL& E%>m8%w w7h*'$!      7& A& BF7!W-7tw 8uDAB %u f& & e w5 5  W- W00~u5  .lux Bw* J@B |_@  o x d u  08l "$&(*R0R00      ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& ~ z   5 , @ :% & f E ~  (˥-%0     ,:% &  ~ 8 5E& z   5 , @ :% & f E ~  w@(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)nice.c 5.2 (Berkeley) 1/12/86usage: nice [ -n ] command setpriority/bin/shPATH:/bin:/usr/binsh: Unknown error: %d .:L^p|#BQ`x (Gdu&Vm+G_  4GVj 6XmRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator doxfegcslLu DOXU09l5& R0R00  < e7cce7  /   7%  $w ^u:H J :%N: T@m:[[ @ @m& 8] J @ @m @e5>5 B@  ? x@  @<%@R@@Ne 50  >@5bz5 |5 ~Nez @!Ne 50ց@0w@!0@& hNe 50  >6f< h 54,@e! L4@4 D@m64u> < T(<@<e6 s<e& 6 "5 2_ t-2_58_| e ( _6 u> <)<@<f< h 54 e4@4 D@m652_ %   jo @ BfB 8 BNeF f 5D%815 8 5@@@% 5:  gf: X es: . NeB& %%% .ee@e!_ <_~@e! %4%44 .e   .%4%44 .e   .L4t2_4w D     ww D$@  x  4 w _@%P_ 4  &  _  - A@, t]Ne 55 @A Aap,tC u-<I9 @ #@ `Ne& @E 4 4 _@0 @  4t_&& p %_ T4 ePPP_ & 8 %_4-4- _4-_4- _4-_4- __4-__4- __4-__4- __4-__4- __w B@5u5 "@@mA@ NfNm 8A rw@e5pfNm 8w Duf h 5$uNef f 5Nefef %   wp@ 5@5u%%w (@5f h 5we@ 5%Nef ( Ne@& ( u@5 fef %   w D ̋y ̋@ 0 $y ̥-̥+y  f&@t J %w w  w w  w w @e5ff %w w  p  Nf l% n f  &   N $wt w ` @e5ff n %wP w <  Nf l%  N $w w  @e5f w w   Nf l%  f  &   w w @e5f < w w n *  Nf l%  wP w <   w6 w "  :   w Ow~  9 E5 @@l wzw DC E5<E@e33. @;E  5 , @;% & fE d 5  U3 3  w (w~ w D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  wz A@w X D LԋwP w < De LN T4ee  T4e Be v Nfe %ww -|@ wN &% w  BuNefef %=@@wX&ww >@5-E@BepNff %5N @U@0 @0 =  Nff %5@5 w@yw   @ppC`p ы A@Ћ w FD:5UE5Hw* _5uNfe & (% _bNe &  09l1& R0R00 uN )U5| m- 5 & (%St%   U   & (% S U _ @_w DE%%"5   & (% U wv w ^D55@    3 F 4 4 4 4 4 ww~w  $$z 5+ &5e-e %j &     8 ww  5f 8 7 f 8 7 wX@ mn7lz b%j e w  L >    8 e-"ww D z 5 e %j w  5 e-w L ww  N .ww rDCDpC  t wZw FN FwJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w   U7 U7  Ae vB7   % 55 a  a!PE -\%  w$  `e vWt vw*@ `e @  %e U? `e 7 U? a7 ?U ew dDE wZw FD5 F 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m`& E%RmL%w w7|*'$!      7& A& BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .lur Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& d z   5 , @ :% & f E d  (˥-%0     ,:% &  d 8 5E& z   5 , @ :% & f E d  w0 h&N$:`zz$Ftest: argc is zero]missing ]%dtrueZZZ%s: expected integersyntax errorexpression is too complex!-b-c-d-e-f-g-h-k-n-p-r-s-t-u-w-x-zZZZ-o|-a&=!=-eq-ne-gt-lt-le-geZZZ-o|-a&ZZZ : Unknown error: %dz&2DVht:IXp} ?\mNe #?Wx,?Nbx  . P e RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB  doxfegnczslLuDOXU0:l  R0ϢR0Ϣ0 @h@ e7cce7F@ /   7%  w t4" i a @-   e %Ne 8 @E%  7b&  e _W _%p?p .m b2@&   1 @&   1&  & e@&   1Ne@&  @E%  zR @ d  Ve@ %  @ %   (  j& %  @ 2jj w  @55 &5 @@@-NNNfej @ & >% -umu-ww  f  >%ww`w D Lԋww u@t5n@5p@@ 5@Nefef % (3A@u5Btrp@2n@@ Aup@ fef % u-u-u-@w&wlwv e& 7 t7lgwHw@w:7V< w N Dww w>ww7<*'$!      7& A& BF7!|W-7h0@(#)tee.c 5.4 (Berkeley) 12/14/85tee: cannot open 0;l uwR0R00 @ V e7cce7  /   7%  w P% @&  @&  @7 e  7  % r   @  & % e  r %    7` r d %FB %@ 7( " r    m Z e 2   r Pe  d  m@ Z e % d  w w DD #e  P Fn %& %& %    5 - ?% f & ߰f   wP w < DC5 ˥ff % _ _ J <D < 8_^54& -&<?% f & f <  _^ t1j ,  ,  5 -,?% f & ߖf ,   x tl -l#@?^% f & L  5%  0*5(f @& ˥ ”  >  5 ->?% f & ߾f >  w^ w J D      + - ̥9 Wp @@`e̥0  w w f fef J%5 4w w D Lԋw w De LN 4ee    4e Be v Nfe %w2 w  -h@ w N % w  Nef 6 ww D 5  =N& % `5ȥ= ( = @we  w d BuNefef J%=@@w8 Jҋ~ @@yw|w D5"E@e44fef J% F U4 4  fef J%5 w w ы A@Ћ w FD:5UE5Hw* _, 5uNfe & % _, bNe &    uN ` )U5| m- 5 & %St%f  ( U   & % S U _ @_w DE%%"5   & % U wv w ^D55@ F   3 4 4 4 4 4 ww~w  $Z 5+ | &5e-^e %J & r    ww  5f 74 f 7wX@ m 7Z %J e w       e-ww D Z 5 e %J w  5 e-lw  " ww  N ww rDCDpC `  wZw FN wJ ~5 & E        ~5>wlYwfw Net@f Z e  w6w.w  t U7f U7\ Z RAe vB>7 @  6%0 55 a  a!PE -%  w$ ` `e vWt vw@ `e @  `%e U? `e 7v U?j a7\ TV?NJU ew dD*E wZw FD5  5N ` !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7*'$!     V 7L& A<& BF7!W- 7 w 8uDAB %u f& & e w5 5  W- W00~u5  .luR Bw* 0;l uwR0R00J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   wlquy}(-otJweofeoffsfbsffsrbsrrewindofflinerewofflstatus-t-fTAPE/dev/nrmt8usage: mt [ -f device ] command [ count ] mt: don't grok "%s" mt: negative repeat count %s %s %d failedmtts11TMKRLSLET RLL WLE NEF ILC ILAMOTONLIESVCKPEDWLKBOTEOTtm03ATAERRPIP MOL WRL EOT DPRDRYSSCPESSDWNIDBTMBOTSLACORCRCUNSOPI CTE NEF CSITM FCE NSGPEFLRCINCVPEDPARFMTCPARRMRILRILFtm11ILCEOFCRE PAE BGL EOT RLE BTENXMSELRBOTCH7SDWNWRLRWSTURtmscpunknown tape drive type (%d) %s tape drive, residual=%d ds er%s=%o%s=%x: Unknown error: %d\dn&8JVlx+:R_u!>On0Gfv!9Z| ! 0 D Z |  2 G RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator Bd(o4xfegcslLJuND,O8X`U0<l2" sR0ˢR0ˢ0 ( e7cce7 / $  7%  xw ww D Lԋw$w N ww w7*'$!     $ 7& A & BF7!W-R7@(#)sync.c 4.1 (Berkeley) 10/1/800=l 0WY[]_R0ʢR0ʢ0 b e7cce7 / 6  7%  :w tNez " wRwNt@ et@ et@ e|t@ ett@ eht@ e% r :%& N r :%r_f& N_ r :_#(@#_(t e _ __e .  .   . #EU Ut e _ . EjUd Q_UR_ . 7 Bt e _$ . -EUP Ut e _(_" .  _eȥu_e . . $V Q_`ȥ^?HE<_4<_5 .  t  e_9 .  _e  7 > . C .  _e  7 K . ht@& P %& eh b Y % :5 @t . @t7# 7 _ @t ` . <t@& f %& e5 @t p @to   : @t s  :5 ,AWp NR . AWp AVw@\ AWp ATwPL AWp AZw@F AWp AXwP6 AWp R &  |z %  _ t et eut e}t egt eww   5 t @mAAmH@m\ ȋ7 P wbw N%8  %* %z    r   r    z e%z   %E?%5z  5@z  %5 5  ez  %55 ez  %55 ez  %55 e z  E%  ez  %55 ez  %5 &E r& L E% )E r& L %50 -E r& L %5@ 0E r@& L %5 3E n & L 6z  %_ xE%jES @  5 %8_ __ %55 edz  %55 elz  %55 ewz  %5z5r ez  %5F5> ez  %5@5@  ez  % z  5 5 %55 ez  %55 ez  %5 X5 P ez  %5$5 ez  %55 ez  z  5 5 %5 5  ez  %5@l5@d ez  %5850 ez    z  _* _ x|z  &  &  ~&  o&  d_&  UN&  _z  2&  #&  &  &  &  &  &  &  &  &  &  d5%6"$EE@  fg& %5 % 8e  jz  w2 w  5 EEu-,.%  qz  e@Nsz % % vz  u%%/%5 lz  eE%oz  ?xz  %w< w ( ENfzz e%z  ;z  5 z0=l 0WY[]_R0ʢR0ʢ0  E% z  ?%  z  e@Nz %w w t  Nfz ewb w N @ fz ew< w ( D      + - ̥9 Wp @@`e̥0  w w nfef %5 bw w D 3 \EtU4 4 wj w V D LԋwN w : De LN j4ee   j4e Be v Nfe %ww -N@ wN >%w  BuNefef %=@@wVW f r @  W f r@  @ yw|w D5"E@e44fef % U4 4  fef %5 w w ы A@Ћ w FD:5UE5Hw* _5uNfe & >% _bNe &   uN )U5| m- 5 & >%St%n   U   & >% S U _ @_w DE%%"5   & >% U wv w ^D55@    3 \ 4 4 4 4 4 ww~w  $b5+ &5e-e %R &     N ww  5f N 7 f N 7wX@ mf7dbZ%Re w  D 6    N e-ww D b5 e %Rw  5 e-w b ww  N Dww rDCDpC   wZw FN \wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  U7U7Ae vB7   % 55 a  a!PE -T% w$  `e vWt vw"@ `e @  %e U? `e 7U? a7 ?U ew dDE wZw FD5 \ 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m2& E%$m%w w7t*'$!      7& A& BF7!nW-7Zw 8uDAB %u f& & e w5 5  W- W00~u5  .luZBw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& z z   5 , @ :% & f E z  (˥-%0     ,:% &  z 8 5E& z   5 , @ :% & f E z  w     @@    "'- 3 8?GNV0Z0^ 0b00f k p uy}@@@ee  @   '-4@;@CJRYair y @@ ` 2Kn,X` %K05075110134134.515020030060012001800240048009600exta19200extb38400even-evenodd-oddraw-rawcooked-nlnlecho-echo-tabstabstandem-tandemcbreak-cbreakcr0cr1cr2cr3tab0tab1tab2nl0nl1nl2nl3ff0ff1bs0bs133tty3337tty3705vt05tntn300titi700tekcrtbs-crtbsprterase-prterasecrterase-crterasecrtkill-crtkillmdmbuf-mdmbuflitout-litoutpass8-pass8tostop-tostopflusho-flushonohang-nohangctlecho-ctlechopendin-pendindecctlq-decctlqnoflsh-noflsherasekillintrquitstartstopeofbrksuspdsusprprntflushweraselnextalleverythingeknewioctlnewcrtioctlcrtoldioctldecioctlgspeedhuprowscolscolumnssize/dev/tty%d %d speed/dev/tty%s unknown unknown mode: %s net discipline, new tty, old tty, input speed output speed speed , %d rows, %d columns ; even odd -raw -nl -echo -tandem -tabs -cbreak nltabcrffbs crt: (crtbs crterase crtkill ctlecho) crt -crtbs -crterase -crtkill -ctlecho -prterase -tostop -flusho -mdmbuf -litout -pass8 -nohang -pendin -decctlq -noflsh erase kill intr quit stop eof erase kill werase rprnt flush lnext susp intr quit stop eof , M-^^%c/ %s%s = M-^^%c%s%d %s%u baud: Unknown error: %dd l v   . @ R ^ t  $ 3 B Z g } ) F W v  8 O n ~ )Ab)8Lb:ORError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatordoxfegcslLuDOXU0>l IKMOQR0ɢR0ɢ0 @* e7cce7 /   7%  ~ w B5 % u N " _ef  5fe e%% %% %%% N " N  ; "NffR "eA Am@ Am@ 5uffff\ e %Nd " %%EN fe eu5 5 A AaA 5`u`u %ffh *e5 5 @ @a  % "N _   , @ ,: 2 .5, -,?% & ,  @ @a " N ~ wF w 2 DC E5<E@e33. @;E  5 , @;% & fE  5  B U3 3  w w p DC AupB 4  & %b 5% 傎& %`@ @m A ^&@w  w fef F%5 bw w D Lԋw W f r @  W f r@  @ w T D85U5_5P_  m@e4 ,5Ne &    uN \ 4USt%5< B 58 B 5& & % 45@e-4  % U5EU  w& E w  D  +   r= wB w5 a U5ff %ށ̥a &  e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bww7 w FD:5UE5Hw* _( 5uNfe & % _( bNe &    uN \ )U5| m- 5 & %St%  $ U   & % S U _ @_w DE%%"5   & % U wv w ^D55@ B    3 4 4 4 4 4 ww~w  $5+ &5e-~e %~ & ~    ww  5f 7@ f 7wX@ m7 %~e w       e-ww D 5 e %~w  5 e-xw   ww  N ww rDCDpC \  wZw FN wJ ~5 & E        ~5>wlYwfw Net@f V e  w6w.w  U7rU7hf^Ae vBJ7 L  B%< 55 a  a!PE -% w$ \ `e vWt vw@ `e @  \%e U? `e 7U?v a7h `b?ZVU ew dD6E wZw FD5  5N \ !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E% m%w w78*'$!      7& At& BF7!VW-7Bw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@0>l IKMOQR0ɢR0ɢ0B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   wa.outrsize: %s not found size: %s not an object file text data bss dec hex %u %u %u %ld %lx %s total text: %ld overlays: ,0%u >d$o0xfegcslLFuJD(O4X\U0?l^ 9;=?AR0R00 @ @ e7cce7d  /   7%  ~ w 5  p @ ? 6ff %5% 5`  5  N 5Pe N ~ wB f  fd 0ew 85 D̥̋/55 Nef $-%>f ( fd 0e f" L  wl w X 1d 0  ~ wN w : w-xr @m7hȥ- ^Z> L-F@ <7j%:f  (   df * dW * d   d  ?w ̥:7 *+ w-l df * dmz @m7l f 9 E5 @@l ww DC E5<E@e33. @;E  5 , @;% & fE  5  BU3 3  w, ww  D Lԋw w De LN 4ee8   4e Be v Nfe *%ww p-@ wjN % w > BuNefef F %=@@wЋ Ћ &w`ywZw D5"E@e44fef F % BU4 4  fef F %5 wn Ћ w FD:5UE5Hw* _(5uNfe & % _(bNe &    uN \ )U5| m- 5 & %St%X  $ U   & % S U _ @_w DE%%"5   & % U wv w ^D55@ B   3 4 4 4 4 4 ww~w  $L5+ X &5e-t:e %< & R    ww  5f 7 f 7wX@ m7L%< e w       e-ww D L5 e %< wf  5 e-Lw   ww  N ww rDCDpC \  wZw FN wJ ~5 & E        ~5>wlYwfw Net@f V e  w6w.w  T U7F U7< : 2Ae vB7   % 55 a  a!PE -%  w$ \  `e vWt vw@ `e @  \ %~ze U?hh `e 7V U?J a7< 46?.*U ew dD E wZw FD5  5N \ !w5A vBB-  }ee@ !ۃ `!ւ ` `fm& E%m%w w7*'$!     L 7B& A2& BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .luD Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   0?l[ 9;=?AR0R005 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   wpmkdir: %s: %s mkdir: %s: %s mkdir: %s: %s usage: mkdir [-p] dirname ... V: illegal option -- : option requires an argument -- : Unknown error: %dNV`z*<H^jv,DQgv0A`"9Xh+Ln"6Ln$9RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator >d$o0xfe gcs l LFuJD(O4X\U0@l +-/13R0ŢR0Ţ0 6 e7cce7 /   7%  w  ~  77 7 %@- eD -%= \:? P  . i r$ P   f   ̋ R   ef 4    w>w *|N R Z P N Ny P% Nef @E%@_ b XN N    ,f N  wx NN 5 N N 5~ Nefe~  N ^5_\e R Ne N N x 4 5l| |/|-X|w|P=| |N 59~N ^5 efe~  N ^5ef| Nef|f Pe_< N P% N  ? N'  _VN  _ V R_VN7_h < NK  %_V  @E%f NfE[ % h _VN  _  _VN_hw .@.@ w w  4 . * 55%    5% %y w w j N   A 7  P  (aem@  P% - // ~Nv  7alw (w> w8 w fef %5 w w D Lԋw~ !w w d D ` 4 4  wT w @  f  %  ` P 4 4 w w D 4-&4-!4 4   &e & %4    w me   s lt   ww ^ D85U5_:5P_:  mv@e4 ,5Ne & r   uN 4USt%5$ 5  5& & % 45@e-4  % U5EU  w0E w D5"E@e44fef % U4 4  fef %5 w ww  ы A@PЋ w FD:5UE5Hw* _ 5uNfe & % _ bNe & r   uN )U5| m- 5 & %St%  ~ U   & % S U _@ @_D w DE%%"5   & % U wv w ^D55@   ` 3  4 4 4 4 4 ww~w  $5+ &5e-he % & h    ww  5f 7* f 7wX@ m7%e w       e-ww D 5 e %w|  5 e-bw  x ww  N ww rDCDpC  ( wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  j*U7\(U7R*P(HAe vB47 6  ,%& 55 a  a!PE -%( w$  `e vWt vw@ `e @  %e U?~~ `e 7l(U?` a7R JL?D@U ew dD E wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `|m& E%m%w w7"0@l +-/13R0ŢR0Ţ0*'$!     l 7b& AR& BF7!4W-`7 w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_l@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w@(#)rm.c 4.18 (Berkeley) 1/6/86usage: rm [-rif] file ... usage: rm [-rif] file ... rm: cannot remove `.' or `..' rm: %s nonexistent rm: %s directory rm: remove directory %s? rm: %s not changed rm: cannot read %s? rm: cannot read %s? rm: internal synchronization error: %s, %s, %s rm: remove %s? rm: %s not removed rm: remove %s? rm: override protection %o for %s? rm: %s not removed rm: ran out of memory rm: path name too long: %s 44d~oxHfVeHg"c.sXlXLuDOXU0AlB L!#%'R0ĢR0Ģ0 <* e7cce7 /   7%  @w z Ne Ne| % @Ne   @wB w . x@e5@e57 =Ne  f n w uuf n eNefe pNef  u-$u- N _B_FN B5N }-(N B5N Nef n Nefe  u-u-N Nfe X  X 5u-u-uuf n eNe 5__Nf n @_w n DC  ̋`%# wJ (ww 0 fef  %5 dw w  D Lԋww D 4 4  b ww  f b %  P  4 4 ww D 4-&4-!4 4   &e & h%4    w:me   s lt  &whw D5"E@e44fef  % U4 4  fef  %5 w| wwPw FD:5UE5Hw* _5uNfe & D % _bNe &   uN  )U5| m- 5 & D %St%   U   & D % S U _ @_w DE%%"5   & D % U wv w ^D55@    3 b 4 4 4 4 4 ww~w  $5+ N &5e-T0e % & 2    T ww  5f T 7 f T 7zwX@ m7%e w       T e-~ww D j5 e %wF  5 e-,w h ww  N J ww rDCDpC    wZw FN b wJ ~5 & E        ~5>wlYwfw Net@f  e  w6w.w  4\U7&ZU7\ZAe vB7   % 55 a  a!PE -%Z w$   `e vWt vw@ `e @   %^Ze U?HH `e 76ZU?* a7 ? U ew dDE wZw FD5 b  5N  !w5A vBB-  }ee@ !ۃ `!ւ ` `Fm& E%m%w w7*'$!     B 78& A(& BF7! W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_ @  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w0Al@ L!#%'R0ĢR0Ģ0@(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)pwd.c 5.1 (Berkeley) 4/30/85pwd: %s %s /getwd: can't stat /./getwd: can't stat .../getwd: can't open ..getwd: read error in ..getwd: read error in ..//Bff d o x f e g c s l L u D O X U0Bl" 2CR0R00 @6  e7cce7  / R  7%  R'w *% u5v ff e r R'@ ^5fe@& ^!%uu;.&  u5 *W &̥0 xXeNe & %% N "% R'ff 2 % 7  R' R'w~)w f)D*  R ? E G   - ? %  & ߾ #  ݀5  E -  ? %  x  & l # w(5b   w ( fef ,%5 8 w( w t(Nefz %wl(w X(Neff %wP(w <(D A555  ԋuNeffe %w(w 'DC 5 5 _(%%_J5 %*e5  AWp `eu7  0u%l5  %h%[ 7 e  _~Neffff e   * O  A@ EN  5% % % %Nf &    %_ A@ E%Nf @wj&N  5 w D&N%c%s%[Nf ff f& ew&5 5 5 5 %e%f %o%xDe5 5 A @ EN  % % % %- Ԑ A @ EN   _%+_  _%a%f %A_%F_ % A@vN  O% A@v@mAm@ vA@v5u7 0 %a%fW7 5`u`u C% S P Ԑ A @ E =7 %%.%e%E- *% ' $ ! Ԑ A @ EN  %+%-%0%9 A@  5u% N  =   @e! @e! _@t@]   xBNe A _Ne A @H@pHw #DC = 5%c%0u5 %s     %rB%c5 %[rB       %%   =  D- %cw" w "D ̥^  BBB % %]%-+ B $%-̥]4  B ̠ B BB %]  w^!w J!D*\5% %-%+ 5 55 55  B5eA5 7 %.55  B5eA5 7  %E%e$%+%-  Wp B`e7   @`5 @ 5AupAm%55 @5A5u555555  55555AupN& \ e5 55w6 m 7"dww RD LԋwJw 6De LN #4epe (  #4es Be v Nfe  %ww -@ wNu Z % w ~ BuNefef ,%=@@wRЋ Ћ w D% 5     |@w4- ywPw D85U5_H5P_H & m@e4 ,5Ne & '  uN 0(4USt%z 5 %5 %5& & &#% 45@e-4  % U5EU  wE w z  uff e55 D ^fe& ^!%e  & & ^!%e & ^!%e0@A@ 7r5%  0& ^!%mm   ww zD@et5r%=r D 8 " 7;P @.  @ w:e =r r̋7 =rNet T# Net0Bl 2CR0R00 T#e  @et5Net #5&f 4%  N7 w DC . V " 7%n @.  2!f !%  >  ,w.u5&f % L N7 D w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @7  W-@D7 Ae B7 ḁ.@e@- @D7 @pHe _̋@pHeA Be vC ̂ x. uuff %5uwpA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ 0( w5 4@E%@EU5N&e p# X &e <# Nf&e #%4 IN&e p# ] &e <# Nf&e #%  (Ne& '  ff eee@ 4t@t"4 4t % t)_<w N %@ %N t)wzw fDff %5u4 4 @ A f&A@EE4tmm@ 4 t  @ ve@ 4tww D55ff %f&& "eff&e e &e  55 wwDwb5 5 w DD5#25ff T %f&& eff&e *ew&e '44  && ef&& ,#e&e & V*%%U w vD5_`bo5ff %f&& eff&e Ze L&e 8f f ff&e V e 744  && ef&& ,#e&e & V*%%UUw @@m e%fe '  &e  55 3ff `%f&e@ &50c &e  55 3b  " U44  && ef&& ,#e&e & V*%%&_Lfffffe e _L&e % __Le_  mm@ e@ f& ef&& ,#efe& V*%%_L J_w @0 0 @0 N D77Hww D85_PNe& 'q fe Ve4-4-/44  &&  ef&& ,#e&e & &#%%&e ' &e  55 ew*w&Lw4 et 5-5-5 5 w ~D4 4 @ A f&A@EE4tmm@ 4 t  @ ve@ 4t4-4-/44  && ef&& ,#e&e & &#%%&e ' ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& ,#e&e$& &#%%&e$ ' `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& ,#e&e$& &#%%&e$ ' `Btp$t t"  ff Nef&& ,#e&e$& V*%%UwD w 0 D5#5 5 wwPw  @ a@ a@m5A a@5w D 5# aB- f a@m& !% w e aC-w ^ D@ A 5@u@e@ 5u   w, uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l8 @Et5lX 5lZ u te%w L D5u-5 w2 @e@- @ a@ a@ a5@ a@@@m`&fNm ^!% a@ `` e w D a@@m e  wj e  aAm HN@`@m &f ^!%  aN f`f ^!%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef ,% %U4 4  fef ,%5 wZ    6v&  @ppC`p   6@Cw8w27 Ћ P ы A@PЋ w FD:5UE5Hw* _$5uNfe & V*% _$bNe & '  uN 0()U5| m- 5 & V*%St%  ' U   & V*% S U _# @_#w DE%%"5   & V*% U wv w ^D55@ %  % 3 t) 4 4 4 4 4 ww~w  $z 5+ &5e-Te %j & 2    f' ww  5f f' 7 f f' 7wX@ m7z %j e w       f' e-~ww D jz 5 e %j wF  5 e-,w z% &ww  N \*ww rDCDpC 0( ' wZw FN t)wJ ~5 & E        ~5>wlYwfw Net@f *(e  w6w.w  4nU7&lU7nlAe vB7   % 55 a  a!PE -%l w$ 0* `e vWt vw@ `e @  0*%^Ze U?HH `e 76lU?* a7 ? U ew dDE wZw FD5 t) 5N 0(!w5A vBB-  }ee@ !ۃ `!ւ ` `Fm2& E%$m%w w7~*'$!      7& A& BF7!nW-67Z& & e Ӌ r v &7$&  e ӕ- ӕ0B~ӕ.  ӕ0~ B~r v &7 & e ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & &e w5 5  W- W00~u5  .lux Bw* J@B V_-@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff re w5  @ 0   Wp `e0w pj 41w]ww | TN z%7 F  N7 7 ^w`w L "   L0 7 lx /%5# f /   f /  (N f&  ̥ ̥ 7(7 & /  ̥̋ ̥ %N & /   w`w Lw(wRw >D CKw4 ˋ 5 &  4  $ '     ` TW ~  s`K6!  w D  +   r= wB wn5 a U5ff #%ށ̥a &  ,#e 3     U̥r 33w D % & & ,#e 4E05Ewvw bDCB P  5 , :% & E& # z   5 , @ :% & f E #  (˥-%0     ,:% &  # 8 5E& z   5 , @ :% & f E #  ww Nefef 5& :4e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& 4eww x fff 5& 4ewhw T 5 %O N  = P555Ne5& 6e555'0Ne5 B& 6e57 Be0" 5%55 5 B5@B eP a=%P7Pwl %5 B5Ne& 6e55e0%7`Jʕ0%Pʕ1  %P˕0 ʥ9 6@~ 0x%lx 0%lxusage: %s [hexnum or internet address] sethostid: Unknown error: %d.6@Zj (>JVhw $1GVbu!@ax8H_ ,Ncv,N`r  RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorV| ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired T-d,o,x-f-e,g-c-s,l,L-u-D,O,X&-U /etc/hostsr# =(\0Clh :R0R00 j  e7cce7  / B  7%  w 85 5 -f    *f   e  % 5% 0J :   % _Nj  Nj  /j  : j D  " j F  j ̋Hj  5u j  A@v e@ f& ef&J e% e _ ww B5 5 5 5  f  55u-@/ Nef N = w<@tp-n%,@E%@%5 @tp-p -l%b\tpnNtpp @uu@E%@$ ~N A@v e@ f& ef&R eA@  N 67_HN  N = 7 _Tff fev vDZ&e \&e e_f %2 J5uN f  5`u`u = c 67e _T 7 < N A@v e@ f& bef&g eo  r& f F%&  N  =_& w^  wP (wH w >fef %5 fw w D J5u@-A-/A@E5u@E55  ff& e4 4 5- 5- v5w" w  D Lԋw w De LN . 4eve@   . 4ey Be v Nfe 4%w w l -@ wf N{! %!w : & f eB B`@ `w w BuNefef %=@@w Ћ Ћ   Ћ Ћ w r D 4 4  wb w N  f  %  P 4 4 w" w  D 4-&4-!4 4   &e & %4    wme   s lt  w r & f .ewjwyww JD5"E@e44fef % U4 4  fef %5 w    6v&w w7  ы A@PЋ w FD:5UE5Hw* _ 5uNfe & % _ bNe &   uN )U5| m- 5 & %St%>  U   & % S U _f @_j w DE%%"5   & % U wv w ^D55@   3  4 4 4 4 4 ww~w  $25+ d &5e-|Fe %" & Z     ww  5f  7 f  7wX@ m72%" e w        e-ww D 25 e %" wn  5 e-Tw & ww  N ww rDCDpC  N wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  \B!U7N@!U7DB!B@!:Ae vB&7 (  % 55 a  a!PE -%@! w$  `e vWt vw@ `e @  %e U?pp `e 7^@!U?R a7D <>?62U ew dDE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `nm>& E%0 Clj :R0R000m*%w w7*'$!      7& A& BF7!zW-7fw 8uDAB %u f& & e w5 5  W- W00~u5  .lu* Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& > z   5 , @ :% & f E >  (˥-%0     ,:% &  > 8 5E& z   5 , @ :% & f E >  w(@(#)du.c 4.11 (Berkeley) 7/1/83.-s-aNo more processes. //.%ld %s %ld %s .../%s..%ld %s ../..: Unknown error: %d4<F`p".DP\n}*7M\h{'Fg~>Ne2Ti|2Tfx RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator(!L!L!doxnf|engHcTs~l~LuDOXU0Dl 7R0R00 @*  e7cce7 /   7%  ~w ! 5 5 e __D̥-__ x$}e_ <fJt.Xea}e AAWp @@`eA1$@ @2B 6o   z ~_7 j  bWp @@`e7P$ @ 8 ̋ e% .e=  AfAAm r5A @puA-ueu & AfAAm r5A 5r5&N A1 eu @ȥ+v f % N  ~e  N H7wf h %e  N H7w+ % 2 /   7`w`w  7`w`w v  @e À 5  5  -D  @     ,ee wN& @ w  & ff $e &  & f f n e      !5 -@ ?%  & ߺ @ &  w6w "  _ H   ,e 6 ^ X P L5J< -< ?.%  &        &e `D- ,    5 - ?%  & ߐ   @e_ww N@&@&f n e@&  @ww N@&@&f& n e@&  @wzw fN@&@&@f& n e@&  @w0w =&fe e Ne@&  @ww =&fe e Ne@&  @ww  @5  E@$4-t @te "%!-D@te@&  w$w  Cx @ ww   ԕ_ԕT  ww N@&@&@E&& n e@&  ww lBEN <  &@     @&  w$5 - ?t%  f & Z    w @ _z xw@$7 N@&@&f n ew P f $F?8 f 7 Fw DE50$ A mm@ 7ww7 A 7`w`w N& n w  %  f |Uwxw d ^5XA@,R5j D>82 ,e  f& @%&  - , l f ^ Z5XJ -J ?<%  & *   ww uuu <8  05 -@ <@5 _ _ 8  5.ffff 8e5uffff DeA`@$A@  5u_ 5 _ A@ee@ f& 5u@ A 5@u@ffff e5uffff n e5uffff z ef&A@ f&ffff L ef&A@ ee@ 5ueu A@@mAm@ 5uffff e5u5`u`u ffff ef@`$  _ ffff d e5uffff p ef@`$uu05  d ww D̥+ ̥x  x e ̥0̥0zӥ. jˋ5 5 $@ ffB eee@ ee@ 5u ̥̋. ̥b  fe ~e̥B  fe deA@w$% ff  eee@ eew v D  A@Ef&v fe5 Effv ewZw F9 8 W-@5N0Dl 7R0R00ffe @e5@-    ~A 5u  ww 4Ne@ &   @  $  w&  @ppC`pLw JDC+ 5  a  r5 w: w U5ff %̥a &  e 3     U̥r 33w `DC E5<E@e33. @;E  5 , @;% & fE  5  BU3 3  ww DE5_% _n _n5`uu '& & e5u%%w$ @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & e5u %%    Z%%%_5 B5 5 E4N ff & e W _%_`%_`_w D* R ?E G  -?%  & ߲   ݀5 E - ?z%  l & `  w 5V  w DC AupB 4  & %b Z5% 傎& %`@ @m A V&@wT  w 6  fef <#%5 w" w D Lԋw w De LN 4ee   4e Be v Nfe T%w| w h -@ wb N> %>w 6 BuNefef <#%=@@w W f r @  W f r@  @ yw0 w D85U5_5P_  m@e4 ,5Ne &   uN \4USt%v 5z B5v B5& & % 45@e-4  % U5EU  w| E   R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw DD5"E@e44fef <#% BU4 4  fef <#%5 w    6v&  @ppC`pww7V Ћ w FD:5UE5Hw* _(5uNfe & !% _(bNe &   uN \)U5| m- 5 & !%St%  $ U   & !% S U _ @_w DE%%"5   & !% U wv w ^D55@ B   3 4 4 4 4 4 ww~w  R$v 5+ &5e-&e %f &      ww  5f  7 f  7wX@ m7v %f e w  z l     e-Pww D <v 5 e %f w  5 e-w  ww  N !ww rDCDpC \  wZw FN wJ ~5 & E        ~5>wlYwfw Net@f Ve  w6w.w  lU7jU7ljAe vB7   % 55 a  a!PE -%j w$ \! `e vWt vwX@ `e @  \!%0,e U? `e 7jU? a7 ?U ew dDE wZw FD5  5N \!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7l*'$!     v 7l& A\& BF7!>W-*7*& & e Ӌ n r &7& e ӕ-ӕ0B~ӕ.  ӕ0~ B~n r &7 & Le ӕ-0 vӕ.j B~ӕe\ ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .lut Bw* J@B V_%@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w&w Nefef 5& 0(e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& z(eww  fff 5& z(eww  5 %O N  = v555Ne5& )e555'0Ne5 B& )e57 Be0" 5%55 5 B5@B ev a=%v7vw %5 B5Ne& )e55e0%7 `Jʕ0%vʕ1  %v˕0 ʥ9 6@~ N hT\ \\       (  usage: od [-abcdfhilopswvx] [file] [[+]offset[.][b] [label]] %s   lnulsohstxetxeotenqackbel bs ht nl vt ff cr so sidledc1dc2dc3dc4naksynetbcan emsubesc fs gs rs us spdelT z z z z z z z \ t h z b n 0123456789abcdef@(#)od.c 5.12 (Berkeley) 5/14/84od: bad flag -%c r* (%s) %21.14e%14.7e \0\b\f\n\r\tEOF : Unknown error: %dx$0BTfr8GVn{=ZkLc ! = U v   * = L ` v  , N c RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorR4$d$o&$x$f$e#g$c$s#l#L<$u@$D$O*$XR$U=(\0 El8@'R0R00 #p e7cce7 /   7%  w F IH@-B=e0 xD*<'>$ .&@a ߃@HP ,% e@ȋ  @bwwe @   wxw d7h . j& | _VNe&  7 7 0 nev p% _&X R  %>  5  5u0 ne%%% % %%_< z 5u A@@mAm@ f&& l ep vB*& | _<%H%@% 8%0%(% _& | _P + .7 $fe ne     ڀ A@@mAm@ f&& l et 5 |  h vB0fe ne    t @mAePPPP ΀ @mAm@ 5u ff& l efe ne% | N 7 % % | feVe ne% |  t@mWtAmAmH  f (e%   f Z N .5  .7   _ 4wLw 8D _taE%fB%u_.H.*  43E     ?uta catdbr  ta e%u%U  ta    tataEta& % C-_hwta   w DC,(" w,f& %Vp@w r f l eN   wZ(mE mm@ e<@ 7`w`w w J P ,%6 P ,%P , NP ,%  $ww N< ne%<_B #fe: p% _B  fefe r%5 & fe T%7 wfefe r%5 & fe T%wfefe" r%5 & fe T%wfefe( r%5& fe T%wz fefe0 r%5 & fe T%7:w8 w\)f % 'Ne 7 %?N& ne!4 7w 7 f r% ʥ  w D  5 & & e5u A@w~5 5 5@ 5`u`u w &DE5_ % _t _t 5`uu '& & e5u%%w @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & e5u %%    %%%_ 5 5 5 E4N ff & e W _ %_f %_f _ w D z 5u5mu A@ww D J 5u5 A@ww De m@ e@ 5u%% du %e u 5mu A@w\w HD 5u5 A@w,w D%%055  m@ 5u%% e du %umumu 5umumu A@ww D      + - ̥9 Wp @@`e̥0  w<w $DC AupB 4  & r%b 5% 傎& r%`@ @m A &@w  w Dfef %5 2w w j%Vww t7WpwAwpAmu% Nf J @m5uBmB-"C-Dm5TD-umz@5@- w \0%El7@'R0R00ӁNNf Bm:u-Bm( B-т̒C-Lw H @@5@ . vwpAmDu-6B @5  N zC! l5ԒS DCNUHC-f 6m,5D-/+D-!Cm@5&@5%3-f J 5u0B555R DD-N& m-N& J -l_^w w D 3 .EtU4 4 wn w Z D LԋwR w > DC %75 ̥+̥- %$ ! ̥0 ̥X̥x % ̥0 ̥X̥x 5 5 %707e e  ff eee@ 5u %7 = A@  w@ A@ Jҋ~ @@W f r @  W f r@  @ w D85U5_5P_  m @e4 ,5Ne &   uN 4USt%85D 5P 5& & % 45@e-4  % U5EU  w E w d D \ +   r= wB wF 5 a U5ff %ށ̥a &  e 3     U̥r 33  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw fD5"E@e44fef % U4 4  fef %5 w   @ppC`pw@w:w D  & & e 4E05Ew7  ы A@w FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%D   U   & % S U _t @_xw DE%%"5   & % U wv w ^D55@    3 . 4 4 4 4 4 ww~w  $85+ P &5e-2e %( & x     ww  5f  7: f  7wX@ m78%(e w        e-ww D 85 e %(w  5 e-rw 4 ww  N ww rDCDpC  \ wZw FN .wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  znU7llU7bn`lXAe vBD7 F  <%6 55 a  a!PE -%l w$  `e vWt vw@ `e @  %e U? `e 7|lU?p a7b Z\?TPU ew dD0E wZw FD5 . 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m6& E%(m"%w w7*'$!      7& A& BF7!rW-#7^w 8uDAB %u f& & e w5 5  W- W00~u5  .lu0Bw* J@B |_!@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& L z   5 , @ :% & f E L  (˥-%0     ,:% &  L 8 5E& z   5 , @ :% & f E L  w@(#)nm.c 2.11BSD 1/22/94|nm: invalid argument -%c a.outrcannot open! bad format %s: no name listout of memoryno string tableran out of memoryerror reading strings %s: %s:%s: %06o %c %s %d %s nm: %s:(%s): %s ` ` #1/#1/#1/ ((((( AAAAAABBBBBB Txx d o x|!f!e| gV!cb!s l L u D O X U0,Fl &R0R00 H , e7cce7T  / (  7%  w :2_ @m7 *   ^%7z_   _/   ,%7J_4   %7~ _9   %7Z g=  > > ]A  * , SE   %7 CK   %7 3Q   `%7 #X   @%7Z_  F ( n %  C-_b%25\  \ _ V 7h F x   8 _*  _e   g  n  r  Zx  4 ~    U   Ux   Ud   UP   _U8  V 7T 2 ( n %    77%2  ( n   7 x 7 @ % % ( n  7 7 7   0 %  0 T h  % : 6   J e   _B7   m -5m-!  %7%! x 5  7  $`ȋ -@    .  -v  x5R b bPT 54  54T~* (( $7   _> E w $  -   %- x  7 ww @ ȋ T w 7tw b5 5 ̥0/̥9, f& ff eee@ ee@ 5u bJ fe e  *7 l%  f&fe eA 5 u  ff( e @w  x k w& w D5J%a%ze52%A%Ze  2wh w T 8 4 - w@ w , @ E  !%     2   - 27 7 w w  D  !%     2   d-Z^ 27 P7 ^w~ w j D5%a%ze5%A%Ze  E % -  - 2w  2 -7 w D5%a%ze5z%A%Ze  E r% -dh l ^-TX 2w  2 >-487 2w R D5%a%ze5%A%Ze E % -  - 2w  2 -7 w N w w ( n e~x*( n e h b=( n %w| w &  @ppC`pL)w w * D Lԋw" w  De LN 0 4eTe  0 4eW Be v Nfe h %w w - @ lw NY| %| w V u@t5 5 @ 5Nefef ( % (3A@u5Btr 2 @ Aup fef ( % u-u-u-@ww  BuNefef %=@@wr< lw e& 7 7gwyww D5"E@e44fef % U4 4  fef %5 w   @ppC`pww7P Ћ w FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%   U   & % S U _h @_l w DE%%"5   & % U wv w ^D55@    3 " 4 4 4 4 4 ww~w  $ 5+ &5e-e % &    01Fl &R0R00  ww  5f  7B f  7wX@ m7  % e w        e-ww D  5 e % w  5 e-zw ( ww  N ww rDCDpC  P wZw FN "wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  jU7thU7jjhh`Ae vBL7 N  D%> 55 a  a!PE -%h w$  `e vWt vw@ `e @  %e U? `e 7hU?x a7j bd?\XU ew dD8E wZw FD5 " 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E% m%w w7f*'$!      7& At& BF7!VW-7Bw 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& @ z   5 , @ :% & f E @  (˥-%0     ,:% &  @ 8 5E& z   5 , @ :% & f E @  w     [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#)dd.c 4.4 (Berkeley) 1/22/85ibs=obs=cbs=bs=if=of=skip=seek=count=files=conv=,ebcdicibmasciiblockunblocklcaseucaseswabnoerrorsyncbad arg: %s cannot create: %s counts: cannot be zero not enough memory readwritedd: argument %D out of range %u+%u records in %u+%u records out %u truncated records : Unknown error: %d$>Nfp ".:L[kz+:FYj$E\v , C g  2 G Z |  2 D V j RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorPttdoxpf~epgJcVslLuDOXU08Gl~ ;R0R00 @. | e7cce7  /  7%  &w ) e&. %@ȥ-  R f t  p ʋe  % A !  & j7. N  N 7  7  ! Nb %N 7 Nt % 7  H7   /f - ) T  @`F " 6  @`  b  &N %  " 5  A  @m& Z @m +-  @m    " E%@N   @m& e7` D- &w'  @m& % w p'@ O  wf'w L'6Nf % N  N   tN w'  5 Nee Z e 5 N     P@ u- e  5@E%@ffe e5Ne % e 5w & < ! Nf !%   z v5tf -f ?X%  & F  "  w%w %7 xNf  N &wr%w ^% V   ! N : : wF%w$ w$ w$w %D F 3! ^w %w $D "  " 4w$w $   ( 7 "w$w $  $7 w$w $DC  ̋̋wr$w ^$ l " ( 7X EN V%7,:&  7:&   7:&   &   %,&  ̋ w#(w.#w # >  :  L  w# $ 5 ff L% 50   8 w D#  uN "5&f %5w# 5  f "  0   w " p  @e5ff l%5w" 5  w-   4 w D"  "  & < %7(w"4 "@5Sf ( 7x w ! Hw!w ! t  w!wfw ! <6 <7 .  *$ $7 w!w t!wwz!w f!   @ E wR! 5% % V%   2U 7X& 7[&  7n^&  7Va& 7Ld&   7.w,g&   7wj& 7m& 7p& 7_w $   w  7   255 ffn e55T DD>& L %e& L %e& L %e& L %e7w   _ s "_  _$ 5 & f "%5=p  5u fff \"e5 #u 1f "%50 :=N %wbw ND      + - ̥9 Wp @@`e̥0  ww D5 5      + -! ̥9 f& ff >eee@ ee@ 5u̥0 A@  wrA@ww JD LԋwBw .DC   w"5 7@  55@- 7 5!w De LN "4ee  "4e Be v Nfe P%w\w H-@ wBN %w  BuNefef J*%=@@wЋ Ћ w D %4 4  (ww  f " %  %P `'4 4 whw TD 4-&4-!4 4   &e & "%4    w me   s lt  yw8&  4  b '     ` TW ~  s`K6!  w 0D85U0=Glx ;R0R005_5P_ t mj@e4 ,5Ne & '  uN `'4USt% 5 F$5 F$5& & "% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff "%ށ̥a &  \"e 3     U̥r 33w 4$ `' w5 4@E%@EU5N&e " p &e l" Nf&e "%4 IN&e " u &e l" Nf&e "%  (Ne& '  ff eee@ 4t@t"4 4t % (_*w N %@ %N (ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  . ve@ 4tw"w D55ff %f&& "eff&e e &e  55 www5 5 w D5#n5ff T %f&& eff&e *ew6&e z'44  && ef&& \"e&e & )%%U w D5_No5ff %f&& eff&e Ze L&e z8f f ff&e V e 744  && ef&& \"e&e & )%%UUw @@m e%fe &  &e  55 3ff `%f&e@ &50c &e  55 3z  ! U44  && ef&& \"e&e & )%%&_:fffffe e _:&e % _~_:e_~  mm@ e@ f& ef&& \"efe& )%%_: 8_xw @0 0 @0 N 277ww D85_>Ne& 'q fe Ve4-4-/44  &&  ef&& \"e&e & "%%&e & &e  55 ew ww4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  . ve@ 4t4-4-/44  && ef&& \"e&e & "%%&e & ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& \"e&e$& "%%&e$ & `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& \"e&e$& "%%&e$ & `Btp$t t"  ff Nef&& \"e&e$& )%%Uw w r D5#5 5 whwdwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& % w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5lP @Et5lp 5lr u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm L % a@ `` e w D a@@m e  w e  aAm HN@`@m &f L %  aN f`f L %  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef J*% F$U4 4  fef J*%5 w    6v&  @ppC`p   6@Cwzwtw D F$ & & \"e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _,$5uNfe & )% _,$bNe & '  uN `')U5| m- 5 & )%St%  (' U   & )% S U _" @_"w DE%%"5   & )% U wv w ^D55@ F$  % 3 ( 4 4 4 4 4 ww~w  $ 5+ &5e-e % &     & ww  5f & 7 f & 7wX@ mh7f \% e w  F 8    & e-ww D  5 e % w  5 e-w $ "&ww  N )ww rDCDpC `' & wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f Z'e  w6w.w  <U7:U7<:Ae vB7   % 55 a  a!PE -V%: w$ `) `e vWt vw$@ `e @  `)%e U? `e 7:U? a7 ?U ew dDE wZw FD5 ( 5N `'!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E% m%w w7x*'$!      7& At& BF7!VW- .7Bw 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_,@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& " z   5 , @ :% & f E "  (˥-%0     ,:% &  " 8 5E& z   5 , @ :% & f E "  wCan't fchdir() back to starting directoryunknown option: %cusage: chgrp [-fR] gid file ... %s: unknown group%s: unknown groupWho are you?You are not a member of the %s group.Can't open .You are not the owner of %s.You are not the owner of %schgrp: chgrp: /etc/grouprr(/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd: Unknown error: %dPXb|,>J`lx.FSix2Cb$;Zj-Np$8Np & ; RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired "FFB+d(+o4+x+f,e*g+c+s+l+LJ+uN+D,+O8+X`+U0IHlWUR0R00 Nr4 e7cce7 / N#  7%  nFw I (  7$ +& N 7we< w P G 177Ne  ht@ FGe%  P7@E% _4_4 r y7h_4^_4V_4R_4H_4D_4m(jgda ^[XU     R   nF:   .         p    ff ^%5%_"7*" 77 7 782 5`  f F  R   nF55  f& |e tUee u-5 A A r&f z e> Nf  nF2DDeD-̥df D-YD-C 5  : 5, -& ?%  ~v -v ?h% F& V  5PF B %&  J eD- nFwE0@7$    5 - ?% F& ߲F B f  N FN Fw .ENefef %5u _ A A r&f z e N N @< ff eNf ֝.0D(̥d%& pB& pB LGf  > D-ӃD5  F  FeD-N FwDw CN .5 ==N N  wCf F =AWp`}5 5 f d. ZW.PNe&`ef %&& |e 7e > 4e=!)AWp<Nf H = R   nFAWpDDoAWpa} N Z.N -= A@v e@ f& 9e_@w xBDl.5P~4 4 ̕-  _ Nef % Nef  NR @% wAtttt@E *   @  ` dtt_n ̕dY̕bt Q̕c̕s4 4 G̕lfef H %55@@m0Ne > 4(Nef .@E%@@eAeP~̕dttttt@E4ttt t 44tttt @ pmH Hm_w j@5 A A r5u-_ 5 D&   BC-eD-2/DN& j  B5@-5eD-f @eE5eZ 5r5AAm 5r5  #  -E ?% F& ߚ B C-wH? B-up`WpAmDN& j 5Ff  AWpaA- : 452F N B5F@eE5 ! F /  -: ?%  5 - ?% F& ߌ B u-_  j5jF w >DCv9~65.̥d+5˥d(˥d", , ,, w=5f& 5%Vp@w ^=N BN Bae%_ R   nF .@ N B w =N B @a/// N&e B w  S B e ,˥ ˥ ҕ? ˋ w;Ғw p;DX p-%wb;w N;D v e@ f& 2ef&] ew;w ;D 56_c_" jfe p-%F t56o vfe p-%&&  f{fe8 p-e̥b̥cE&fe p-e̥s& &&fe ee #0NHlQUR0R00567-7- 7-7-N6ef6efex p-e N6efex p-%  Nexfefe8fefe& p-ewT9w @9D p%@w49CeA @@"e   `= w 8 AEWpCeK-_P_Pe w8N K&e ,%w 8AEWpCeK-__e w\8N :K&e ,%w $8D78 5  XB 5  XB  XB 5  XB  XB 5  XB  XB 5  XB  XB 5  XB  XB   @w87w 7DC   u_ʋ_ʥn oe5  a d> sa u_w6 %   _U_ _U_  %   _ _  5 %   _U_ _U_ %   _ _U_ _  _U_* % : %   _ _U_ _  _U_D %  T % _D  _ _j %   _ VUS P  KUHx %  %   /U, () %      % _D   Ufe  _ _Hw 4DC w 4  5@5 @- 2@w 3D ^ 3! vw3w 3Vw-LF @m7<ȥ- 2.> - 7&%:f - ( Rf  R  R  R  ?w2 ̥:7 *+ ~w-xr jRf  RN @m7b@ :R 9 E5 @@l w*w 62DC E5<E@e33. @;E  5 , @;% & fE B 5  2DU3 3  w1w p1Nt@f FGewd1w P1 X  1 7D> Bw:1w &1 .( D7 w 1w 1DC  ̋̋w0w 0  1 7 ET B/%7 :&  7:&   D7^:&   &  ^ %,&  ̋ VwJ0(w/w 00DCB Ԥ@w"0 w 0    L  w/  5 ff L% 50  8 w /  uN B5&f %5wz/ \5  Nf pB P 0   w "/ p  @e5ff l%5w. 5  w-   4 w .  B  &  1%7pwz.v pBj&59f 1 72 w 0. w6.w ". t  w$.w w .  (37   D7 w-w -ww-w -  @ E w- /5% % B/%   -;  7N>&  7@A&   D7(D&   D7G&  7J&   7wM&   7wP&  7S&  7V&  7_Pw ,t >  w,  x7 rR 7H 855 ff( e55 > D& 8@%e& 8@%e& 8@%e& 8@%e7w z+  _@Yv pB_f_e5 & f A%5=* 5u fff HBe5 #u 1f B%50 :=N Dw*w *D      + - ̥9 Wp @@`e̥0  wj*w R*D5 5      + -! ̥9 f& ff !eee@ ee@ 5u̥0 A@  w)A@w6):w,)w )Ffef 6J%5 w) w z)%Vww t7WpwAwpAmu% Nf ! @mj5uBmRB-"C-Dm<5TD-um@5@- w( ӁNf mu-Bm B-т̒C-Lw X( @@5@ @  vwpzAmDu-p6B Z@F5 8 N C! 5ԒS DCUC-f m5D-/+D-!Cm@5&@5%3-f ! 5u0B55^Z5R DD-N& 2m*-&N& ! -_!w&w &N B 5 LG5 w&Nff 8@%@w r&D Lԋwj&w V&N ' #wT&w @&D el&&&&Wpef WpexfH p-eHw&w %5 5  AaAE f&A@vUU5u %w%w %D w%̥/ 55 B&f  e %Nfe B *fe XB fe XB ԥ.̋De & + & A %fe0 B% D %,@e05e $wNe$ $wNe( $w%r_d$ _d$% _d$%2_d$WpfWpeme, _d$@e\5 N $f&thje -r @ E30$ -V *te%5.N $f&@.e@.A Ep@.A Ep - s% -3% 0$_d$ - t-%_d$ -%77te%5  e%7܃ -p _h$@e%7w " Nefe +w"7 ,AWp@7` Z7 \ f 4, % B %7H7B w "7 7 "7 7 ,% B %77wb"w N"v0 ,̋  N$  N$  2  w "w " 2 @55 V w-Tw-L  t % -.  t5,h 5,j - /$ue%&&fe Xe3 e%pe%3wV!w B!& f e37w.!w ! (&Q@f& pe5uQ@f& e5uumumu _`)eeQu  %QQ eu % ff et ff e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ;ttw!ww h fe +@wZ @pHA@tww " ,!,& -   w 1&@& ,%7[˕,@&Nf 4, w D < !     +  we% - r<N r<&@&@& p-e@& ~ ~w  Nef - ww D 5  =& -% `5ȥ=  = @we  w  BuNefef 6J%=@@wXЋ Ћ  Jҋ~ @@w D D4 4  Hww  f A %  DP LG4 4 ww D 4-&4-!4 4   &e & B%4    wPme   s lt  &w~W f r @  W f r@  @ &  4  b '     ` TW ~  s`K6!  w 0D85U5_05P_0 0 m&@e4 ,5Ne & G  uN LG4USt%:5F 2D5R 2D5& & B% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff A%ށ̥a &  HBe 3     U̥r 33w 4$ LG w5 4@E%@EU5N&e B &e XB Nf&e A%4 IN&e B &e XB Nf&e A%  (Ne& G  ff eee@ 4t@t"4 4t D H_2w N D@ DN Hww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  : ve@ 4tw"w D55ff %f&& "eff&e e &e < 55 wwr&w5 5 w D5#P5ff T %f&& eff&e *ew6&e f>'44  && ef&& HBe&e & rI%%U w D5_:6o5ff %f&& eff&e Ze L&e f>8f f ff&e V e 744  && ef&& HBe&e & rI%%UUw @@m e%fe F  &e < 55 3ff `%f&e@ &50c &e < 55 3"R @ U44  && ef&& HBe&e & rI%%&_&6fffffe e _&6&e % _j6_&6e_j6  mm@ e@ f& ef&& HBefe& rI%%_&6 $;_d5w @0 0 @0 N 87f7bv&ww D85_*9Ne& Gq fe Ve4-4-/44  &&  ef&& HBe&e & B%%&e F &e < 55 ew~wzz&w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  : ve@ 4t4-4-/44  && ef&& HBe&e & B%%&e F ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& HBe&e$& B%%&e$ F `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& HBe&e$& B%%&e$ F `Btp$t t"  ff Nef&& HBe&e$& rI%%Uw w r D5#5 5 ww~&wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& ?% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm 8@% a@ `` e w D a@@m e  w e  aAm HN@`@m &f 8@%  aN f`f 8@%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef 6J% 2DU4 4  fef 6J%5 w    6v&  @ppC`p   6@Cwzwtw D 2D & & HBe 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _D5uNfe & rI% _DbNe & G  uN LG)U5| m- 5 & rI%St%F  G U   & rI% S U _B @_Bw DE%%"5   & rI% U wv w ^D55@ 2D  D 3 H 4 4 4 4 4 ww~w  $:5+ &5e-fe %* & D    F ww  5f F 7 f F 7wX@ m7:%*e w       F e-ww D |:5 e %*wX  5 e->w D Fww  N xIww rDCDpC LG F wZw FN HwJ ~5 & E        ~5>wlYwfw Net@f FGe  w6w.w  F&U78&U7.&,&$Ae vB7   % 55 a  a!PE -%& w$ LI `e vWt vw@ `e @  LI%ple U?ZZ `e 7H&U?<ޔ a7. &(? U ew dDE wZw FD5 H 5N LG!w5A vBB-  }ee@ !ۃ `!ւ ` `Xmֽ& E%Ƚm½%w w7Z*'$!     J 7@& A0& BF7!W-M7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu2Bw* J@B |_L@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& B z   5 , @ :% & f E B  (˥-%0     ,:% &  B 8 5E& z   5 , @ :% & f E B  wr-w-@sS@x- r-w-sSx-r-w-tTx- 08@PX`.1ACLFRacdfgiloqrstuusage: ls [ -1ACLFRacdfgiloqrstu ] [ file ] ls: out of memory %s: total %ld ...%s unreadable ls: out of memory %s not found -ls: filename too long ls: out of memory %s%s%s -> %6u %4ld %-9.9s%-9u%-9.9s%-9u%-*s -%3d,%4d%8ld%8ld %-7.7s %-4.4s %-12.12s %3d %s%s%s%s%suappnd,uchg,nodump,sappnd,arch,schg, ,archarcharchivedarchiveddumpdumpsappndsappndsappendsappendschgschgschangeschangesimmutablesimmutableuappnduappnduappenduappenduchguchguchangeuchangeuimmutableuimmutable: illegal option -- : option requires an argument -- /etc/grouprr/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwdSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired &&&.KdKo KxKfKeJgKcKsJlJL6Ku:KDKO$KXLKU0aIl >R0R00 n t e7cce7  / 2  7%  &w ` D e  & : . e   & :  e  @%@ a  %n @ a& !E%@  @ a a& < P @  & N   &w w p  \45 H @n f E%@ N` : w( n f &E%@/f  5u Nfs Fe Nf %  N  f N  ww r Bfef %5 w^ w F D Lԋw> 9w!ww  De LN V4eze   V4e} Be v Nfe %ww -@ wN F% w f BuNefef %=@@w:  Ћ Ћ &w|ywvw D5"E@e44fef % U4 4  fef %5 w  ы A@Ћ w FD:5UE5Hw* _5uNfe & * % _bNe &   uN  )U5| m- 5 & * %St%B   U   & * % S U _ @_w DE%%"5   & * % U wv w ^D55@    3 H 4 4 4 4 4 ww~w  $65+  &5e-e %& &     : ww  5f : 7 f : 7wX@ m`7^6T%& e w  > 0    : e-ww D 65 e %& w  5 e-w N ww  N 0 ww rDCDpC   v wZw FN H wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w   U7 U7  Ae vB7   % 55 a  a!PE -N%  w$   `e vWt vw@ `e @   %e U? `e 7 U? a7 ?U ew dDE wZw FD5 H  5N  !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E% m%w w7n*'$!      7& At& BF7!VW-7Bw 8uDAB %u f& & e w5 5  W- W00~u5  .lu. Bw* J@B |_ @  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& f z   5 , @ :% & f E f  (˥-%0     ,:% &  f 8 5E& z   5 , @ :% & f E f  w@(#)ln.c 4.6 11/15/85-f-s.Usage: ln [ -s ]0fIl >R0R00 f1 or: ln [ -s ] f1 f2 ln [ -s ] f1 ... fn d2 %s is a directory %s/%s: Unknown error: %d8@Jdt&2HT`r.;Q`l+Jk #BRi6Xm  6Xj|#RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator d o x f e gp c| s l L u D O X U0jJl 1R0R00 +z= e7cce7: /   7%  #w "' $B:T:@78:72:% &: < 4:w'@e7:5@ r yfw|wl99e9Ud 9 9UT R9U<   b  U  E   U      U   U _  U@|_w %5n B88$88%88  788  8  78 8v  v8 r7n8h8Wpezw`8w0%w %%V8 wJ8w%w %  w%w $5  %8 ( * w$w $5 p  X  r \w$w $5AJ 45 :  (wt$w `$5 N  wP$w <$ w@$w ,$  #w*$w $N  % N  N  $=   N&  w#w #Nf  w#w #6Wp Dz 7 6w#w #D  ~e-6 6%z67 6 6w`#w L#5    8%5!*Z65 :: :% <6%46,6(6 r7 6z6A r  z5x @ff :%u5 5 uoe % 58 @ff :%N b u]C -D̋)5& X 3 "3#3%E vm&@ 3s 3( 3*3,e@@Ee  5 5z zw!Uf V* w !  5D 0 @  5zf %N p"5 x: :%j46F zT4u&   "# (* v@4% &,5  b @&& :%5 55 ue %}5B @&& :%zCe 55 = e % e@ A r  V w0 w  zF3 %%u 5 z   3ww z2 &%%  | 2ww w2  f ef&2 e  wxw dC2 %     f& 4ef&\2 e:H2 %82   ef&"2 e  ww   ww 5`v6K 0B %n h b ^B %  H%  8 2 .B %  wV%y   B % Z:f %5@ w 1 Z:  w 00e0Z:  w Z: # X  Z:@.ԋ /ԕ/Ne&  2  P5 wRw >Z:  w8w $:Z:  N0E %@ @%I5 z E 5e- 0D /e-/  za  #-/7/Z: X /U4//// / /wdz:  Z:z:ҢӋ5 7- /7-|/r  ݁w D@&& :% && :%&e"&e" :%ww  z5 Z:  %.Z:.Ԥ ˋ̥̋/  e-.܆ %..  e. .%z.wZw Fd  N w>w * z J5F  @  ee@ f& eu. BBm-- vCEtWtEAZ*@0 t ze-- ww l z 5 e-~-_E  Z:    Z:  5Z:   & & eBzf %% j  & & eBzf %  . zf %  N p"_ w`w LZ:  wJw 6Z*%Z:`,z 5    ze~w w D & & eu & & ev 5um-+ NAEt5A vEu@Z*5 @pZ* u-ۂw\w H*  wHw 4  5 Wp z -F+ 558+ ,+-&+9  EtWtEAZ*@0 78+5r ~NfH %5PN^  0oJl 1R0R00*h  ww n5 g@Be 5x-5w-5r-u 5s5s@ f&@&@&@&r HeNe    e Z:  ww ~D  ox  i Z: Z:  Z:   & & eC  z &%%  & & eC z &% Z:   p" p"E&EZ: %wwww |Nfef '%5 Fwh w PD LԋwHw 4DCB 5S 5t05S5S5S5S5S5S5S5S ΀ww N  ww D el&&&&Wpef Wpef4: fe:wFw 25 5  AaAE f&A@vUU5u %ww D \w̥/ 55f  &f J e %Nfe  tfe  fe  ԥ.̋De &  &  %fe0 % p" %,@e05e <w&Ne$ <wx&Ne( <wj&%r`&_ X&_% L&_%2_8&Wpf,&Wpem&&e, _@e\5 N <f&t;;e -% @ E3@ -% *teHB5.N <f&@.e@.A Ep@.A Ep -j% sB -V%3B F%@_ -6% t-*%NB_ -%B77teHB5  eB7 -$ _@eB7w * Nefe w7 $AWp@7+ +7 + f * B  B7\7V w 7 V$7 +7 +7 +vB  B7*7$ww +z ̋      2  wdw P + @55 # w-#w-#  t LB -#  t5,; 5,; -t# @ueHB&&fe Xe3 eBpeB3ww & f e}wrw ^ BQ@f& e5uQ@f& @e5uumumu _eeQu  %QQ eu % ff let ff e5u< ff 4et< ff neL A@e@ f& Let e  =  r  rd > r 8 8 rd ( A0 5 8u 4  A0 f&A@ 5u r  r   A0 @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw !w2 tw, w  !,&    w 1&B %7 (˕,BNf * w D D  !     +  w e% - r<N r<&@&5B feB ~ ~w Nef  w w v D 5  =& % `5ȥ=  = @w( e  w  BuNefef '%=@@w Ћ Ћ  Jҋ~ @@w D p"4 4  &wr w ^  f  %  p"P $4 4 w2 w  D 4-&4-!4 4   &e & %4    w me   s lt  &w ww v D85U5_25P_2  m@e4 ,5Ne & $  uN $4USt%B5N !5Z !5& & % 45@e-4  % U5EU  wHE    6v&  @ppC`p   6@Cww7 Ћ PPЋ w FD:5UE5Hw* _!5uNfe & &% _!bNe & $  uN $)U5| m- 5 & &%St%N  $ U   & &% S U _P @_T w DE%%"5   & &% U wv w ^D55@ !  p" 3 & 4 4 4 4 4 ww~w  $B5+ R &5e- 4e %2 & `    # ww  5f # 7"  f # 7wX@ m7B%2e w       # e-ww D B5 e %2wt  5 e-Zw " #ww  N &ww rDCDpC $ 8$ wZw FN &wJ ~5 & E        ~5>wlYwfw Net@f $e  w6w.w  b2CU7T0CU7J2CH0C@Ae vB,7 .  $% 55 a  a!PE -%0C w$ & `e vWt vw@ `e @  &%e U?vv `e 7d0CU?X a7J BD?<8U ew dDE wZw FD5 & 5N $!w5A vBB-  }ee@ !ۃ `!ւ ` `tmd& E%V޷mPއ%w w7*'$!      7& A& BF7!W-p+7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu:Bw* J@B |_|)@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& ( z   5 , @ :% & f E (  (˥-%0     ,:% &  ( 8 5E& z   5 , @ :% & f E (  w@(#)tp0.c 4.1 12/18/82/dev/rmt0/dev/tapx/usr/mdec/mboot/usr/mdec/tboot@(#)tp1.c 4.2 6/28/84  8RjTape open error Bad usage mode uid gid tapa size date time name End Pathname too long - %s File ignored Out of core @(#)tp2.c 4.1 12/18/82Directory checksum Warning: swabbing required Warning: cannot read prototype boot block. Tape read error Tape write error Tape seek error %c %s .%s -- Cannot open file Directory overflow @(#)tp3.c 4.1 12/18/82%s not found Can't open %s %s -- Phase error Tape overflow Tape overflow %4d entries %4d used %4d free %4d last %s%4d%4d%5d%9D %2d/%2d/%2d %2d:%2d %s %s -- create error %s -- write error SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecTXmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT,h  !%)- 1TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02dC)sh(lh(L(u(D(O(X(U0yKlSxz|~R0TR0T0 I % e7cce7- / 5  7%  Aw $E 1% B7 B7 B7 \7 %f \7 f \7 % A ,  &  - B/ & , @mʥ-#L & %V, & B, <,epn- D-&, ,.n-, ,3n-, ,<n-@e5 b+NK 5 7 +Beʥ- J D-Nf   AwxC!`A 9_D xB D-P & we * `ȋ D-Z & Ne % %`ȥe8r D-p & Ne v457 t* & w^* `5`ȕ-` J `H_ * * * * * * ) ) ) ) ) ) )_R )_R * & ) )d ) ) d) 5% 7)7)))_R )~)) )%t P~ 4! %) L)d ,) p) df) 5%7 ()T) L)%F)  5   & ()_R` 5   & _Rw A :  :@ E x0 ( D 5e N Aw@w @ (7 P(7 x( N @e5 _Be (, 5 ʥ-M LM YR Z^ e3 l5 o- u* `ȋ3` DN v45'& v3''& v3 e'w-'낄 e `ȕ-` h D- w? #7 ' :'1 5p'T' p'H'`' #`':'V' P'w V?A rWp&DA r v a@ w:?w &?Df& `#%5 &&I 5 @  x& & te& r@w>M &  ff %  :%5`u`u eD55  ffL& =efe6& =%A@e@ 5`u`u & ff 5eu7 P& ff% =efe% =% W- N B7 & N&% =% % R,fff e $e %% D R_H D7 @_ &  #5`u`u ff % _w = ff$ =e$ .*  er w< @mAm@ e<@ f& Xe >pHe. V$ 5 w <8u eeH@ 5u _ %@@Dt@ae5 ff# =et5fe# =%@- & 5A 5`u`u Ce # m#fe 8$eC-솣@mAm@ e@ f& "e fe %Ne %5%N 5uvN- - AE@`e 5  %C-, ,e-h w:w :DAWpCe !   f& 2ef&f "e   B-wt:w `:"ff X% 2&m$ wH: & !!m!!m!!5 $5 ! :B E% & T 8' @mAm@ f& "eT 1@mAm@ 5u fff! =efeP! =%5 W- N B5 Nf! =% _H R,_H_Rfe !% @5 E5%_H%_H  @@me&t 8A@@mAm@ f& "e t %www5   L\_He$u _Hd J K L  "> #? $@ 4!,  % iT 5uvN- - DE`e N 7-"F" /?mtmnmh "",  " E %V 4!U "!& &&   5e _R N D  D7  -, )%7: )%7H )%7|wmxwmtw n_8 w8_6 w 6   0@ @ ee%wV6w B67 7 7 U %7\ %7c %7 4 1    5u-#vN- - AE@`e  "-J-B-: X7 ` P  7R7R7D7D5 0~KlSxz|~R0TR0T0 @ ._"4 (%#$ (%$ (%  8A@vN- - DE`e 5"@ E5t"% U hff )%5  5u-b ^  RA@vN- - DE`e ,!&$&" && u 5e !#" 4"$"U e "&$!&&  5e  5u-  e?E?7 _ T!w fN 5 5  6A@vN- - DE`e !" md$U !&$&  5e N 5u-5 @ A Afe?E?pf@ -f@ 7f %  5 m T!u bN 5 wz \N T!wh P7 ^ZmF5@m7L5   LA@vN- - DE`e  / x U    "---  - 5  9 5%  5u-h t d7 z7 x?fh )%7^$& XR J)ew w1mH"U m<"m6"$ tm"w H1%9N 5uvN- - CEae  "" L 5e]& & s s"U w0w 0 V- '  b8X- 'R B^- ' 4Z- ' \- ' P`- '    7  % & U  Wt mm@ 7ww%T0N 5uvN- - AE@`e " & & !"U7H7 B  74$T 0e   d 0ew/w /Df& `#%  x̋ D-/  |!& r% r@w.<# ~ =er .* |! bl@ e<@ f& %e%%ew J.ff B%mm T ~ @mAm@ f& "eT 1@mAm@ 5u ff =efe =%5 W- N B5 Nfb =% _V R,_V_` fe !%  @@me&t 8A@@mAm@ f& "e t %w ww E F G G "9 #: $; :!6 V_V B_V :L_V% f^N$t 0e_Vmhm`m XR5 E5%_V%_V5  5% & "%- & seKN 5uvN- - AE@`e 7 7-"!!%7-$!t   5% "b&$!& 5e;& & _  N D  D7 %%0 @mAm@ f&& "eT  @mAm@ f& "et p`H ~ePT  @mAm@ f&& "e*T  @mAm@ f& "e ~emmmw*w )R _ ~ "jed t l L &  T R " @6e0E  xm<5CN v3 N & v3 򫁪 򳀷 mmf ) 5N 5uvN- - AE@`e EAmWt@`el"E @`ew(w (D _ 7]? b( Aa1 -h  @A@vN- - AE@`e !'" #$e5_ ! @a5fe 0ee  5u-  e& v3l& v3 5?  (v ( >j (d ( ,_X- ' 7 5 h2 ?* =L 5ULD?uut >5%  ft 0e& 1 A 5`u`u fe 0e $t 4e%j @  ZA@vN- - AE@`e " !uu >5%   f 0e & 1 A 5`u`u  fe 0e  5u-X  fe 0ev (l ?d =\ T 4et7B8 =0 T 0e @ tn 4z &  m @ 5u T!5u5  T!@mAm@ @mAm@  3/W ,. l h T!@mAm@  W %%A@m, @  W 4  Nn <%  w0$w $u5 A@e@ Ew$w #   ft 8%  $t 0ew#w #DAWpBeC  N& <% ` ``N "~wf#w R# AWpDe& ff eC AA @@ % & & ef& =e &  =%55 t4 ` % % @ E4 4 w"w "AWpDe &  f& Fef&f "e     & ew$"w ">w 7"-  l  e $  = 7 %f & w!Ne B 4<DL& & "e  &  fe !%5fe =    =e .*  =w-w-w  _$- n-  -w Ԕˋԕ/ԕlԕiԕbCԔˋԕ.ԕaN- = 5%-Hw b 5 5 t % ˋ<umAE rD e%= 5uvN- - AE@`e 5 t f 9% e%t Ղ f&A@vee@ 5uww  ft 8% 7 ww z %w% & @ 5 vu@E5@ utpP 5u7d= A@vN- - DE`e  t & 8% "" ! V"!&&   5eU ww w r  Z >) 5 60- 5 % Z0 5 5 5N8 5 %  ww 0ff& "e T !%%< & 5 5 5 zr 7Zj7Tww z 5f =% M` &  :u& h5 =w"w N %%N x 5% &  5uvN- - AE@`e "ww D ? =>l@ Ȑ6 \V5%J D@,@% (@ EE&E *>    V:% @ww CBtE  e e  & ww  & v3 ef5?`ww A Am@ 5u% %N & @wVw B<.f =%%<_+.fe: 9% _+ fefe <%5 & fe @6%7wfefe <%5 & fe @6%wfefe" <%5 & fe @6%w|fefe( <%5& fe @6%wN fefe0 <%5 & fe @6%7w wf ;% $Ne v47 %?f =%!4 7w 7 f <% ʥ  w \lmbE mVmT@ 5ue<u A@w2w AWpDe  B4   % & ww  f A 7 wR.77R.v0<4 4 4 e AWp mF! w X epw j@p-  0 %R.t-t-w%R. 0 5 D& .&n ellu  ff =e   W   w&e  % w D&e :B  /ww D   0ww D  , 0w~w jDU wlw X2 5 D& . %R.wBw .D >fe > Ne <8Ne : f =%%4 4 ww D `3! 3 3 E %R. r@ww D0<PR.07 %;  7  & <%bb& ӄ *> % ₎& <%`@ @m A R&@w    9 E5 @@l wp %w6w DCB 5Ԑ @ww D 25u5mu A@wnw ZD 25u5 A@w>w *De m@ e@ 5u%% du %e u 5mu A@ww D F25u5 A@ww D%%055  m@ 5u%% e du %umumu 5umumu A@ww DCe!%  -#<%   &  *> 5  w ׀5E&w zDCe!%  -#<%   &  *> 5  w& ׀5E&w D      + - ̥9 Wp @@`e̥0  www DC AupB 4  & <%b V:5% 傎& <%`@ @m A l&@w&  w D   7 -  s 3  33 a r w w+& f =ew xbfef E%5 Twd w LD LԋwDw 0DC %U5 ̥+̥- %$ ! ̥0 ̥X̥x % ̥0 ̥X̥x 5 5 %U0Ue e  ff Zeee@ 5u %U = A@  w2A@w u@t5X.5Z.@ 5.Nefef :% (3A@u5BtrZ.2X.@ Aup. fef :% u-u-u-@wp  ~ ~w 4 Nef 8@w( w   f 8@w w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef 9,5@ 'NeR 9 %ʕ/  f =% %p%` w0 Nef 9ҕaʋʥzUʕa Jҋ~ @@&w8 W f r @  W f r@  @ < w mn*:lw e& 7 7gw w  D85U5_;5P_;  m@e4 ,5Ne & B  uN B4USt%V5^b ?5Zn ?5& & =% 45@e-4  % U5EU  w E   R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef E% ?U4 4  fef E%5 wN    6v&  @ppC`pwbw\w D ? & & =e 4E05Ew7  ы A@PЋ w FD:5UE5Hw* _?5uNfe & D% _?bNe & B  uN B)U5| m- 5 & D%St%b * B U   & D% S U _R> @_V>w DE%%"5   & D% U wv w ^D55@ ?  r@ 3 D 4 4 4 4 4 ww~w  $V5+  &5e-e %F & ^    A ww  5f A 7  f A 7"wX@ m7V%F e w       A e-ww D V5 e %F wr  5 e-Xw @ Aww  N Dww rDCDpC B :B wZw FN DwJ ~5 & E        ~5>wlYwfw Net@f Be  w6w.w  `2/U7R0/U7H2/F0/>Ae vB*7 ,  "% 55 a  a!PE -%0/ w$ D `e vWt vw@ `e @  D%e U?tt `e 7b0/U?V a7H @B?:6U ew dDE wZw FD5 D 5N B!w5A vBB-  }ee@ !ۃ `!ւ ` `rmv& E%hķmbć%w w7*'$!      7& A& BF7!W-rI7w 8uDAB %u f& & e w5 5  W- W00~u5  .luN Bw* J@B |_~G@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& *> z   5 , @ :% & f E *>  (˥-%0     ,:% &  *> 8 5E& z   5 , @ :% & f E *>  w /tmp/ldaXXXXXovhndlr1 DDDDDDDDDD DVDDDDDDD^DDDDDDDDD6^DDD<DDD0,DH&B^ND*D<F @FLl.outvminit failedvmopen failed-L: pathname missing-L: too many directories/lib/usr/lib/usr/local/lib%s: -o where?-u or -c: arg missing-D: arg missing-D: too small-Y: Not in overlayoverlay %d size %d overlay %d size %d ld:too many overlays, max is %d ld:bad flag %c l.outld: nswaps: %ld, nmapsegs: %ld sbrk(0): %u %s: end overlay generation %s warning: archive has no table of contents; add one using ranlib(1)warning: table of contents for archive is out of date; rerun ranlib(1) %s EOF in ldrandno namelistNo relocation bits%.*s type 0%o in overlay %u at %u text overflowdata overflowbss overflow_etext_edata_endbss overflow%.*s n_type %o n_value %o sovalue %o ovly %d relocating %.*s in overlay %d from %o to %o overlay base is %u. %.*s at %u overlay %d max overlay size is %u overlays end before %u. Undefined: %.*s bss overflow%.*s: n_value %oattempt to redefine loader-defined symbol-n or -i must be used with overlaysentry point not in textentry point in overlayinternal error: symbol not foundLocal symbol overflow%.*s: ovly %d sovalue %o new %o hav %o multiply definedrelocation error0123456789abcdefl.outa.outcannot move l.out to a.outa.outld: too big for type %o premature EOF#1cannot openpremature EOF#2! __.SYMDEFsymbol table overflowfound %.*s in overlay %d at %u ld:%s(%s): %s bad magic numbercannot create tempcannot create outputr+%.*s: undefinedlocal symbol botch` ` #1/#1/#1/No memory for stringsvmmapseg: bad segnoToo many locked segs!write swap, v=%d fd=%d can't read swap filevmlock: overflowvmlock: underflow/tmp/vmXXXXXX%s . ((((( AAAAAABBBBBB / - 7 %:f  ( Vf z VI z V B V B ?w| ̥:7 d*+\V Lw-F^@ 8Vf z V_ @m7H 8 9 E5 @@l wzw DC E5<E@e33. @;E  5 , @;% & fE  5  x U3 3  w Ww~ w Jfef |%5 w XwL w DLw ԋ w D Lԋw w De LN 4ee 2  4e Be v Nfe `%w w  -@ w N~ d%~ w  BuNefef |%=@@wЋ Ћ w x@5-E@BepNff |%5N x @U@0 @0 =  Nff |%5@5 w@ywZw D5"E@e44fef |% x U4 4  fef |%5 wn Ћ w FD:5UE5Hw* _^ 5uNfe & % _^ bNe & N   uN )U5| m- 5 & %St%J H Z U   & % S U _ @_ w DE%%"5   & % U wv w ^D55@ x   < 3 4 4 4 4 4 ww~w  \$>5+  &5e-0e %. &     ww  5f 7 f 7@wX@ m7>%. e w   v    e-Zww D F>5 e %. w"  5 e-w  T ww  N ww rDCDpC   wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w   U7 U7  Ae vB7   % 55 a  a!PE -%  w$  `e vWt vwb@ `e @  %:6e U?$$ `e 7 U? a7 ?U ew dDE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `"m& E%m%w w7*'$!      7& A& BF7!W-<7w 8uDAB %u f& & e w5 5  W- W00LlfhjlnR0OR0O00~u5  .lu6 Bw* J@B |_H@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   wsusage: hostname [-s] [hostname] sethostnamegethostname%s H: illegal option -- : option requires an argument -- : Unknown error: %d@HRl| .:P\hz6CYht"3Rs+JZq>`u(>`r+RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator tdZofx$f2e$gc s4l4L|uD^OjXU0Ml  $PRTVXR0R00   e7cce7  / 6  7%  >w x 32e@ȥ-*b C x0 | x7  h ^ P L J B e  > ,2D'  >  2P,T   ̥\*̋%   ̋ N  w  ΁eN ̥[̥̋]ӕ[eӕ] n  >w,w  B5 @e5 55ʥ^  ӕ    [D \_<ӕ% 냄%*  ӕӕ w $  * .ӕ  ʋӕ e% ӕ5%^ %-B-ʥ] t`EH( ! t`EH(%]5 Nmx %e__%<_%>ӕ_%( _} ӕS_%)@e@-_ӕ S _%1_ %9_ 1D-_ӕ_w   f @% N 7 7 7 7 < ߐ D%9  &   ˥œ & ԋ & ԋ l N 6ePw J  % % 2 %. N > ( "  Te ww DC_ x`_ wԋ_̋_E5@t`AEA(@0e_ 0 _ 0_ 5   @5&f % Dm_ 5   @5DmN&f % & D ԋԢ E5@t`AEA(@0e `˥L& _2 _& _2 _% 8 ̥_______̥___ _   w  R e w I N >  &  * e0%h  N > D R  > 4 &  ne  >  w w D @ A H w w Nf % >w w DC+ 5 f a  r5 w: wT U5ff R%̥a &  ^e 3     U̥r 33w DE5_ % _2 _2 5`uu '& & ^e5u%%w  @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & ^e5u %%    %%%_ 5 5 5 E4N ff & ^e W _ %_$ %_$ _ w  fef %5 hwr w Z D LԋwR w > De LN n4eej  n4e Be v Nfe ~ %w w -@  w N2 > %2w BuNefef %=@@wZ yww @ D85U5_ 5P_  m@e4 ,5Ne &   uN 4USt% 5 5 5& & X% 45@e-4  % U5EU  wE w D5"E@e44fef % U4 4  fef %5 w ww7 Ћ w FD:5UE5Hw* _5uNfe & B% _bNe &   uN )U5| m- 5 & B%St% 0  U   & B% S U0Ml $PRTVXR0R00 _ @_w DE%%"5   & B% U wv w ^D55@    3 ` 4 4 4 4 4 ww~w  $ 5+ B &5e-Z$e % & 8    R ww  5f R 7 f R 7(wX@ m7 % e w       R e-ww D p 5 e % wL  5 e-2w f ww  N Hww rDCDpC   wZw FN `wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  :`U7,^U7"` ^Ae vB7   % 55 a  a!PE -%^ w$  `e vWt vw@ `e @  %d`e U?NN `e 7<^U?0 a7" ?U ew dDE wZw FD5 ` 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `Lm|& E%nmh%w w7*'$!      7& A& BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& ~ z   5 , @ :% & f E ~  (˥-%0     ,:% &  ~ 8 5E& z   5 , @ :% & f E ~  w@(#)grep.c 4.6 (Berkeley) 5/14/84 @||f"8&((*2r(((~grep: unknown flag grep: argument too long grep: RE error r%s:%D grep RE botch %s %s:%u:%ld:%s : Unknown error: %d(:L\hz )=Qp8Vu6T&?Yu-:Nbu8KdRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB FjjdoxfegcslLu DOXU0Nls $:<>@BR0R00 #  e7cce7  / d  7%  w L"   7  7t  5    e q @ȥ- 7 `    Le %% Dv0  7x 7 05L   5x   V   H w@!w ,!27 rZ7\7V_ 7P %;,76%,  0,( r yB  f f 7 7   p e 7 @ e    . 7 ( &  n _N  n   4  f ` TVNe7L   t : %a%z& p  H  Ep@ UZ _ _ e7  "    -7 _7    h  n    7 d  T7 n-\V N* f _ H_   T n    7%&  e W    7  7 6  e-_-_7 _ v v E7x r N ._ _w& _ _& _  _8 _ _d _< _ _v _H _ _    _ _ _ _ _  _ _ _  (  ZE-& B>6_ _F _ _^ _ _ _Z __w   1%945 AWp ue5` L%0%9  @ 5@ `  | %05    r yR -><& -*& %/e-  &  ~%a%z&   Ep @ e- `--&     /n  wH _X  _N    :w  6*7,7&-$ & ww  e7- ww  & ww --& w~w j 0% %p%l  %l % & w>w *7 f7 d % %̋%f&  9% & % % &  % %& r% %e%f Ԕww t   | .w`w LL    . ^& w4w     -68.e7,&(  7" 7  ww 7 t7 ? .N 7 7 & & e7  7   4% %  V 2 wFw 2 XX7 PN pj f7:7 \7&wfe& % @E7w L% 7wE%J& ^% .4/ w nL  % 7wN~e ҵ 5%L :& e>w 8% #0 w Ne  5 "%@-4 & ew Ԕ -̆5 "%@-4 & wFw 25 w\NXP -,Be . R! 7$  w  @ 7`@ 7` 5 eee# J  @ww r       e@   Ne , %   ww  t  -7 &   ww  <   ww DCe 7 D-7 wbw N| e5ee7^ e7R7 L7Fw5w L f h DE  ef h  Lww  ZLf h E̔ԥ $Le E7`wb~ef h w 0DC E% <( 7`-!w]R L "p %7 47b& %ew-F 0Nlp $:<>@BR0R00 : " , %7"e w  A v f& ef %%( wPw <  %6 '7 7 7 n^   J  7x77w w  & & z% &  De%& %\ D% ԕ\Ԑ@e!& % ԕ zE-v -r &  @-Ue-Pd   w(5 E@e7. e-w    %& ̔e-L ?- e  wdw P 5|L& DU R     8h T7E  "e%6   f @ ` ` 7`e- & ww  P% % &  L & Ґ%L& %\ U%  U! 7B%g7 8 w w L2wԔ7 w  LL-5@E%& E5&%& %E%1e1@-@  @ & eL7%& LԔww DCBԔ%& w w  @ & L e f @ 5 `@ `7. a7e 4&    &7te      E He ʂ & w w DC !w w -w e  w LD@e5 X!ʋ__7 7 $%^ 4 5 _@e@-_ҕ _%)J@e@-_ҕ R_ !%* _ $P *> .8 [P \_ %(%v_l ҕҝ^ Z_%1 %6ҕe_ҕ% __ҕb \X TS 7x!Jҕ Jҕ %^ % :%- %]ҕ-   %Ґ % %]@pҕҐ%_7P7 L& w w 5@ 0 8 @ 0 B    -LԔ7 -rN 7 L V7x&  &  7\w Lԋ˥& ԋw DC  _R xV w ԋ̋7& % ` & %  08  0B 5 B & f ^@ B A @8 `5 B &  @ B A @8 `f ^ & @ B A @8 ԋԢ  & % ` -_& _  _& _w :DC 8 Ҥ  B w$ w D  w T@~ w   eD  he   e0 .ww D7  .̋ .w~w j>C  %H7 ԕ\ԕ % >%<ԕ-ԕԐ%j j j  "%% % ԕ\te0Ee0e,% % Ճ7ww@ w2&& e& & %ReR$ @  1   "@! @#E B Ew  "%wpww D Lԋwe& ;ewPw u@t5 5 @ 54 Nefef % (3A@u5Btr 2 @ Aup4  fef % u-u-u-@w$w  Nef @ww  f @w w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef ,5@ 'Ne  %ʕ/  f % %(% w Nef ҕaʋʥzʕa&w< w6mlw" e& 7 7gww l & f Hewdw  @A  v @A   6@Cwfw`7 wJw  N "ww ww  |v U7nt U7dv bt ZAe vBF7 H  >%8 55 a  a!PE -%t  w$ ! `e vWt vw@ `e @  !%e U? `e 7~t U?r a7d \^?VRU ew dD2E wZw FD5 4! 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%߷m߇%w w7*'$!     < 72& A"& BF7!W-"7@(#)ed.c 4.5.1.1 (Berkeley) 8/12/86TMPWRITE ERROR$F>d@,JRTj r/tmp/eXXXXXed.hupMEM?/bin/shsh-t!longjmp botch longjmp botch . ((((( AAAAAABBBBBB 0Ol . 468R0R00  ( e7cce7 /   7%  w N  %@-n @ eK2 @m& v @ !; ~E x t25rJd -dD ?V% 6 H D=< -<% ?.%  2&  T D-  Ł 52 2& 2 T  w8w $DC E5<E@e33. @;E  5 , @;% & fE T 5  U3 3  wvw bD LԋwZw FD:5UE5Hw* _5uNfe &  % _bNe &   uN )U5| m- 5 &  %St%2   U   &  % S U _| @_w DE%%"5   &  % U wv w ^D55@    3 6 4 4 4 4 4 ww~w  $&5+ \ &5e-`>e % & >    ( ww  5f ( 7 f ( 7wX@ m7&%e w       ( e-ww D v&5 e %wR  5 e-8w < ww  N  ww rDCDpC  d wZw FN 6wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  @<U72:U7(<&:Ae vB 7   % 55 a  a!PE -%: w$  `e vWt vw@ `e @  %jfe U?TT `e 7B:U?6 a7(  "?U ew dDE wZw FD5 6 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `Rm& E%m%w w7*'$!      7& Av& BF7!XW- 7D@(#)echo.c 4.2 (Berkeley) 5/27/85"FF0PlZ QSUWYR0R0ꢚ0 wD$ e7cce7h / b  7% " kw o6 7 7 BeDe@e ^ d0wnebD 5 %,  @77 m%@ 5 -xnDDC d ^ z5%, B 787 2e%@ e -@5  H C xdr d0 %  e5%  %@ _p 5 @e ֆ_ h_\_@  D@  5@7Bu@ 5@ pb 5%   A p @ p @ x_p xl 40_p&&* JPe7(1_p d0_p7"B_pHCB_p&. rP%7B_p&/0 P  & ,F $e& FQ & & FQL7A_p 4&& &3 8& ,F $e& FQ &4& ,F ^$e& FQ &&&&&5 Pe_B&&&& A&&&7_& _&_&_&_&__7^@_pF_H_E_G_&A_&& P_ L&+& L&& dQ_&&@& Q_& 4& ,F "e& K%& _& ,F "e&_F H _p& @_ & =_ & >_ & ?_ &;_ &B_ &C_ &D__f&&& JP_??&& hO__?&&!&&&#_ & P_ ' ( )&&&$ Qe_&H?&&&%w \h " r _L _R x" "} }w$h P _R  t_R !. . !  !  !  !/ / !0 0  = n!9 9 = T!: : < :!< ,!< !< !< !<  < I< I I_@Jn< J J_@R< - -_@6< (< v < h  < Z ; L 3G X  ,F' ((%7; $ < <_@3G X 407; K K_@ L L_@|>,F&.2G h'e7^; 2 2_@,F 2G 4W &.2G h'e7 ; n1 1_@B" N; ;_@B" 2 &  _@ # #_@ $ $_@ ! !_@ " "_@ & &_@ ' '_@ ( (_@ j) )_@: N _@9 2 _@9  _@ 9    _@ 5 5_@ 7 7_@ % %_@ 8 8_@89 4 4_@9 j9 \9 N8 @,F&' r &2G h'e78 _ _ *"7 :_RZ"~_R"t f _< _4 :7~8 : :_@6"<7 :7 :_R6"*7 ~:z:_R D D_@ xC C_@ bB B_@ L; ;_@ 6= =_@ ( (_@ ) )_@ ^ ^_@ $ $_@D'3G Z% @ @_@n9 D7 tu9 47g97*7 x"/88 _R' d0 _L,976 >"90FF *58 F 880F,F &fF h'e76 _2 _* '8"F 8g8 F8 F8\F88F x8%r8JF'?b8]FN"P80FF *7 6 >8  T> >_@ >? ?_@(_ 88F 7%7 F)( d0 " 5_P Z_"N9(P g%w _%G2 ,ğ( ,ğ"9 9  @ E d%  % w_w n_N"0PlF QSUWYR0R0ꢚ0wt_w `_N( Y% NS(NX( Y_%%M@t%^( Y @ - 1 2 4 9  :  < @) K2Gb( Y ,35,3#3 -3 ?3%  3 2 2(4h(C& 2C h wr^w ^^ 5N2GRG _n= _r7*9_r 9_r99Z'_F9 & L %_F%H_F@75 %  (4$ 7 44e2G5H74% e% 5_%_ 5= %_BtBm-_ Wpe "!_ Wpe "% "> @7H4% __ vWteuB@t`-N$Wpe "!Wpe "% "  @73% cdWpDe "_@&tBm-Wpe "!Wpe "% " @73% 45%%_ @7V3% @7r7@2G 70302G6e6w[@73%  8 34 0%H_3_  737 __  @ ȝ_5' @,@% @ E_E&E h _w [  @eH-wZ w Z wZw Z < 6@ H5$5& @,@x% @ EE&fE h wXZw DZwz1% t1 j1 w4Zw ZN& & & = $;e&B ;e&A rP%5 f rP%57 = = p\Q9N  5N @wYw Y@ r y(@|=v= p=p\QwpY@ @ @p@4 '    @( 0%     @ @pw X@ r y(@ \L@ \L m@ 0 \L N m5 wpX@ @   '    @( 0%     @  w WD 5 # [N̋œ[N % P \N  %-% .\N 3\N N m5 \N *whWw TW( 0 wRWw >WD  r y(7 &; 0 \O -; Ne& \L % :  1\LwV A p\L\L * %    ( 0%      w VVD r y( %\O \O &:%>    w V        '     ) 0%       w bU @%/5@ ' ; A B C DN  @p-  N wU8 %\O8 \O 8w TD̋TwT w T   @m5-8  D-wTe@ %\O -l8= w ZT@  l55 }  %\Oe= -8@wTw T  @a 1 \OA\Op@Aa1 -7 @aAaXAXAp %7 75 V07. 9e @ap@@m@ 5\Q@=  x(@@` @`@V@aX V D-uVT5 5 _!%@` @`@V@aX V %@5@@a@@a@V@apX V %@ @` @`@V@aX V %5 5 5 @ \JA A\J @`- 6!@ t l5 @ @ap _ _ uuTV@ \J Ne@@m@@m@@m@ @ap@ 5\Q@=  x(@@`@`X @`X@V@aX V D-5 _ %@`@`X @`X@V@aX V %@5 @@a@@aX@@aX@V@apX V %@ @`@`X @`X@V@aX V %@@m5X@@a0X7 4  0 \O -4 e @a@a0 @a 5\Q@%L%@Ap %=%> @@& %?0@@& % @a \L e %\O @b \O :3 C- D-Nef\J % 0% 3  A 1\J @ @aAp @ @ap u-V_0_F  @ @aAp @ @ap}@0 t@a=@WtAap eD- u-_ 3 \J  \J m 0 \J @a5@pt@mWtAmA Aap  D-uu @@wM@t5` %  w rMDC % e5  t`Ӌ w0    k 7 ) Q )C g  k X kwK@ȥ-(B@e @%f@t/ȕ _h"/AH_h"@ȥ- 7 7$@=_"N) g8_h"N) g _h"N) g_h"f) d% _h"Ne dR _h")C g  k_h"w JwJw J%%M@t%wJw J,F&,  &, h'e,F&,  &, h'e,F&S, h'e7J.,F&- N &- h'ee7.,F& - $ & - h'ee7-,F&-  &- h'ee7-,F&-  &- h'ee7-,F&-  &- h'ee7r-,F&.$- h'ee7F-,F&.-- h'e7<-e7,-,F&.0- h'e7-e7-wHw Hd l53- 0 5 @ @m %2@wHw H@5H55 @ @m5) %.N m.@ %. m@.N m@5  %2 N m5 wHw G  ff ((%%.  N m5 wG l NN- 0%N * s53sN ( @m3  @mw PGD ̋ r2@wHG `w ,GD ( @m& g  ,wG  w FD F*-+j- 0 EU5%. 7 454wFw FD F*-*w- 0 EU5%. 7 45 %. m.EN *4w.Fw FD%S 64 d F*5 1  `43U44wEw EDd%S 3  F*5>5 %. m.4 & t4&-4&b)fe 9e Ne *4EUw"Ew ED5- 0%54&&&&- 0ewDw DD l- 0%  g  l- 0% g wxDw dD7 <27(_,X( ,eN( H(_,_, )6(= &(7F2?*(-<2C2*2 6f 7 22 0%' S# d*%2 | v@ Eb d% %ԕ Ԑ Fځ@@ E %x' %] S2 0%  %%S!J'E@'U@&2'pVp@E'UwB%C i7  &e& &_+ w Bu == ,F&f &f h'e5Nf ( wnBw ZBS]5 ^&5% a5 Y̥ Y̥ V̋_. %d S3 0%AWp 5(.AWp ".AWp %.".AWp N". mAWp .".AWp ".AWp (.̥ ̥ ̥ ̥̋  ̋O %d S-3 0%AWp 5(.AWp ".AWp %.".AWp N". mAWp .".AWp ".AWp (.̥ ̋Lԋ c6AWp 5(.AWp ".AWp %.".AWp N". mAWp .".AWp (.AWp .". u-wz8!AWp N". 1 AWp N". `AWp 1$.AWp U(. -t7l&& ,FS3 e& e 5 AWp N".fV3 Y% - w?w ? 76%-2SAWp e .N )Ԕ#4 5v#4l#%] Sf3 0%w4?w ?%d N3 0%AWp e .@w?w >`f3C geLw>w >3C g Nffff f ffC ge3C g"?" &3C ,6e  kw`>w L>wX>w D>D  wB> 5 ̥ ̥ ̥ ̥̋+̥- B̥.B B%&̥. B B   ̥e̥E3 ̥+̥- B5 B@%@%AWp @AA@`e%&_ 1 ̥ ̥ ̥ ̋_ 1_"1w = 2 Wp gWp%|gWpNg X % w} _>% e_>%@%@e,5*azl  @* *H=*@e@-* N( 5 0%@c E x4"@Ne,+5f c%N g5`_>"@l%@*ld* *=*@l5" ""5 " "  N(.5 0%N 25$5&@5%"N& :)5%" 5&fe,f %e 4%"5 &fe,f %e!%"5%"@& Q5N& )fe,f c%f&f$ T%N g5` _<=@w0w 0@5 255Nf & p< 5ff % 55@p@w)w)&iw0w 0N 255N :)5ff z%%@ 255N :)5ff B% ~55@   x:4NR5 0%5&55&f fe w)w)*iwJ/5&55&55q5 0 5&555 0 5@B f VB5w .N 255N :)5%F%E5%F%H5u&f fe w(w(.iwJ. 555&f 2e 5u&f e ff %w'w'w -N 255@ 255%M@E%@f ( @0A1@U@5f ( @5 0&f Ne ff %w&w&2iw$-N :)5N :)5@ X xF45&55ff l%5&f e 5&55&555 0 5&555 0 5@B f VBN5 0%w &,N 255@ 255N )N )@ g5@ g5@@m  l5@f g @fNm g ff "% ^55@p@ff %w(%w$%6iwL+w 8+- N 255ff %@ 255w$w$:iw*w *@ gN 255 @ gff %@ %g4@ 255 @ 0 gff %@ 255w#w#>iw*##w )Nf > 55@ @5 Y ff H%>#:#Biw)@@&@& M%wX#wT#w b)N 255N )ff %@-< @ 255N )ff %@5N &@E@U A15 % Y5 @&f &fe h'eL̋ ̥ ̥ ̥ ̋_G 5 ̥ ̥ ̥ ̋5 N5fe c%N 1 @f  &̋F 5 5 N5fe c%N 1 @f V &̥ ̋ @&f &fe h'eLԋ R55@5A1w8!w4!FiwL'w 8'N 255 ff %@@-ff %@ 255w w Jiw&w &#_Hw w Niw&ff %N 255ff %@ 255w %N'_pIwwRiw%ff P%@ 2f& 4%@-\ 255ff %@ 255w %u@5@5 N5 0%@55 @ @m5DNf ( @ 2552.ww, ff %@5  %2,(Viw0$w $@&  xP4N5 0%wwZiw# N 255N :)7.w # u@ 255% N ) gN :)& e N :) & 5)%%%N :)& %N :)& zN6 0%ff j% 555&f e ww^iw"w "5D' 255N )fe g ff % 6bfe g  Ne g% Ne6 0%@-NeA6 Y biw!@@&fe M%VRw !w!w !@555  %. wvwrfiwj!w V!N 255N ) Wp g WpNg@& g^ %  Wp g % % D6 0%%| ]6@& V% _6a6@& 6f Wp1gWp g @c6 0%@ *Wp1gWpqgNv6Wpfg g%WpNg iff %w, w  @ e l6 0 w w @ww   w D̥r̥w74  5,+  l7t$@ f l Ne X  | 5 K x9N VjN Vj w"̥rz@- pf X N VjNF@- <f X N VjN Vj f999 ce n̥r f Y N f Y N Vj mpHw R \ @  mJ w<N i& R %5u fe m& d%%%ff  % m %@Zw@*J w*w D      + - ̥9 Wp @@`e̥0  w\w DD  L7 - $ s 3  33 a r w w+& f gew Cfef p%5 w w NefC NZ%ww lNeff NZ%wdw PD A555  ԋuNeffe NZ%ww DC 5 5 _[%%_[5 %*e5  AWp `euB 0u%l5  %h%[ >`Be  _[Neffff [e   * O  A@ EN d5% % % %Nf @d &    %_jZ A@ E%Nf @d @w~N d5 w XN%c%s%[Nf ff f& >_ew"5 5 5 5 %e%f %o%xDe5 5 A @ EN d% % % %- Ԑ A @ EN d _^%+_^  _]%a%f %A_^%F_^ % A@vN dO% A@v@mAm@ vA@v5uB0 %a%fW7 5`u`u C% S P Ԑ A @ E =B%%.%e%E- *% ' $ ! Ԑ A @ EN d%+%-%0%9 A@  5u% N  @d =   @e! @e! _B\@t@]   x:Ne `A _B\Ne `A @H@pHw DC = 5%c%0u5 %s    d%r9%c5 %[r9      d%%   @d =  D- %cw. w D ̥^  999 % %]%-+ 9 $%-̥]4  9 ̠ 9 99 %]  wrw ^D*\5% %-%+ 5 55 55  B5eA5 B%.55  B5eA5 B %E%e$%+%-  Wp B`eB  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& be5 55w 6 m 7" w l D Lԋwd w P De LN g4e:e c  g4e: Be v Nfe d%w w - @ ;w N:li c%li4e& ;ew w | BuNefef p%=@@wP  Jҋ~ @@w  D% 5     |@w 4- mn BI I7<Iw  fff dew w yw w n D85U5_ f5P_ f  m~@e4 ,5Ne & hl  uN l4USt%C5,C i5(C i5& & g% 45@e-4  % U5EU  w@ E w  D  +   r= wB w 5 a U5ff g%ށ̥a &  ge 3     U̥r 33w 6D5"E@e44fef p% iU4 4  fef p%5 w w8w27B Ћ P ы A@PЋ w FD:5UE5Hw* _xi5uNfe & n% _xibNe & hl  uN l)U5| m- 5 & n%St%C  tl U   & n% S U _6h @_:hw DE%%"5   & n% U wv w ^D55@ i  Vj 3 m 4 4 4 4 4 ww~w  2$C5+ v &5e-Xe %D &     k ww  5f k 7 f k 7wX@ m|7zCp%De w  Z L    k e-0ww D C5 e %Dw  5 e-w i nkww  N nww rDCDpC l l wZw FN mwJ ~5 & E        ~5>wlYwfw Net@f le  w6w.w  iU7iU7iiAe vB7   % 55 a  a!PE -j%i w$ n `e vWt vw8@ `e @  n% e U? `e 7iU? a7 ?U ew dDE wZw FD5 m 5N l!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%շmՇ%w w7*'$!     d 7Z& AJ& BF7!,W-Xw7& & e Ӌ DD &7& e ӕ-ӕ0B~ӕ.  ӕ0~ B~DD&7 & Ze pӕ-0 dӕ.X B~ӕeJ ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luDBw* J@B V_Xr@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff Je w5  @ 0   Wp `e06@~ w DCB P  5 , :% & E& h z   5 , @ :% & f E h  (˥-%0     ,:% &  h 8 5E& z   5 , @ :% & f E h  ww Nefef 5& ue C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& ueww  fff 5& ueww | 5 %O N  = i555Ne5& re5i55'0Ne5 B& re57 Be0" 5%i55 5 B5@B ei a=%i7iw %i5 B5Ne& re55e0%i7`Jʕ0%iʕ1  %i˕0 ʥ9 7!#ECD"-.0.r%&RsCD(+7,)7RIG B9@>'?A B@;1Az^qx<=7wl/tMLfKFighYjX2 W$^87^7-.Vb^_`cdeZ[\]7*b!#r^"ks-. %&_`cdeZ[\] nopmb!#"7" %&q %&_`cdeZ[\]b!#7" %&_`cdeZ[\]^Tb!#7y" %&_`cdeZ[\]7^!# "bU %&!#"_` %&!#7"b %&nopm_`cdeZ[\]7b!#7" %&_`cdeZ[\]7!#"+ %&b7y!#53"_` %&!"7 %&!#" %&7!#" %&77!#53"!#" %&*7 %&7!#" %&7!#" %&7y7!#!#"" %& %&77!#r"!#s" %& %&J!#!#"qr"s %& %&!#"!#" %&q %&!#" %&!#!#"" %& %&!#!#"" %& %&nopm!#"6 %&66PQ6nopm666666664NO66S666666646{|}~4a6664:H666644644u4v444466444HH44444444$IHFE 9/z)JJMCA#h85""rt5OC(MJ34/z)'! JJJ~B//sF9(}|{8C6z-4&y1xv      {{/(0845 7-+IJ1<2KL;{./{,:9(+-*/%IJ-((((([}&'(){!#$}@=>?^$())))),,(((}}{/;BCD)),,,]"}9|(02)2./));%},),)));2;)))))BuC<uDEFGP7 !"JgA`auug8 GFE56%HI1234tggmuJJfhg g>@RSTUVW^+_,-./09#ijlnoqrgceg=uQYZ[\$KLMg;psNOgX]k:bd; ;?')*  vgg;&(;g;gygxwpp  pppp@LT^pptzpp ,:JXftppp(2BJpppppzpp pp&<&<LVpdtpBTyacc stack overflowsyntax errorbailing out$zero&null$record$record$record$recordillegal statementCCRDTTRT\p$2@N\j b x   * D Z p  , H d z   D R \ Rt  ( > T j nt (>># >:>;>>>>>>>>>>>>>>9>9>9>9>9>>9>9>9>9>9>9>9>9>9>9>9>>!> >>#;>UPOUUYXYWYNMINFNGNCNBNENLNAN?NNHNDN=<  "99999999999&92999999999 QTRSV@KK999999979%9996995999999999999'9)9999(99998999J99*999199,9/999$999949-99099939.9+9=9 O=>a9: O P'k4}4~6SS;V4}6=;69SS OXZ !QU"#=W$9] O[Yb c#g%$h&\\\\\\\\\\%i'&j?@g<()h*+,,q-67.</)m0?@1!d!e(l2+p/v0w2{3453|R*n8K-r.t*o-s Aj.u??\`lm A B !1x1yn#p1z$?qot8u?s%o&v88 Cw\`< D E F G's H I Ay()x*+,z-x{./ J0 AS128 C345 D E F G H IS8 K L M< JTTTTTTTTTT<L< NLLk K L^ M__________TTTTTTTTTTTTTTTTTTTT` NL"f"f"f"f"f"f"f"f"f"fL`"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f"f^^^^^^^^^^^^^^^^^^^^``^```````````^``"*"6"N"Z" p$( ""@"" "" @"""x"$"*<"0 "6"<8"BHLR0X^<djnrDx|D 4"H "  $(,0"4P"8l"<"@"FJ"N"R"V"Z"^"b"f"l"r"v"z "~P",""x"D#P#\#  H%""$""x"""""""""""""  """" !" "$$"(\","0"6d"<,"@@"D"HH"NL"Rt"V"Z`"`"dh"l`"r"v"|""""""""""4"""4"""<""""""  0000000000AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAG $record%onewline in regular expressionnewline in stringstring too longnewline in character classstring too longbad switch yylook %dlex: %c ? %o %s (%s) (%o)@(#)b.c 4.2 8/11/83(^NJJunknown type %d in penter unknown type %d in freetrregular expression too long unknown type %d in cfollunknown type %d in first @(#)main.c 4.4 (Berkeley) 12/8/84Usage: awk [-f source | 'cmds'] [files]rcan't open %s-d-l-S-Rnot restored awk.outnot saved @(#)token.c 4.3 (Berkeley) 12/8/84++!+'+*+-+0+3+6+ 9+ ?+ H+ O+ S+Y+^+e+i+p+w+}++++++++++++ +!+"+#+$+%+&+'+(+)+*++,, ,-,.,/,0,1$,2(,3.,43,5:,6B,7H,8P,9V,:^,;a,<h,=l,>p,?u,@z,A~,B,C,D,E,F,G,H,I,J,K,L,MFIRSTTOKENFINALFATALLTLEGTGEEQNEMATCHNOTMATCHAPPENDADDMINUSMULTDIVIDEMODUMINUSASSIGNADDEQSUBEQMULTEQDIVEQMODEQJUMPXBEGINXENDNLPRINTPRINTFSPRINTFSPLITIFELSEWHILEFORINNEXTEXITBREAKCONTINUEPROGRAMPASTATPASTAT2ASGNOPBORANDNOTNUMBERVARARRAYFNCNSUBSTRLSUBSTRINDEXGETLINERELOPMATCHOPORSTRINGDOTCCLNCCLCHARCATSTARPLUSQUESTPOSTINCRPREINCRPOSTDECRPREDECRINCRDECRFIELDINDIRECTLASTTOKEN@(#)tran.c 4.4 12/9/8300$zero&null$recordFS RS OFS ORS OFMT%.6gFILENAMENFNRout of space in makesymtabsymbol table overflow at %scan't set $0can't set $0%.20gillegal reference to array %sfunny variable %o: %s %s %g %oout of space in tostring on %sout of space in tostring on %s@(#)lib.c 4.4 9/17/842S..................................................................................................$recordrcan't open %srecord `%.20s...' too longrecord `%.20s...' has too many fieldsrecord `%.20s...' has too many fieldsNFfield %d: |%s| built giant record `%.20s...'trying to access field %dawk: %s near line %d awk: record number %g @(#)run.c 4.5 12/4/84..7p77888888=d=8=8=8==================?@,@:@^@@pBBBBBKKKKillegal statement %ounexpected break, continue or nextunexpected break, continue or nextunknown boolean operator %dunknown relational operator %dout of temporaries in gettempformat item %.20s... too long%snot enough arguments in printf(%s)illegal arithmetic operator %ddivision by zerodivision by zerodivision by zerodivision by zeroillegal assignment operator %d%s%d%d%s is not an arrayillegal jump type %dillegal function type %dstring %.20s ... too long to print%stoo many output files %dwawcan't open file %s%s@(#)parse.c 4.2 8/11/83out of space in ALLOC$recordMMM77777755ML?L?L?L?L?L?rArArArArArAMMMMLhE>EHMHVI6J8K8K8K8K3DDM666MM4K :M;4MMMMMMMM.CMMM@@@@MMM9777777777788 8 88888 8$8)8.83888=8>8?8@8A8G8N8W8]8a8b8i8n8u8z88888888888888888888888888888888888888 < <= > >= == != ~ !~ + - * / % - = += -= *= /= %= printprintfsprintf splitif(while(for(instatnextexitbreakcontinue || && !fncnsubstrsindexgetline ++++----$(@(#)freeze.c 4.2 8/11/83empty restore file 1@rzA]ݬ5@3dlB##3h?ØGf@lB,l$d!rJGSrCu%طK@0qi9IE4Ÿ@;\)@3dG@0WFW/bin/shsh-c$_$_._ _ _ _ _ _ _ _ _ _ _ _ _ _^^_: Unknown error: %d;;;;;<<,<>"><>Z>y>>>>>>?:?X?????? @*@C@]@y@@@@@@A1A>ARAfAyAAAAAAA B"B > @-_hl     4 > %8 > % : > B@9 @  % -@<@ 5   N &  % N[ >   ee%@w@9 @ȥ-_`f 8     >% %ww vD      + - ̥9 Wp @@`e̥0  w0w F fef %5 w w D Lԋw ы A@w  $: 5+  &5e-e %* &     ( wTw @ 5f ( 7T f ( 7w@ m*7(: %* e w       ( e-ww D : 5 e %* w  5 e-w R@ wVw B N wBw .DCDpC  d ww N w ~5 & E        ~5Yw(w   U7 U7  Ae vB7   % 55 a  a!PE -V%  w  `e vWt vw$@ `e @  %e U? `e 7 U? a7 ?U ew ^DE wTw @D5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `mn& E%`mZ%w7*'$!      7& A& BF7!W- 7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu2 Bw* J@B |_d @  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& X z   5 , @ :% & f E X  (˥-%0     ,:% &  X 8 5E& z   5 , @ :% & f E X  ww D:5UE5Hw _ 5uNfe & % _ bNe &   uN )U5| m- 5 & %St%F  U   & % S U _ @_ w zDE%%"5   & % U w. w D55@   3  4 4 4 4 4 ww6>w0w Net@f e  w6wwFhlpuy~@(#)kill.c 4.4 (Berkeley) 4/20/86HUPINTQUITILLTRAPIOTEMTFPEKILLBUSSEGVSYSPIPEALRMTERMURGSTOPTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2usage: kill [ -sig ] pid ... for a list of signals: kill -l %s kill: %s: number out of range kill: %s: unknown signal; kill -l lists signals %u: %s :BLfv(4JVbt 0=Sbn-Lm0Qlu ACEGIR0R00%DTk8Zo"8Zl~ % RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB v dvox@ fN e@g c& sPlPLuDzOXU0Rl K!R0R00 :\  e7cce7> /   7%  2w *6 55 5! t( u,<  2#@ d   5 n  5lff %5% 5`% <  2  Ne&  s *_zNef Z"  2 _zFBN  <  < f l,e7`w`w f T   n&&&& e - f   |. 5<  "Xf 5%N x1 5N% % f Z"  2 f  5f T5 5@5Neff ev 2w3w v3D 5 5.<N /%"wV3 f T5  5@  x,=AAWp @AA@`e5@#Wp @@`eeWp @@`eeWp @@`e5eWp @@`e5eWp @@`e5e̋%_,% _,%_,%_, _,%;_, _,%;_,%# 5 7 7 el r  rd  r %e  _,%_,m 7`x w`v w p %  r  rd  r n A~ 7`0 w`. w ( ~A 7` w` w  f    (eee@ 7 w f <   (eee@ 7 w f <   ^(eee@ 7 w _0w 0 5 < f w|0@50.& &%52u4  %5 %+  _n fe> @3 >N "5@fe>f % %0 %1 _n  %%<_h NO@fe @fefeZ N#% "5Pff %%5RuTf f r%%5VuXNfe.f % _R LfeNf e %= _n !_R uu5 5 fe @3  C r vf&A r t@aUUNe& & fe e5Nefef e  w %= _n ,_R _X  C r vf&A r t@a&50TNefe& LfeNf e %=zDG_RNP "5PfTfR #%5RuTfXfV #%5VuX @N $ ) @N :V< t-%%< N x1__N x1_ w ,w-  @m7ȥ- > - 7t%:f H' ( <f < <* < ?w8, ̥:7 T*+LF # %EAEt =_5]Ne "NVfej $%CaejNe T[Aej@ e`5 N F> : 0Rl K!R0R004e $%`5  h $%` ӕ:ӕ Bej%_$mo N m $%` 5 Nfej )%`Aej@55 *@e`5^}^f@ej@A^1e^p^@^fe` )%z  0U* %Nfej 5%@-`R ffej e O5K 5h%D 4 r |.%5fej . e>fej H'  NAej@f 5%N x1 5 & fh )%%%|w$w $D w*w" 57% <Jj N#%5,  %7% , |. 77%' %%hv %%f x1\w#w #H x1>7w#w #D4 7,w#bw"w l#N T wj#w V#D el&&&&Wpef Wpefx $exw#w #5 5  AaAE f&A@vUU5u %w"w "D &w"̥/ 550 /&f  e %Nfe / >fe . fe . ԥ.̋De &  & |. %fe0 .% x1 %,@e05e rwNe$ rwNe( rw%r_ _% _%2_WpfWpemze, _@e\5 N rf&te -6 @ E3` - *te5.N rf&@.e@.A Ep@.A Ep - s" -3" `_ - t-~_ -n"77te5  e"7n -4 _@e"7Nw  Nefe Z"w7 AWp@7$ 7  f " " / "77 w 7 7 7 7 @" / "77wxw d:D v#̋      2  w6w "  @55  w-w-  t  -  t5, 5, - _ue&&fe Xe3 e"pe"3wlw X& f eGKwDw 0 XQ@f& e5uQ@f& e5uumumu _eeQu  %QQ eu % ff et ff e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 Ottw!w\ww xDe LN /4ePe"   /4eS Be v Nfe )%ww -@ hwNUp $%pew@aw:w w@7% ?@wN f w vDC_z!̥%_`! 5 r y2 _`! 9% 5afe & ,%5@e5 5 N ! _x! 5 N ! _x! w _x! _x! _x!  !% _x!0 !% _x!0 r  r f !% _x!0 !% _x!  !% _x!  r  r f !% __x!0 !% __x! ! __x! __x!0 !% __x!% __x!. ! __x!0e r& !% __x!0e  @ r& !% __x!0 !% _x!_0 _x!_ _ ! _x!_ _6 _< _`! _% _b_fe & ,%5@e5_ _`! _ _Z _`! _ _v _`! _ _ _`!0 el rdf !% _x!_ _ _`!0 !% _x!_ _. _< _`!  ! _x!_ _  _X h_4 _$ _ Y% _ _ _ G0 !% H_ _. _ - 2_ ! 0 el !% _ _ _ _D  _?  ̋__w A r e0@ A r 5   % @  L %  !ww D w | x?tw \ fe Z"@wN @pHA@tww  v#!,& H'   w 1& N#%7˕,Nf " w D : !     +  we% - r<N r<&@& $e ~ ~w  Nef # ww D 5  =& '% `5ȥ=  = @we  w t BuNefef 6%=@@wHw 4  ' '  ' w/ f'  ,5   & . 6@ ,w  B  + 7.( .ww   17 ww |D 5 %" 5x@ #w^%̥\" %%#l % % % R% % %  w D=& H'  w w  H  + 74 _D'( )% % % %  %#77 $7 $7 $7 7 _'& '% % % % U\K % % N & '% % % % E( & '% % % % U& '%  %7 $̋#̥#7̋7  & H'  wBЋ Ћ   Ћ Ћ  Jҋ~ @@w hN 3 HNef 3?@E% 8 (2 (*L- / e . Ne `)u-u- `(w4 `( w D x14 4  5ww  f |. %  x1P 34 4 w w D 4-&4-!4 4   &e & .%4    wh me   s lt  &w BzI I7Iw BuNeff 6%=@@w w  fff )ew w yw &  4  b '     ` TW ~  s`K6!  w  D85U5_+5P_+ j m`@e4 ,5Ne & 3  uN 34USt%$50 05 < 05& & .% 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff |.%ށ̥a &  .e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef 6% 0U4 4  fef 6%5 w    6v&  @ppC`p   6@Cwzwtw D 0 & & .e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _05uNfe & 5% _0bNe & 3  uN 3)U5| m- 5 & 5%St%0  3 U   & 5% S U _X/ @_\/w DE%%"5   & 5% U wv w ^D55@ 0  x1 3 5 4 4 4 4 4 ww~w  $$5+ &5e-Ve % & 4    3 ww  5f 3 7 f 3 7wX@ m7$%e w       3 e-ww D l$5 e %wH  5 e-.w 1 2ww  N 5ww rDCDpC 3 @3 wZw FN 5wJ ~5 & E        ~5>wlYwfw Net@f 3e  w6w.w  6U7( U7 Ae vB7   % 55 a  a!PE -%  w$ 5 `e vWt vw@ `e @  5%`\e U?JJ `e 78 U?, a7 ? U ew dDE wZw FD5 5 5N 3!w5A vBB-  }ee@ !ۃ `!ւ ` `Hm>& E%0۷m*ۇ%w w7\*'$!      7& A& BF7!zW-x:7fw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_8@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& 0/ z   5 , @ :% & f E 0/  (˥-%0     ,:% &  0/ 8 5E& z   5 , @ :% & f E 0/  w@(#) Copyright (c) 1985 Regents of the University of California. All rights reserved. @(#)date.c 4.20 (Berkeley) 3/24/87|{usage: date [-nu] [-d dst] [-t timezone] [yymmddhhmm[.ss]] ,,,!*2;BIRZ_dlt|d:nut:settimeofdaygettimeofdaysettimeofday/usr/adm/wtmpdate: can't write wtmp file. rootdate set by %sgettimeofdayGMT%.20s%s%sANYADJTIMEACKMASTERREQMASTERACKSETTIMEMASTERUPSLAVEUPELECTIONACCEPTREFUSECONFLICTRESOLVEQUITDATEDATEREQDATEACKTRACEONTRACEOFFMSITEMSITEREQTESTSETDATESETDATEREQLOOPtimedudpudp/timed: unknown service date: socketdate: binddate: All ports in use gethostnamedate: connectdate: senddate: send (delayed error)date: recvfromdate: Wrong ack received from timed: %s date: Can't reach time daemon, time set locally. : illegal option -- : option requires an argument -- /etc/servicesrr# ,/ /etc/utmp/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec"mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d :Jbl*6HWgv'6BUf| A X r  ( ? c . C V x . @ R f | RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorL S Z b l u |  D v !B!SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/etc/ttysrronoffsecurewindow=/dev/ ((((( AAAAAABBBBBB 7d7o7x`8fn8e`7g:8cF8sp7lp7L7u7D7O7X7U0Sl    R0R00 < H e7cce7  /   7%  2 w l  s 6@ ? lff %5%j 5``%# w~ F  & n : %7` ^ 0@7R & J : %7< : 0%%( @&  f& ne# @& d f& ne zw^w JD)  W-A@ CH & @ %  N 0 5u   wN lw 5 5 5  H 6 @ %5 ) x 0H @ %  x 0  2  lNH @ %5% 0NHH 8% g  2 1H HBeu ̢ & ff e  u-_. l_H Heu ̢ffff ze 2 ̥ eu A 5`u`u  H B ԥ eu w D̥0 5 5  f&ff eee@ ee@ 5u  A@w w BN %w  2 w` w L  N % 2 w8 w $     2 w w  Pw-F@ @m76ȥ- ,(> - 7:%:f  (  f            ?wb ̥:7 *+ xw-r"l d f   #H @m7vE: 4f 9 E5 @@l w`w DC E5<E@e33. @;E  5 , @;% & fE r 5  U3 3  w w  fef %5 &w w D Lԋw w De LN b 4eFe   b 4eI Be v Nfe 2%w* w  -X@ ^w NKL %Lw  BuNefef %=@@wЋ Ћ yw  R~55R 5& ER$ ~ER w $D5"E@e44fef % U4 4  fef %5 w   @ppC`pww ы A@Ћ w FD:5UE5Hw* _ 5uNfe & 6% _ bNe &   uN )U5| m- 5 & 6%St%  U   & 6% S U _ @_ w DE%%"5   & 6% U wv w ^D55@   3 T 4 4 4 4 4 ww~w  $ 5+ \ &5e->e % & ^    F ww  5f F 7  f F 7wX@ m7 % e w       F e-ww D  5 e % wr  5 e-Xw Z ww  N <ww rDCDpC  wZw FN TwJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  `zU7RxU7HzFx>Ae vB*7 ,  "% 55 a  a!PE -%x w$  `e vWt vw@ `e @  %e U?tt `e 7bxU?V a7H @B?:6U ew dDE wZw FD5 T 5N !w5A vBB-  }ee@ !0 Sl    R0R00ۃ `!ւ ` `rm& E%m%w w7*'$!     P 7F& A6& BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& r z   5 , @ :% & f E r  (˥-%0     ,:% &  r 8 5E& z   5 , @ :% & f E r  w@(#) Copyright (c) 1987 Regents of the University of California. All rights reserved. @(#)cmp.c 4.8 (Berkeley) 12/21/87RZ(0ls-%6ld %3o %3o %s %s differ: char %ld, line %ld cmp: %s: cmp: EOF on %s usage: cmp [-ls] file1 file2 [skip1] [skip2]  : illegal option -- : option requires an argument -- : Unknown error: %d 0@Xb| ,>M]l},8K\r7Nh5Yz$9Ln$6H\rRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB `doxfeg|cslLuDOXU0Tl R0R00  H e7cce7l  /   7%  J w 6% .d   J e 2 f9w 7   b n 5d X U R  ̋ e @ȥ-  @mNe& &@E%@Nf z && % J@E%Ne&  z7` B-N  J wZN & w 06N f N z N  q N zw  D D5 Nee  e z5 DN   X  @@E%@f 8 &e %5@E%N e e z5w <sd  Nfd % r l d `5^P -P ?B% d& 0d  B w w x 7 ,Nf  N J wj w V  {d  N   w> w $ u w N  + - =A @@5@@A @@5P d `ȥ, VR X @w  %7 taeğ  %0 wj w V    @ EwH U8 uU  g oU  aUw  + - = w w D | g  o u8E?t EtEEtWt@PP 4 s' t' w x wn U rU$UI  X5@5IU Uw w w (w w  D Lԋw w De LN z4eej n  z4e Be v Nfe %wv w b -@ w\ N % w 0 BuNefef %=@@w w D 4 4  lww  f n %  P ( 4 4 ww D 4-&4-!4 4   &e & t%4    wBme   s lt  &wp<ywfw D5"E@e44fef %  U4 4  fef %5 wz wwЋ w FD:5UE5Hw* _ 5uNfe & N% _ bNe &   uN ( )U5| m- 5 & N%St%X  U   & N% S U _ @_w DE%%"5   & N% U wv w ^D55@    3 l 4 4 4 4 4 ww~w  $L5+ &5e-ze %< &     ^ ww  5f ^ 7P f ^ 7wX@ m&7$L%< e w       ^ e-ww D L5 e %< w  5 e-w r ww  N Tww rDCDpC (  wZw FN lwJ ~5 & E        ~5>wlYwfw Net@f " e  w6w.w   U7 U7x v nAe vBZ7 \  R%L 55 a  a!PE -%  w$ ( `e vWt vw@ `e @  (%e U? `e 7 U? a7x pr?jfU ew dDFE wZw FD5 l 5N ( !w5A vBB-  }ee@ !ۃ `!ւ ` `m & E%m%w w74*'$!      7v& Af& B0Tl R0R00F7!HW-74w 8uDAB %u f& & e w5 5  W- W00~u5  .luD Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   wCan't fchdir() back to starting directoryUsage: chmod [-Rf] [ugoa][+-=][rwxXstugo] file ... .Can't open ..chmod: chmod: invalid mode: Unknown error: %dNV`z*<H^jv,DQgv0A`"9Xh+Ln"6Ln$9RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator doxfegcslLuDOX(U0UlQ zR0R00 @*D e7cce7` / 0  7%  w  fe  7f  7f  7f  7_d@ @mȥ-_@ @m r y& u-_`@ @m7VR  c_`@m  _` 4_` 4 *@ @mP  0  mA AmH_\    mA AmH_` m   @ @me7_`_`@ @m_` h_`   @ @m5N 5%c%s "* $mHof 5N 8 _` mHN %o` ]  _ _    @ @me77z3 _ _x  R@ @mg _ _ _  u-_  %  * 4- _0 _(  _ @ 0_ 1_ 2_& p_<  p_| %   %   %   @* d%O* 7Q* 7S* 7 U* 7t W* 7^5 _p3r 7_6\ 7_9F 7_<0 7_% @ mY 8  l @ m %s @ m5_r i@ m& 7|^|xA mpp t  ~mPF5 l fm8A m4H -JF @m   J     Q -_R _ _ 5 }x  m mzt-_,  m\A mRH V%` 60( s@ m"& 7 b  me  mh m f J  _lkrxjn v`VpV0 N J  J(n62*(0  J   57  _l      qtwz %  |vo@ mh& Z1Rp H0 @ J %__l : H Bm 4 .m" m  J 7P%%  o   w w d w w p & |v  pj  | ^X  RL  F@ F w" w  > 5f 0 Nff 0% A@ ȕ 3@5&@ A@,@ % A@ EN@E&N  | zwZ w F C %/ ”%? %ӥ.w& w  N ~ ԥ/̋tw w  #N  0%u N  0%e   0 H5% 8 dw Nf N 8  ld Ne @- @5%% N 8 4 @w C %o  w @e” ̋Cw D  -- 7   0  & 8%`wX w D Nfe  Nfe  Ne ~ w" b ;ew~ w fef p%5 w w D Lԋw w u@t55@ 5Nefef % (3A@u5Btr2@ Aup fef % u-u-u-@w  ~ ~w  BuNefef p%=@@w w lw e& 7 7gwVBLI I7|Iw  & f *ewww D5"E@e44fef p% lU4 4  fef p%5 w Ћ PPЋ w FD0 UlN zR0R00:5UE5Hw* _R5uNfe & % _RbNe & B  uN )U5| m- 5 & %St%  N U   & % S U _ @_w DE%%"5   & % U wv w ^D55@ l  0 3  4 4 4 4 4 ww~w  $5+ . &5e-e % &      ww  5f  7 f  7wX@ mj7h^%e w  H :     e-ww D 5 e %w  5 e-w  Hww  N ww rDCDpC   wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  dU7bU7dbAe vB7   % 55 a  a!PE -X%b w$  `e vWt vw&@ `e @  %e U? `e 7bU? a7 ?U ew dDE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `mT& E%Fm@%w w7*'$!      7& A& BF7!W-07|w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_<@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w@(#)cc.c 4.13 9/18/8509AIQYa :/lib/cpp/lib/c0/lib/c1/lib/c2/bin/as/bin/ld/lib/crt0.o-o would overwrite %s/lib/mcrt0.o/usr/lib/gcrt0.occ: warning: -P option obsolete; you should use -E instead -t overwrites earlier option012p-B overwrites earlier option/usr/c/o012p/usr/newc0c1c2cpp/tmp/ctm%05.5d12345%s: cppc0-P-wc1c2as-V-u-old-X-o-lc_p-lccc: %s: %s No more processes Can't find %s Fatal error in %s ran out of memory (savestr) JnnhdNoZxf&egcs(l(LputDRO^XU0%Vl bR0R00  V e7cce7  / 4  7%  $w ^<5 5 < "E% %`uuw D f   e%'@-!  b_ e_ n\ s] t_ u vXNeb& 7 % __ e@ȥ-74ZNe & J@E%?u-;u-7 '?&  _ _  _ $f  N N&r % L w7       t  D5P%Z> L =     % 5 -?%  f&  d fEE05 _.Ar N $ww D_    _ ~ t   z vZ  X, $ $  5 -$?% f& f$ d   ߾ 5 - ?% f& ߊf d 7 _% _     _   v_ h %  ($X5"^ -X?% Df& P%d E% e@g >%k 7 ǀ5( -"?%  -?%  r n f5ffE d 7     %_wz w f D: VP HB 5n w6 f& > %"!5 fNm& (%5}  $umBׁN F  w ffef %5 \w w D 3 FEtU4 4 wV w B D Lԋw: w & De LN T 4ee   T 4e Be v Nfe |%w w -H@ w N <% w n BuNefef %=@@wB yw w ( D85U5_5P_  m@e4 ,5Ne &   uN 4USt%Z56f 52r 5& & > % 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff 8 %ށ̥a &  D e 3     U̥r 33w D5"E@e44fef % U4 4  fef %5 w ww7` Ћ w FD:5UE5Hw* _ 5uNfe & (% _ bNe &   uN )U5| m- 5 & (%St%f   U   & (% S U _ @_ w DE%%"5   & (% U wv w ^D55@   3 F 4 4 4 4 4 ww~w  $Z5+ &5e-e %J &     8 ww  5f 8 7 f 8 7wX@ mh7fZ\%J e w  F 8    8 e-ww D Z5 e %J w  5 e-w L ww  N .ww rDCDpC  t wZw FN FwJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w   U7 U7  Ae vB7   % 55 a  a!PE -V%  w$  `e vWt vw$@ `e @  %e 0*Vl bR0R00U? `e 7 U? a7 ?U ew dDE wZw FD5 F 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m@& E%2m,%w w7v*'$!      7& A& BF7!|W-7hw 8uDAB %u f& & e w5 5  W- W00~u5  .luR Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& d z   5 , @ :% & f E d  (˥-%0     ,:% &  d 8 5E& z   5 , @ :% & f E d  w@(#)cat.c 5.2 (Berkeley) 12/6/85rcat: input %s is output -cat: output write error %6d %6d M-^%c^?cat: no memorycat: write errorcat: read error: Unknown error: %d\dn&8JVlx+:R_u!>On0Gfv!9Z|!0DZ|2GRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator doxfegnczslLuDOXU0/Wl IR0ޢR0ޢ0 8  e7cce7@ /   7%  0w 4@ &  ,e W  5 5 r5 b & +e@e @w3  , ځ5  5Nefe   P/w *3% @-_` ,e 15 &b +% 0-@f , @p] xUXVUPRUHNU@ G|CU*<U 8U@01UL*U#UU UUU  @T $ kff $%5% 5`5#x ~ + r5^ 5V  + P5<@e7  + &h 7b55  5 5  5@ 5  5 5{  5 5  5 5   5 v 5n   @e7R  + P5<   + + 0N  0wh0w T0NN +% wJ0w 60v +  +  +  +  + ' + H + u +  +  0w/w /5 5+Uf: ,%55, "  +%%  Ef ,%5 f %-   35@E%(fef ,%% 5  fe x*%  f 3%%. @w~.w j.N P/wn.w Z.<hf ,%%<   wB.   : hfe: 4*%    fefe *%5 & fe %7 w fefe *%5 & fe %w\ fefe" *%5 & fe %w( fefe( *%5& fe %w  fefe0 *%5 & fe %7 w   f x*% .Ne F7 %? f ,%! P  4 7B w@ : 7 < f *%, ʥ  _w L, _ @ Nf b1  ,5@% . +e .A@f&@&@& @&@f&h )e a%  )/k& @ee@ f&@&@& @&@f&&gDh )e( @f&@&@& @&@f&nh )e@55 |lh<h@& 3%%<@  @& 3%!@ 7fff e7 wL*w 8*A@u5v_v D@5A W-A@ Nfe& ,%-, 5u 5 @@me&f 3%@ C`       @ @55fe& ,%%   >@ @5^@m5f 3%%@ w(w (mE mxmv@ 5ufff ,e W < w(w |(D   g w^(  5Q5BNe  fe Xe  X"5N@ el&@&@&@&@ & e N     z      w r'D 5 5u5B 55  N z   fe  N  & f ,e5u & f ,e  f ,euuL5 fffe DeN P/A@e@ f&f & eN   wL& w 4&P u55u 55 5   _N w% ;5Nef \* w-l_w-`_f ,%6 &f +e z iN 55N#  ufe e  &f+ +e5 $u55uNef l*l &f> +e P/    _z  _j _vw d$04Wl IR0ޢR0ޢ0   ` c '7R Hp>jfe )e fez *% %5uNe X(5% Ne b*ff %@w#w # D   5 e  w#e @w |# N +%e wh#w T#/f *  wJ#@w 0#5f & 4*%  N  ,w"w " w"w " &f +e 0w"w "  5DE5 5 5 5u5 XuWP +%N w6" N 55  u' !  5 5uu fe  5pu u fe  N     f ,euju5 & f ,eu55u & f ,efffe e& f ,eu55`u`u  & f ,eufffe ~e& f ,eu55`u`u  & f ,eufffe (eA@e@ f&f eN  N _$ _(w   55  7N w #5z N   .b\fe \e   N 5 z      w VR5 Ne \* 5  0 5_58   & , 5_< &&@ +e_ T5 L5dE5B   _ +% w| _N q & , 5& && +e fe  Nef b1 5w- w-N P/5x   u5Nefe  N P/ z _ x  5 5B@ fe  5_B_Nef b1 u55@@5Nefe  N P/@e_D   ,eu<5 %'& f ,eu55u & f ,efffe e5 5 & f ,eu55`u`u  & f ,eufffe eA@e@ f& e @_w DCE ! ! ! !  @  ` ӕ?ӕrӕdӕcӕb ӕ-ӕlӕsӕp5ӕ-5ӕwӕ-E  @    @ ӕrӕ-ӕxӕSӕs5 ӕ-5ӕwӕ-E       ӕrӕ-ӕxӕSӕs5ӕ-5ӕwӕ-E   ӕ wbӕ-ӕxӕTӕt|www *&w- @m7 ȥ- > - 7%:f ) ( f  U   L  L ?w ̥:7 |f*+^Xh Nw-HjB :f  k @m7(  9 E5 @@l ww DC E5<E@e33. @;E  5 , @;% & fE - 5  .U3 3  ww D      + - ̥9 Wp @@`e̥0  ww*w fef 4%5 w w xD Lԋwpw \DC %5 ̥+̥- %$ ! ̥0 ̥X̥x % ̥0 ̥X̥x 5 5 %0e e  ff zeee@ 5u % = A@  w^A@w @N X" $w>w *D el&&&&Wpef Wpef )eww 5 5  AaAE f&A@vUU5u %ww D (w̥/ 552 ,&f e %Nfe , @fe , fe , ԥ.̋De & % & , %fe0 ,% P/ %,@e05e vwNe$ vwNe( vw%r_ _% _%2_WpfWpeme, _@e\5 N vf&te -d @ E3 -H *te5.N vf&@.e@.A Ep@.A Ep - sT -3T _ - t- _ -T77te5  eT7l -b _@eT7Lw  Nefe &w7 AWp@7R L7 N f ' T , T77 w j7 7 7 7 BT , T77wLw 8hF '̋      2  w w  $ @55 H w-Fw->  t  -   t5, 5, - ܑue&&fe Xe3 eTpeT3w@w ,& f eIMww  Q@f& e5uQ@f& e5uumumu _#eeQu  %QQ eu % ff et ff 0e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 Qttwl!w w RDe LN ,4eRe &  ,4eU Be v Nfe r*%w w -@ jw NW )%tw w V '!,& )   wz 1& '%7˕,Nf ' w 2 D  !     +  w e% - r<N r<&@& )e ~ ~w ~ Nef ' wx w d D 5  =R& 4*% `5ȥ= , = @w e  w Nef (@w w  f (@w w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef \*,5@ 'Ne \* %ʕ/  f ,% %% w Nef \*ҕaʋʥzʕaw BuNefef 4%=@@wv Ћ Ћ   Ћ Ћ  Jҋ~ @@&wr wl nwb yw\   R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef 4% .U4 4  fef 4%5 wZ    6v&  @ppC`p   6@Cw8w27^ Ћ P ы A@PЋ w FD:5UE5Hw* _r.5uNfe & 3% _r.bNe & b1  uN 1)U5| m- 5 & 3%St%  n1 U   & 3% S U _0- @_4-w DE%%"5   & 3% U wv w ^D55@ .  P/ 3 2 4 4 4 4 4 ww~w  $5+ &5e-rte % & P    0 ww  5f 0 7 f 0 7wX@ m7%e w       0 e-ww D 5 e %wd  5 e-Jw . h0ww  N 3ww rDCDpC 1 1 wZw FN 2wJ ~5 & E        ~5>wlYwfw Net@f 1e  w6w.w  RU7DU7:80Ae vB7   % 55 a  a!PE -% w$ 3 `e vWt vw@ `e @  3%|xe U?ff `e 7TU?H a7: 24?,(U ew dDE wZw FD5 2 5N 1!w5A vBB-  }ee@ !ۃ `!ւ ` `dm& E%ݷm܇%w w7.*'$!      7z& Aj& BF7!LW-P878w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_\6@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& - z   5 , @ :% & f E -  (˥-%0     ,:% &  - 8 5E& z   5 , @ :% & f E -  war: %s: %s. q - %s \\\\\\\\\\\\\\\\\\\ \"08\@ar: %s. abcdilmopqrTtuvx.ar: one of options -dmpqrtx is required. ar: only one of -a and -[bi] options allowed. ar: no position operand specified. -d-m-p-q-r-t-xar: no archive specified. ar: no archive members specified. ar: illegal option combination for %s. usage: ar -d [-Tv] archive file ... ar -m [-Tv] archive file ... ar -m [-abiTv] position archive file ... ar -p [-Tv] archive [file ...] ar -q [-cTv] archive file ... ar -r [-cuTv] archive file ... ar -r [-abciuTv] position archive file ... ar -t [-Tv] archive [file ...] ar -x [-ouTv] archive [file ...] ar: creating archive %s. ! ! ` ` #1/#1/#1/ar: warning: %s truncated to %.*s %-16.15s%-12ld%-6u%-6u%-8o%-10ld%2s` %s%-13d%-12ld%-6u%-6u%-8o%-10ld%2s#1/` %-16.16s%-12ld%-6u%-6u%-8o%-10ld%2s` %s %6d/%-6d %8ld JanFebMarAprMayJunJulAugSepOctNovDec%s %02d %02d:%02d %4d %s %s d - %s ar: %s: %s. x - %s ar: %s: chmod: %s ar: %s: utimes: %s Ttemporary fileTMPDIR%s/%sar.XXXXXX/tmp/ar.XXXXXX/tmp/ar.XXXXXXar: %s: not found in archive. ar: %s: %s m - %s ar: %s: archive member not found. stdout <%s> ar: %s: %s. r - %s ar: %s: archive member not found. a - %s ar: %s: %s. T: illegal option -- : option requires an argument -- SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec $mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d"<Ldn  ,8JYix  ) 8 D W h ~  " C Z t  * A e  0 E X z  0 B T h ~ RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator]aimuy,}h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d. ((((( AAAAAABBBBBB   5dn5oz5x86fF6e85g6c6sH5lH5L5u5Dr5O~5X5U0DXl R0R00exit 0 0FYl R0R00exit 1 0HZlV&'R0R00 V T e7cce7 /   7%  w P @- i( V   e% " 5 V f  %N  , $ 6 Z $r $%F  8 p /@&  @&   @&   N 4 f  5    @ @m&  u-ww ~Nef 5@E% .@E%`'  N( V %_  Z5!Nezf u-u  f 7 N p_ N & e _~N $   ~ 5u  @A 5u  &  5 uC&ffffff "e  + et5 5 && f& VC&&f f e $N  $  w&w    ff 0ef&`  eN fL  %5@- %8 ff 8e f $% ww  f T3wV e f TeD% 5w H6f h% e<f h% eNf   0Nf  rrN f  rN f  r ww D̥: ̋̋ww p C Wp De` ˋ ˋ =K ˋˋ w2w   %w= @0 @0 :&fe ,% &fe ,%w , $OD n 77  wv w \  >7 wR w >    ~5%%w w  p  N&  w w B  N&  w pw   N&  w @w x  fef %5 wd w L D LԋwD $w , De LN F 4eRed   F 4eU Be v Nfe %w w -@ jw NW" (%"w t BuNefef %=@@wH  Jҋ~ @@&w yw &  4  b '     ` TW ~  s`K6!  w ~ D85U5_X 5P_X  m@e4 ,5Ne &   uN 4USt% 5P 5L( 5& &  % 45@e-4  % U5EU  wP E w . D & +   r= wB w 5 a U5ff %ށ̥a &   e 3     U̥r 33w FD5"E@e44fef % U4 4  fef %5 w   @ppC`pw w7  ы A@PЋ w FD:5UE5Hw* _ 5uNfe & % _ bNe &   uN )U5| m- 5 & %St%   U   & % S U _~ @_ w DE%%"5   & % U wv w ^D55@    3 8 4 4 4 4 4 ww~w  $ 5+ N &5e-r0e % & P    * ww  5f * 7 f * 7wX@ m7 % e w       * e-ww D  5 e % wd  50MZlX&'R0R00 e-Jw > ww  N ww rDCDpC  f wZw FN 8wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  RPU7DNU7:P8N0Ae vB7   % 55 a  a!PE -%N w$  `e vWt vw@ `e @  %|xe U?ff `e 7TNU?H a7: 24?,(U ew dDE wZw FD5 8 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `dm& E%m%w w7*'$!     x 7n& A^& BF7!@W-7,& & e Ӌ   &7& e ӕ-ӕ0B~ӕ.  ӕ0~ B~  &7 & Le ӕ-0 xӕ.l B~ӕe^ ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B V_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& V z   5 , @ :% & f E V  (˥-%0     ,:% &  V 8 5E& z   5 , @ :% & f E V  w&w Nefef 5& e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& eww  fff 5& eww  5 %O N  = Z555Ne5& e555'0Ne5 B& e57 Be0" 5%55 5 B5@B eZ a=%Z7TZw %5 B5Ne& e55e0%7Y`Jʕ0%Zʕ1  %Z˕0 ʥ9 6@~ usage: df [ -i ] [ filsys... ] /etc/mtabFilesystem kbytes used avail capacity iused ifree %%iused Mounted on /etc/fstabrwrorq%s: screwy /etc/fstab entry %s: mounted on unknown device %-12.12s%8ld%8ld%8ld%6.0f%%%8u%8u%7.0f%% %s read error bno = %ld count = %d; errno = %d //dev//dev//etc/fstabr: Unknown error: %d"<Ldn  ,8JYix)8DWh~"CZt*Ae0EXz0BTh~RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB 6dox|fe|gVcbslLuDOXU=(\0T[lz +tvxz|R0?R0?0 #@ e7cce76. / (  7%  *ׇw .`.U7-^.U7-`.-^.-Ae vB-7 -  -%- 55 a  a!LE --%^. w ҁe vWt wp- 4d- `e T-  4%<-8-e U?&-&- `e 7-^.U?- a7, ,,?,,U ew TD,E wJw 6D5  5N L!w5A vBB-  }ee@ !ۃ `!ւ ` `$,w 5 5 @ z  +EE55$@ N& %um-++Eff ew@ N& %umw uDAB %u f& & e wσ5 5  W- W00du5  .Ru Bw J@  o x d u        ӕ- f&@Ew ӕ0 @ r@A r  f  e0 9e' E Aҋ D~5w`A  fff Ve w05  @ 0   Wp `e0w  fef %ww DCB  ұ˥- %0  Z N Z   Z N Z  wdw P DNe Ne fe ZҖ% * |u  6u33 74"7.".(3 7 (" Nww ' F 55 e f  e  5!%.(  f    -p! w&w DC & & y `   ww 7 !e ' F ̋  R &  6u$N X   R      pN  |u 33 j f 3R b  Nww D $S R i̥/CE y<H y5'L 5+u$CeB/Ne R  uNe 6u)e '& F ˥/˥. R  u 6ul u ̥/MJҋ<@ 5%5 ҋ@m  L7@m  u5@   5@  uCm/& whw Te ,%.(-xS  R  <0JF@0?8,N X   R  N  |u 4 ?0 Nww D ԥ+5 @E 5B ƭ wT%.(-xf  w de J N X  %.(%.( -%.( R  <0- NB  b ww zD  4  u uwdw PDC ̥/_@ b_@ ˥/ @ A H5 ˋ˥/ ʋ_" !__H_, 5@ A H _@ !__@._6_6"!_ fe& Ⱥ%5_ @@m0˕/˕/@ ȋ/S/ A@`@m L7< A@`@m u555@ A H @e5@ A H @ A HCm 6@@m L7@@m u55@e5@ A H @ A HC uD2ʕ/!/ 5 5@ A H_<  ʥ._ ʥ._P ˕/ˋ_ ww D7 6u B wpw \DwVʋE 5B " hv67 0w DH w55 Ne "%7   6u hv7 w TNe &Jw 7  7 7    y7ww rBe5 4 "  %  ". '+ \_ ` 7r_0Y[lV +tvxz|R0?R0?0 _ w   Ne Q  %" 5/% %  % =< " '  `  %``U@ 4 %`ҕ`  4% _%_U   4%\ 4%_% _U%_ 5B7 5CB__w D7 %7 Ußx tE 5CBe J  w^ >  E  7   ez J t %$  w $5 5 55 7<76 455%{ 45@E%#%? 45@ _ _ $H *_ PDeE 5B_d_5 AWp Ameu 45E 5BN  _ _d 2[ Z__n J_,__De@e! ̥̋  &8 8͖%% q'Ne fe ' _ 7_, j \_' mH 45%:_ 45.%g 45'% f t, w%q_'_ @ 5B @ 5B=T 45E 5B* @ 5B"N 'fe  _Ne _ _@e!Ç  Ne  a_,Ne y 45 v5_ _%[_De% %@e!T 45%] De  ̋E 5B/ Wp @@`eE 5B B- & t ̋ ̥* 3̥-_B E 5B Wp @@`eE 5B ǁB-B-@ 5  ̋_ u-5 @55N _@@  65 aN uN @ be7$@@ 7%{  n5%}_ww D 7& h    a u a wXw DwwJw 67   |  7 nw b ^XTeP w D 5CBwܺw Ⱥ  L  . 2  w   u5 7 zNe Rfe R \BeCe nwZ; %  Nfe $Nfe& ZҖ% & & ew޹E ʀS V  ӕ CeĔ fe& ZҖ%Be@e7@e7@e5)E&%\ 4d & tU7r\U= S <V  4%= @e5` t fe S 5@u5 @eu@E fe& ZҖ%Be ҕ fe& ZҖ%Bee  B _8 hv7 0 _w k67D 7   hv 7  hv  Nf  h 7  7  u7  * X'Vk % * #vt .e # T wZw Fp  Zx 7~N  w(w  j@F r  N ww :w27F ww Զ " Nf v 7" wĶw u5Nef  ww D & f ww vD@&   #w & e  & f    w,w DN& 4  #z & e5  &     wƵw D@&   x & e@& 4 Pwrw ZD@&   } & e@&  @xw"w D@& $  { & e@&  A @@wдw D @&  & & 5Me%%@&  @  xZ  5 u u@w,  P  P 4'5w D @&  & & 5ee  & Ue@&  @  xj 4'&  % 5 u uN 6w@ 4'& v % 4'& ` % 4'& J %w D@& 59 @& t0@H*e@&  < 4' 4' &  t5 u uN 6wdw LD5 @& ̥>5-̥= ="̥!=~ ̥<̥>wΫ~5_&w D̥̋- E 5B  ƭww t 5j.t@ .ej.t .eNet@ .e5"E"Ne tj.t .eww ڪ& z%5uNet@l .e@eAePPPENe t: .e ( ZҖ%Ne t .eff %wHw 4& Ԟ%5uNet@ .e@eAePPPENe t .eD rtz .e ̋Ne tZ .eff @%ww ~DCB̋ Ԕ wfw RDCBԔ wFw 24fffe %& ^)%Nefe 2@E   @/ @E%@>wԨNefe 2@=5I* w 5 p.ht@2 .e  P  @m B-@5 D-eA t5AAm 5r N5 BACpD`D-8 @m    @mf )  Z@ @- @m ̀ 5 Z u- u- Z wfw R~ Nf wHx.D ̥̋/  ' F  x. B f f @w Ҧ  Netv .eww '   J ZҖ%ww ~N   x  FZwjN  N w </f  ?ff )%=? &f )%Nff )%ww   D ewإN w D  a   a  ww  5 & %5huj *-7 fjfh %~/f  5$ ?f fe )%_X/ _/ _/ 5 _J/ J_X/Nefef ,%Nefe + wNe V_X/Nlfe 0_h/ .l _h/ C%  /   g  |u 7Nl ̀  L7BNl ̀  u m ?fl m& )% * Nl 22   fflfen T0e & & 4eNe 5 N& , 5l_Z. _-  ʧ 2 _6.%  Nfef )%Nfenf ^)%_8.K κe & fe P*% p_6.& b%5hujR *-7 Jfjfh J%_6.w % ?ff )% wx DC ̋ B-w >DC̋w:Ԥ w DԋCӋC-wD-# w  h'_ 2_&2@`E5 _&2C-_&2 5 ZB`  @  u-@AA@ 5ff X-%% ^,% n5 f  $  hN ( Nf 8͖%_1 h'ww D 'C 5C w& 0e w d@ w%:7@E7 @57 w"̥%"t`5B-A vC vCt`@5 & 5 ew DC  j v 5,W ,i &  wXw DwPw <@%InZ| 7  u H& %  7 #  E      6u7r ww |  w|w hwtw `' vwdw PDe' v9 ' E & + u #    . '& A & D & D%wԝw 'f ww L & ww r  ; wrw ^ N ) & & ;  @ $S5&  ;%N u w&& <%w De ܥ() ܥ)   $S&  ;% uww ~ 0 ww p ~e Ne P 6k   X<^ .w(w De y E 5B ˋˋ % (  v a)& e7  R nI6  |u 2 27 LJ 6u2 PJ pwRw > . (7"7,  5e@ fe f  Ne P    |u 3 3     ,ww vh & %Ef& % & ;֝& ލ% w*w    ww   ww Ҙ   *@e 6u& f& f9%ww x@ ƭ & %E5uf y xff ܌%N :6 $=Rff %ww   ; ww Dt`5B-wȗA vC vCt`@5 & 5 ew \DCeww% & 8%d- -?  J  j= : [ x %  j= Հw j= % #   % #   %%%%%  j= N % %  w%: `0% N %B  %_; _; j= w%: `0  yf P u_;%_; _;w rD   n5  n% % %#  n%  K%  > w( n n%\  n%  %'%"   5   % % %   n $  xJ O _ o } w N@   & ;  ee@ r2 f& 4% ww .L-t-  t-t-  hv  u uz vww vN ? wtw `N& ? 8Gw\w HD 5 & އ%Ef& ڇ%e Y7 * R  nI6  R   &  eU Z” @U Z  Z rF& (%  hv7 ~wrw ^De5 & 솖%Ef& 膖%  e $5 N $S5f 4A  f N N uw֑w ‘De A ww 5C(e  f v 55 Ne Vw 7N uNf 4A wV ˋˋʥ=N v  uf v  u Rw p5Ce wꐃ ˋˋʥ= e2 Vw 7( uN uw D ~ ~ǎ  & ˥8˥9t@`eE 5Bˋ %  ~w0w  f y  e  ww ֏D5e  & e  @ nE e * B @ nE e C 5uff@& e  w@w ,DueN 5 @E 5B.eE6 0& 5@ & e MQ h0 ke mF sU uh$ 5@ &wu@ : N uWpC  f :E aF  f :E pC&55  m f :E E  f :E   f :E E f :E w D=  NE  ww nD g  Ne& A@A@5u%%  ff ?%& ff ef&l e wڌw ƌD5 5e  & e @& Te  e  wd  B@& e  w DNe& uu %%  s uuuu Ne& #  %%   &s ew~ w f    5& N %8  5& N Newt@ .e-#vt .eh& #t@ .e%H Net .ewpw \5 e c7 NN R BN nI557 . 6 N y5N R#fe x%5 #  %w7  ww7 N hvfe# x%% ww nDT@e77?e7Ne &J7 '  7'  7~xv@P7d HJ  T 5  hv7 w؈ y7w = ww&7 ww D` t1 & S    m& Q p mh7݃ -h ^DX hv7 P= mF .K &  & ! & Q K m\ &T κe m7> .Kw‡w D?7  K   & Q K m & κej mb7wRw >Nf wNe 25  Q + XRE 5 B̥/ rD-̥/ `?\ʥ{ & M  M@?Oe Q  2w 0 5 @e5} { D  [ { } ̋ ̋ C)    ̥̋]̋ E , [g {  }   ! w|     f  fe K *Ne Kw?K mx &p κe m7Z Nef O ˋ˥]ˋ w .. wwNf O @7w RDC>. /_P ?_P [ { @E  w  M 5   E5 B *ˋ!   5%] %-@5 ˥/  ̋ XR & O ̋   / XRNe 2@E%@ˋ  z Q n Kwd?`_Ow DC@E  wԁ #    E5 5 *! ?2 [5 5%] %-@5 ˋ & P ̋  w  DԋCӋ@A@` 57  %  m  me&f 7f |# CԔ CԔww -" @E?շ ?wlw XDˋ wNw :Dˋŀw4w D +˥~U ˥{ } @ 5 B{7Pww D55 7 Ne R &Ne nI76   7  yj u7 b Ne RN 6uw>w *Z @ Hc6 hv@e7(? $@e777 D̋-  y7w~ nV ̥` ˥\ ˋ ˋ˥`ˋ4  6u5@m@f T  5w \~" 5 55 5 5 5 @e5@5  < m2 .2*w|w { @ȥ '_ F 5)5f  W%w{Wp @A@`e @E 5B (  W   w P{D L7~ u@33 Z 33( "wzw zD Z uwzw z5 5 '_ F  ƭ ^ & Jo%Ef& Fo%e *@ȥ-%5 r @g  z  @ - h  N'_ F  ƭ5Nffe( Xewyw y  5 ! @  N ff@& XeN f |Y wy N f |Y @5 w `yD    JZwNyw :yD  44 7 7 n5% % b@-&N bN n L7  u 2   *wxw x@  Z   D-wlxw XxDC  L7z u5@0rB 6u  w xw wD %2@e" %2@e  4!4www wDe&7 B^5%   @ 5PBf@ r y B^5u T Ne 6uw2wwNB5u̖7 B^5 \TVd7NZ B^5 %Ɖƅԕ\ Հ5 @ 5SB_]\_]_b]7l5_]7_]       . >T˔_[7z_[ _[  _\ B^50ՀY Հw*\K G@" , w_[ B^5 %_[_[ԕ\  @ 5Bu"5#D +*T~ʌ_\@ B^5_Z\u_\\FT_ ]7:F_] De_[w tD 7 7 pjɷ f5 @ 5BՀ@!7 @ ɷ 5  7 n wt7 7 7| z7 rɩl n n5$5 "5 bw s,5Deԕ$7 B^5- twfs%{Ԑ7 B^%#%?ԐȬ7 B^Ԑ _` $ * < e_a`_a 5B@N78D B^ 5B*@e!Ԑ 5B3@e!Ԑ7 B^ 5B%[1Ԑ7 B^%   _@e!Ԑ%]vDŽ7nz B^%:*ԐR`7JV B^%gԐ.<7&2 B^Ԑ%  t%{7 B^%}ƝԐ Ne a__w 8q $ &f l e%1  fe N# Ne# #wpw p6D7.: B^5{w5ź@ Nk_pd5 -n -Xs n:_c -5 un~Ō7v B^E t_c55%:"@N78D B^ n 5B%& :5 uBNfefe i% _pd7 B^%*-%-Nfefe i% RĠ7 B^@@ 7x F%: tdHV7@L B^%: n{(7 B^%}L 7w|nw hnF57 7 B^%g7 B^ &H e' h$ p q r sA t x%  n , t(( :@ff f%5W @wm2(t( 7 B^5E 5B @ 5Bcf t N n7gt($7&C-*%(%\lz7dp B^C-%\ԕ\Ԑ@N B^%  n%t((fe ,7.v_ReC-+%(_Re%\7 B^C-ԕ\Ԑ B^%  n_"ew l 5@e5+ |u 2r@5 Neff tg%N 6u  Ӏ @0 fe W%w|kw hk@ e h  q  r t xNf h N 6uw.kDeCt( iB (3 ˋ  & \&   t( 5 t(&  y ʋt( ` 5ف & New Hj@ e^ h+ q  rU t" xN 6u % % %qՀ ’%tC wiN/ tN y/%hN 6u@` ̥.%e 6uN y D-̥/%eN 6uw TiDCˋ̢ ̋ˋ w@iw &iDC7 B^  5 $Q %' *R -3 ^> 5B_j5 PAWp `eu$2?7(=%_Bk T7Y  @  nwdh : LK3 K #+  B^ 5B @ 5 LK   K@  nJX B^ n t"K-  w g5@- 7 B^ _l \ r_m H B_l-``Z7 B^5 _`mAWp `eu^l_Xm7R^_^m(G ^ t n $ 5 5Bt(%(7 B^ t n%t( t( m 7rw@f # $_k %_k *_k -_k :_k ?t( 7ht%?%(P^ B^%  n%t( @ _>lt( m  B^ 5B_k t m A @5 n_kt-f_l N 6 jn_>lw e055 @ȥ Cˋwd N jn uCBˋw @5 @ȥ w rdf  wpdw \dD̥ 7ԹwXdw DdwĹwJdw 6dĝ_n7@ 0?*7e   |e**e" %  # T e wc ܸ ظ θ7 ʸ ĸ%% g V Net@ .e d5 ` ־%оZ%7Newt@ .e (w-$#vt .ef lf % |,'! ²+E  # T  ~ # T 7 %   _fo_nw $b5 _r-- -ڲ-ҲزʲIJwʲ7IJ7w  e-(-$T 8͖%%ܱ wa 7`Vw`Tw NP@@@`e2w , -"(_,s-_,s r rC5:@H fe mܱ`& x%5 N m`& 8͖% r%# j5 Ne~fZ .e8İ fe 0 B-RWt w>787 .v Wt 7w Wt 7w 7 w,_w _ww  5# 5-55w^w ^& ~ e w^w ^7 D ޮA®>& 8 e 2%. |u 7B: |u ?*&  ew7w77ww^w ^DCˋ!w] w ]%2 w]w ]%2 @e@-N w]w ]D  Ӌ L7IJ  u@wz]w `]D upD L7 u5f @w8]w $]T`  w"]w ]De w ]w \D   e w\w \D  w\w \DC@w\w \Nf x & .v @w\w t\ D %2@e# e %2 @e@-N w>\w *\D & P & |u  6u @w\w [ DԋCӋ@A@`  L7 @A@`  u5CԔ CԔ@w[w [DC && e & |u  .v  Fv wR[w >[D̋ w@[ w [ -ԫ-Ы -̫ -ȫ% .Є %wZw Z . . .7wZw ZDC  & wZ & Zx ! .w ZDC   % & wdZ  .& x w :ZDC X%  x  .wZ% w YDCBԔ~wYw YDC  u & .v wYw Y- @ E 5B  @E 5B whYw TYD& | & |u  .v w:Yw &YD ̋w$Yw YDŀ@wYw Xw4n wXw XDC̋ˋԤ wXw XD#fe x%# Ȩfe# x% # T  & z fe# x%wNXw :XDC & t& z wXw XD C 7 &4 ( ) ;+ > |%! f |{ wW   3!U   f |{  zw `WD 5!_}@ȥ(\'f _}@74720Ne Y5 777  N Ne Z> @ȋ"Nf uN v =%2 @e@-N D-c)@0!X@& zO@f } 5@e@-9@Ap@Ap@p@p%2 @AeH N %2 @e@-N  # T wUw UDC %2@e# %2 @e-  wvUw bUDC & tN& }%w ( ) >& |D- rNff ~%wT   |t-U &  &N&f ~%%%% |u ! U! |u 3 Nf& z}%3  w S 5 D  ( ) ;D-Nff %wS    |u N&f %3Nf& z}%3 3 w BS D  ( ) |D-Nff 8%wS  |  |u N&f 8%3Nf& %33 w R  D &  x D-Nff Ԁ%wtR &  |u N&f Ԁ%3Nf& 8%33 w R5 D  ( ) |D-Nff %wQ    |u @U5C- &UUN&f %2C-&NUf& Ԁ%2w .Q 5u-D :  xD-5  D (A )E <I >F  D- 5  |u f |u 535 @ȥ)5 5  D_   t-& t 5 (H )_ <_B >P I>St-U &  U5 _0t-  & Ut-R _   5 _ _  6uA Am  __Ą " ff }%3 _ք 5& t53  6u37 <Ut-T& t_b55_f5  _f 6u3D-_Ђ  4 wNw ND U D x %2@e" e %2@e-   ܄%2 @e- %2 @e- %2@e! wXM ܄ ܄w 2M ff FeDI   ff GeD r< 0 D r<M   r<DK  0wLw LD r N r &P %wLw LD5% % % % ^ Z%?U@E?F B% %t)6 w6Lw "L("w(Lw L %(N< .  )Ne|t@& .e 5Ne~t& .e& ZҖ%~((& ZҖ%(t~wzKw fKPNefe Ȗ%%7 % 7w&K-  'U F  Ĺ U ʰE @%UA vE@4[5@@'  &e eAe&P~ @%"5@E%U UA v5U@EA vE@4UU5 5@0 -' %' F  Ĺ  f& l&l(@ &% U@\!E- 5@E@U@5_~5U!, 5  , &  55@_~6& _~_~5 '/ [ & b 5_~ :_~Uʘ_~w H7 '5"&  =%5uE& b 55 :ff <% w.Hw H&  <%5uv) j u 1  b  uff h<% >wGw GD4- E%^ !&  <%5u & ;%Ef& ;%5 \!5ff ;% — #vt .e5R *& 5~ & b 5  | r  5 : 5  5 U5!N 6k d J :w2Fw FZ&  :%5u 5 & :%  ff :%7wEw ET  : wEw ED  04-  -|7 v  3 3 E!-Zޛ  œ  :w:Ew &ED-&  "  7 - 7wDw DDl |u s 535 U@)7  f? 5 U5U) 6u3j j!3 `3 VP3 F@5@-0F"s ZP1`%   $)r  @ @-u s -w  &" e wCw vCD _~  x  f 5I F5:95N @  e  f  x  f2  5 3 5U   wnBw ZBN %Pa%P Pe N| 7ar7alwBw B7 wBw A7 wAw A &ژ5 4-        ~  77wAw zAD4- - 5@E@U@55 5]E55!_%( t_5_  5_ 5j  5 5U 55 5-35T 5@'•@& * @' %&  ( 5@5%(s1 e&e&e. e5-1%(r~ 5 %@& 4 ' %&  > D-_5@5 5 N @wX?5!%(Br~ 5(D-!-(+--  & e 5   5_5   8 5  f  _C  5_%_% _t,5_w =D\@e.&P~@e.PPPPefe eefe ؖ%u-u-u-u-u-u- @eAePPPP!.fefe. ew8=w $= F>e @ f A UPj  @-4- E& b 5 : -w e w^w6)%w4w z4%*K  h wh4w T4D$55 _B5 5  _0 xE% & 5  _B5N Ԧ5  .  ._0 k ` _& t O$ ƭ4  & y U0$& )&   U &   U & y %% x2 55 5_ 5 _%5 N& r 5_&  '%5u55t5d5ނ̂ 7T7L7 J &5 ff &%9  Kw wwwwzwvwrwnw\ u7 ܆܆ u7 ԆΆ u7 Ɔ7  hv7  hvf ff &_5%5     5   #5"057*J         `%.5    Nevt .e  ހN& ̀7 ƀ5 5 & & % "5 N .@ .5  5 w/N f& z%5 N .@  . N& B3  3% & Zx 7 Zx 7 Zx 7 .7, EpPN& 03EZUpPNeff& eEUpP 5 N fef& e_0  EpPN& 5  5 D _0EpPN& _0 *EpPN& 'k F  ƭ  % @ _B _0w -7  hv7  hv `wv-w b-D}_Ц5_Ц5A .  $S u  2+ '5N XN .@ .5 %}  .  2 } X .3  $S u5  2+5'  5   L  5@| X .5| X>|w,w ,D & x & x 4   w+w +D4Ne& 2 @E%   w+w +D e _5 E 5BE 5B ;@E 5B2˥[ Ne  ˋ (  & =e =  &e  )  v5'ff D%e  6uff 橖%  6uf N f  'N   .\f  ' F N]L]Gf $'f F 'f F  'f F  4A f f f X_rwV)w B)DC E 5B Wp @@`e ̋ԥ] w )w (Nf " @ c uN $SA c1w(w ('f N y% v@- w(w z( eDe  _~55 E 5BE 5B5!U@E 5BL̥[ Ne& ̋ De52N 6u5==+5@& t ű @& t u5 =Ne& =(#Nf " 5@A @`&@& %ff 橖%'f X%&@& %f N f  'N   h+%2 @e@-N = %2@e! @e_wn&w Z&N 6u@ u@N P 6w2&w &De5=Tu5@e<>@eT Ne P   6w%w %DD/ _\ -ꁷ   W 3Ё ́  ?D/ 6uw`%w L%D%  r   r e0@? w*%w %D 5 ̥+ ̥-  E 5B Wp @@`eE 5B̋   w$  w $Nf  w$w l$D  f p wX$N& P w ($DC@&   w#w # L7y uN t N 6u@ 4 '&f D%w#w #D7 x R x nI56  hv hv7 vxNff %wX#w D#D @@ f  hv5   a L7(x u aN 6u33 333 & %@  Rw"w "'f ' !U^U' 7Qwd"w P"D  @& p  7bwe w&"w "'f N y w!w !D hv%2 @e-    2! 5 `%2@e! f %wR!w >!f w& ww w )wv ;ew w0/Qww @x@e5@e57 x=Ne 2 f w uuf eNefe 2pNef u-$u- N 2_F _JN 5N 2}-(N 5N 2Nef Nefe u-u-N 2Nfe \  \ 5u-u-uuf eNe V5_ _ַNf @_w DC  ̋`>w%8w# w\%ww(wZw*J ww D      + - ̥9 Wp @@`e̥0  ww D5 5      + -! ̥9 f& ff Xeee@ ee@ 5u̥0 A@  w<A@w:ww %Vwuw uut7uuWpwuAwpuAmu% Nf @mu5uBmvuB-"C-Dm`u5TD-um@u@5@- wb "uӁNuf umuu-Bmt B-т̒tC-Lw  @@5@t (  vwptAmDu-t6B ~t@jt5 \t N @tC! 2t5ԒS DCtUtC-f sms5D-/+D-!Cms@5&@5%3-sf 5u0B55s~s5R DD-N& VsmNs-JsN& -2s_wZw FD*\5% %-%+ 5 55 55  B5eA5 !%.55  B5eA5 ! %E%e$%+%-  Wp B`e!  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& de5 55w6 m 7Y"cw TD j5u@-A-/A@E5u@E55  ff& e4 4 5- 5- 5w&& e& & \%ReR$b @  1  L "@! @#E B Ew B* ZҖ%w<Rw`wwpww 4De _4 t4 t t4 4t Ne&& ǖ% _4t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 N 55 Nefe ǖ% & %5u7 n && ǖ% n fe ǖ%ff v% fe& ǖ%wA@E f& Fw hnww D Lԋwxw dDC 2n wX5 7n@  55@- 7 m5!!ww De LN 4eHe` d  4eK Be v Nfe &Ȗ%ww x-V@ `wrNM0 Ŗ%0je& ;eww *u@t5050@ 5X1Nefef ǖ% (3A@u5Btr020@ AupX1 fef ǖ% u-u-u-@ww r& f eB B`@ `wFw 2 fe @w$ @pHA@twr uwl w Nef  w w D 5  ="i& Ɩ% `5ȥ= h = @w~ e  w Z BuNefef %=@@w. Ћ Ћ   Ћ Ћ  Jҋ~ @@w D .4 4  w w  f 2 %  .P L4 4 wZ w F D 4-&4-!4 4   &e & 8͖%4    w me   s lt  &w* W f r @  W f r@  @ < w Sw mow nlw e& 7 .[7&[gw [iBi [I I7:[Iw Nff ew w< yw6 &  4  b '     ` TW ~  s`K6!  w . D85U5_5P_ Z mZ@e4 ,5Ne &   uN L4USt%"5X" j5X" j5& & 8͖% 45@e-4  % U5EU  w E w D & +   r= wB w5 a U5ff 2͖%ށ̥a &  e 3     U̥r 33  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef % jU4 4  fef %5 wL    6v&  @ppC`p   6@Cw*w$w D j & & e 4E05Ewp7U Ћ P ы A@PЋ w D:5UE5Hw _P5uNfe & ZҖ% _PbNe &   uN L)U5| m- 5 & ZҖ%St%" S U   & ZҖ% S U _ @_w rDE%%"5   & ZҖ% U w& w D55@ j  . 3  4 4 4 4 4 ww.w  ra$"5+ R &5e-FaRe %" & $a    |u wHw 4 D5f |u 7` f |u 7Rw@ m`7`"`%"e w  ` `    |u e-p`ww D \`"5 e %"w~8`  5 e-`w F FwJ ~5 & E        ~5>wlYwfw Net@f .e  w6w.mP& E%PmP%w w7P*'$!     .P 7$P& AP& BF7!OW-*7O& & e Ӌ "# &7O& e Oӕ-Oӕ0B~Oӕ.  ӕ0~ B~"#&7TO & e :Oӕ-0 .Oӕ."O B~ӕeO ӕ- ӕ+ r e0e0Sw Nefef 5& Re C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& ewxw d fff 5& ewTw @ 5 %O N  = 1555Ne5& e5255'0Ne5 B& e57L Be0" 5%255 5 B5@B e1 a=%17"[1wX %25 B5Ne& e55e0%27'[`Jʕ0%1ʕ1  %1˕0 ʥ9 6@~ _ n_ n_ n_ t_ t_ t_ t_ n_ n_ nR_ n_ n_ nv_ n_ n_ n_ n_ n._ n_ n_ n_ n_ n_ n _ n_ nJ_ nB_ nV_ n_ n_ n_ nh_ n^_ n_ n _ n&_ n_ n_ n_ t0_ tT_ t_ tv_ tD_ t_ t&_ t_ t_ t_ tw Dh& *J p7bC-% 7B# \ k    I  6u    6u    6u  '. Ε &N D% nb r 67vBw v 7BNe&  ǖ%w|BNe&  ǖ%wfBA   e R˥-N ˋKHHV " xPHˋe % * e7FA7b$XHAVHAA@HA,H&H H  G- * & 2 7G@ 7@G& x 7A f A .e7# eG -@ & Ԁ%  f@B@s <@@  7 @"@ @ @ @  @ '& %#  T@  7:@74@72@.@?_2@ȕ-F r & % ֝F_2 f?_2    * !? x?  5& N #wt@ .e W%?S-??#t@ .e B%>Net .e>>> 7>7>#vt .e>&  f  D%& .e d>= ~>=v # 7=D3D0D' Ȗ%& "֝D  = == z= ' Ȗ%& " @ ~D rD >= ,=  = .з = n r &ww v=&r=& #vt .e%N=%F= #t .ew~w j  C˥: ˋ&e |u C ˋ " 5˕: 5%:  N 6u `   ` 'N D%ww Nf v & & %& x  f  .e u  *ؖ%ww xDt;5T@0<;@@; < _N; .Ne&  -;  @- ._#fe x%5 ; & nߖ%5u#  %C#fe x%7 v; wn; wf;7`;7T;wR;*;7$;7 :7 : 7:7 H?7 &;7 ?7 ?w7|:ff ޖ%  ^:ff ޖ% C  m: u -:: ufe# x%: .wz:w:w:w>w>w9w>wl:wwwn:fe# x%% wfw R@Y' F ȋP' F fe ^fe fe L 5%-95799w9' F fe @e78 XN .wZ9w8ww 8,   78'  ' Ö%& " w4w 跊P8'k F  ƭ *ww  *ww  ww & xܖ%5u8Ef& fܖ%777   A@Ef& .ܖ% J D8!>8&  ;%77p<7 j< hvZ<7 T< hv # T \7  ww #fe x% (7<7< < # 87 7 & hۖ%Ef& dۖ%( Z ܄ 676fe# x% # T 76 @676fe# x%wNf6`6p6 ^6 b;  f-66-66 7 N6( Y  >66'  6( JZ756& `ږ%  5 :( V 55 5 # T ( z (: z}% 55 5& ( Z ܄_w D5e  & efe Ne $S&  "ߖ%& x  u   f  .e@&  *ؖ%ww >'  _Ne  v5  2y   ƭX5%A m4m4@ 5 __u S_Ne 2Gw->4w-64 5  2u-.u-)w-Z4w-R4 w-H4w-@43%"  e w4w3wV2;' %w $N Bw f w 7$3 f & \%73& .e f  6%7t3& .e f  %7P3& .e f 03 ꇖ%7,3& .e :whw T N `wTw @ 27'' F  ̭ X7   ̥̋\h U Z?  ȕww D/ t 5 $S57 9<79N u'N 5/8 ݊67 6e5 R n6 N nI56 55 Nfe Vw 57b6 RN j7 1117 1& Ֆ% @ BNJ v 5761N B55 </0AWpAmEuEtAWtAX*@0( Nf J N v r5N J 7 b5 u ;e  z;7 @57 >5N uN u @ww P75 H7B7 @ ww Df ^ /   h 7  7`6N 6u76w'b < f 2 5Be'b 'b F n 2 %fef 8͖%%#RN .L Vw 5 uf ^ N w D L/ r/ f/ & y . wtw `'  4|.N u Z7h.w>w *>5 'N 5T. 3X* % +u$@ȥ/ V5Nef @E%@N 2e wN  . .e BWpAmEu@tBEBtpX*w 67|-w>w *8m8"8m8 f&d 8 ef& eNf8`8Z eww D5 5  ff e`E@55 ̋@ww L 8# @#& Ne Ne@# wZw FNe& NeX NeXfe  fe 8#fefe@# eww D e & t ƭ5N& & %ww DC& R e&e R , ,&e& eH v uee5@ b2lJ ee w w DC'   f& ef&d   f& ef&'  f& Def&d  f& Leee@ ee@ ee@ 5u' 5' @ f&@ f& ef&d @ f&@ f& eee@ 5ut @   ʥ%  Z ʋ Zw D  x Z eed ff ef& 싖%  ff d ff ef& eN *((* f& e.,,. 5uff  & ff f& "e  ffmm@ f&ll@   ffmm@ mm@ f&ll@ ll &$$&_" "_2002_6446_w ^Nffe ؖ%ff ef&ff D e w"w @Br`J `@Br`r 2`@,,@B@eH @@B ww @B Br @B Br2@  @e@Bp ew6w 4$ L C w5 4@E%@EU5N&e &e Nf&e 2͖%4 IN&e &e Nf&e 2͖%  (Ne&  ff eee@ 4t@t"4 4t . _w N .@ .N ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4tww D55ff %f&& "eff&e e &e 55 wLwLT/w5 5 w jD5#@5ff T %f&& eff&e *ew&e j'44  && ef&& e&e & ZҖ%%U w D5_>?o5ff %f&& eff&e Ze L&e j8f f ff&e V e 744  && ef&& e&e & ZҖ%%UU>w @@m e%fe  &e 55 3ff `%f&e@ &50c &e 55 3" * U44  && ef&& e&e & ZҖ%%&_*fffffe e _*&e % _n_*e_n  mm@ e@ f& ef&& efe& ZҖ%%_* (_hw @0 0 @0 N "7DI7@IX/ww D85_.Ne& q fe e4-4-/44  && Def&& e&e & 8͖%%&e &e 55 ew\HwXH\/w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4t4-4-/44  && ef&& e&e & 8͖%%&e ww D4- 4-  w & & eB & & @ > 4@ &  bؖ%7@w (5;f 7? w P wVw B t  wDw?w $ ?? j7 ?  ?? 7 ?w w www  f? `?@ E wF? 5% %.?/ ,Ȗ%  / =/ x 7>@& x 7>C& x  Ĺ7>F& x  Ĺ7>I& x 7>L& x  "7>w>O& x  "7>w>R& x 7j>U& x 7\>X& x 7N>_w ">  w  7 > = 55 ff= e55= D/==l/& p˖%en/& p˖%ep/& p˖%el=f=`=Z=|/& p˖%e7F=w v _[ _r_vg5 & f 2͖%5=< "5u fff e5 #u 10f 8͖%5000 :=0jn>==f>=====~>^>===n>            b 4DP7:t49B t4f?j69t4t4Hl7R 7 |?~6 _X5* C B525$)J4/T63= B HOd: VV~@]cjovGw6 ~FB 5FFA88 B s    w 38?CMReiy~ !&;>KPgl\\\Z|܁>( &̞ t1޳|TBδֳTFOT_ c ]!^(2 ..ZZVZZZjZBZ 0R=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired /etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwdMemory allocation statistics %s addr %06o, len %5d BUSY addr %06o, len %5d FREE %d used, %d free, %l end dirshome-lUsage: dirs [ -l ]%s /~%sNo home directoryCan't change to home directory./../cdpathNo other directoryDirectory stack not that deepBad directoryDirectory stack emptycwdAmbiguousUnmatched %cWord too longargv$< line too long10No file for $0Variable syntax-*Subscript out of rangehtrqxeBad : mod in $<< terminator not found<<Line overflow$\`. status%s: ||&&^=<>Divide by 0Mod by 0Expression syntax!~({{ ... }Missing }erwxfdzoMissing file name nobeep %s %s. Yikes!! Too many %s!! names in password filefiles '" ;&<>()|^%fignore%job%job &Too few argumentsToo many argumentsCan't from terminal-aliasunaliasToo dangerous to alias that/bin/loginNot login shellEmpty ifthenImproper thenSyntax errorNot in while/foreachInvalid variableWords not ()'edNo match? defaultthen/endif not foundendsw not foundend not foundlabel not found-nPATH%o Improper maskcputimesecondsfilesizekbytesdatasizestacksizecoredumpsizememoryuseNo such limit-hhoursminutesmegabytesunlimitedImproper or unknown scale factorBad scaling; did you mean ``%s''?%s %ld %s%s: %s: Can't %s%s limit removeset hardCan't suspend a login shell (yet)Switching to new tty driver... noglobnonomatch{}Unknown user: %sMissing ]Arguments too longPathname too longUnmatched `` ... `Too many words from ``historyUnknown flag: -%c Usage: history [-rh] [# number of events]%6d @allocbgbreakbreakswcasecdchdircontinueechoelseendendifendswevalexecexitfggotohashstatjobskilllogoutnicenohupnotifyonintrpopdpushdrehashrepeatsetenvshiftsourcestopsuspendswitchumaskunhashunlimitunsetunsetenvwaitwhilelabelHUPHangupINTInterruptQUITQuitILLIllegal instructionTRAPTrace/BPT trapIOTIOT trapEMTEMT trapFPEFloating exceptionKILLKilledBUSBus errorSEGVSegmentation faultSYSBad system callPIPEBroken pipeALRMAlarm clockTERMTerminatedURGUrgent I/O conditionSTOPStopped (signal)TSTPStoppedCONTContinuedCHLDChild exitedTTINStopped (tty input)TTOUStopped (tty output)IOI/O possibleXCPUCputime limit exceededXFSZFilesize limit exceededVTALRMVirtual timer expiredPROFProfiling timer expiredWINCHWindow size changedSignal 29USR1User defined signal 1USR2User defined signal 2Signal 32Unmatched Expansion buf ovflo:^$*-%Bad ! formNo prev sub Bad substituteNo prev lhsRhs too longBad ! modifier: Modifier failedSubst buf ovflo-$*Bad ! arg selector(=~: \ }No prev search: Event not foundReset tty pgrp from %d to %d ignoreeof Use "logout" to logout. Use "exit" to leave csh. Out of memoryUndefined variableAlias loop;& Too many )'sToo many ('s<>()Badly placed (Missing name for redirectAmbiguous output redirectCan't << within ()'sAmbiguous input redirectBadly placed ()'sInvalid null command%d:%d%d%dchild BUG: waiting for background job! BUG: process flushed twice( ) || && | ; << < >> > ...[%d] %d[%d]%s %c %5d %-21sRunning Exit %-16dDoneBUG: status=%-9o | (core dumped) (wd: (wd now: ) Usage: jobs [ -l ]%s Bad signal numberUnknown signal; kill -l lists signals%s: Already stopped Arguments should be jobs or process id's%d: There are stopped jobs%%%+No current job%-%#No previous jobNo such jobNo job matches patternNo more processesNo job control in this shellNo job control in subshells+-/dev/nullnoclobberCan't make pipe%s: File existsMissing )histcharsuserUSERtermHOMEfilecSubscript errorBadly formed numberNo more wordsWarning: ridiculously long PATH truncated /usr/ucb/bin/usr/bin~/.historya.out/bin/csh/tmp/shverboseprompt# % Warning: no access to tty; thus no job control in this shell... /.cshrc/.loginlogout savehist/.logoutInterruptedmailYou have %smail. new %s in %s. New mailMailCommand not found/bin/sh%d hits, %d misses, %d%% %Uu %Ss %E %P %I+%Oio %Vov %Wsw%d%%%ld%ld.%01ld/getwd: can't stat /./getwd: can't stat .../getwd: can't open ..getwd: read error in ..getwd: read error in ..//longjmp botch longjmp botch : Unknown error: %d2BZd~".@O_n .:M^t9Pj 7[|&;Np & 8 J ^ t RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB 122=(\0\lZ f>@BDFR0CR0C0 T e7cce7V / 5  7%  XLw O,f2bdwd e%_@ȥ-_ e ̋ r y$87$m 07 m̋ 9 FG 2N j̋ O FG 7\ T J     b FG%   _     _    _% } FG Tw@7     FG & ZHt C  FG Z B= L ZH| 4 C  FG  B= E%@ >E%@N  twMw LD H  6M  FG D vH wLw Lu-@wL@w Lu-@wL@w ~L b\ CP XLwtLw `LN 6M $wXLw DLNf N  w8Lw $L FG wLw L% ( FG j%   Q FG 7$@ vH  m& ZH m~@ BH @ BH  mZ @ @ %0 %@  5 5D_ _ V &   f e  &   f e     f e | t r j f e X P N F f e  _    1D_ | e | e _     & ZH 5  U h %` &    8 e F U . %&   54 vH ( vH  e w,Iw I 6M= ! FG  XLNf vH D ̋ԕ/=wHw HD 5 7L=2 (   : 1N@@ &f @ @ &f 1e< 1? 1 e wTHw @H%  5%  5@f@@ &D 1ewGw G N B5 V FG N B= 45  N B & f b,ef lL 5 8] FG .C ta3   6M3  v FG e vH N B@ta0 N B f& 1ewFw F@@& ZH wFw FDr5  vH v vH  d &H 5T B=_  H &H 58 B=N_ Nef L Nef L @E5@E5%%_ u-_ %@u-M%@] _ %_  1%Wu-Bfef ,H%fef ,H% * ( &   @`A`p  " u-N N   UN JN JwD %N JN J z@ %\ 1 pj@ 1e %&  1w RD wz J G$$ AeNe 0 r!5% * FG v # JN "-N JN J (-  (-  B= * !5% < FG '  JN "-N JN JF (- 8 (-  B= N JN JNe ,D@-Ne ,D%wCw B & f 2Hefef ,H%%(@eAeP~%%%  %%% ӵCe wvBw bBD̥. .    ZHw2B w B d (- j FG  B= ` XX7^ E%@  7 C_$q FG t`E%@`^  7T L CLx>4 ZH & ZH  FG 7 C$ ZH 7  C  FG  B= < E 5  FG  B= v E 5 FG X B=N J -XD-R@Nfe .1eNfe .1e "   N JN0\lp f>@BDFR0CR0C0 J7 _ @`A`p !N ) N )  1%N JN J N&  N  N JN J             le e   7 f | x l d %^ e Z  7P D e  ~7@  ~76 0 *   ne zN zN e  ~7  m  L zN zN et ~7  et ~7  %  1 |w >w =` = ` = ` = ` =  @7 -   FG r B= fe& ,H% JJwn=fe \O%! w >=f ZH  FG /f HB 5u NfEfe AeNe w( @ T@ 0Lw< et&  taw `<7  --tmWtmp,7  -~-nxtmZ`hWtmLp,   ALDt`pX  AT*(p\  XWt@`  0!\ %w;w r; t @m0  D-0C- -t@mWtAmp,t@mWtAmp,t @mt @m0 D-@ t@m0  C- & @m WtAmA Ht@mWtAmp,  @m WtAmH @m w:w p:D   & & % i @m5a@ @m 55 5AWpmq-?N& %5@ @-@ a5 8A aAWpmZq-@ a5Nf %A a uu @ @m5 C-w9Nf %A a  w R9 WpN  7WpD`Ltt w9w 9 A AmAWpmzq-@ u- AmAWpmLuu-w8 C ` !w 8  m- !m H -A m mmHWpCm w48w 8 K E 7j B= zM E 7L B= Zb >e^f&J5  u55u m  (  5`u`u tmpH -_ m  (  5`u`u tmpH  _ _ __T@ E_@ TD5eu eu _Tm_T@m_T% eu  @ E TDm% eu  @ E TD5m`AmH_  m %  (  5`u`u %  (  5`u`u tm>pHtm,pH _~ V%  @ E TDeu m@m%  @ E| TD5eu %  \_R TD J_@@ E_( TD @ E TD5  m %  (  5`u`u % _&_ % _&eu eu @ E (  5`u`u tmpH -hN JH Jw3w 3 U D-D@59t@m5,tBmB-(@,","@5ruJt5u-Ї D- rw23w 3@  ~t@m aWtAmH C-  @m aH C- zNw2w 2 @ B A AB@ E@ B TD%  ߀wx2w d2OD E 7Q4 E 7? @ m p%_@D- m mA H   mj 5  mR  C- m<  m.f& e D- &  e%(_ @% wX1@ E_DF% m mA H  m   m~ 5  mf  % mP  mBN& e %52,$ -$&?%  z& H  TD_ Ӂ?z&Ew (0>% u-u- _$ G%@S 1 Ne C fe : &[ 1%Ne C Ne T5e 1  6M7e7e7 u-u- c u-da5%7-- @`@-  @`@- \ epzppp _$ _" xXhff $% :u-a u- dc? B5& - u-a u- dc?%  z& ߾zu-a u- dcE& H jf f $% n8 h d %"ff0 $e u-u-   Lz -  6_$$_($5 - ?%  z& H z  u-a u- dc? B5&x -x u-a u- dc?N%  @z& 4zu-a u- dcE& H lff $% _"5 - ?% _"_"u-@ @ fn 1%_"@@ fv 1%u- _"@ @ f~f f8 $e %`%X u- z - X Pz FG%7 @wl+w X+u-NN 1 u- Nf 1%w.+w +   @  5%_& _&N P-5uu-@@ t@m@5 f , A @ EN TD? L%^]5' -! A @ EN TD?%  ߪz& ߞz A @ Ef N E& H D-u-_'%x=  z FGe% ^^ TJ  6270z FG%@ 7D_' t@mf&f .et@mWtAm@5%zf - 5  K A @ EN TD% R fO 2 , $ 5 - ?% z& z H 5 C- D-_&  z FG%7 w(  ߈ 5t -t ?h% z& VzE H w 'D 5 Pj Lg HA 7%$ wx' TD% A@ f&A@vee@ 5uvAm@E`A v5`u`u e ́   %  TD% E v5`u`u e       TD      8e5 E`A v5`u`u ew <& & f .eNfe .1e%(@eAeP~%%%  %%% ӵCe w%w %(-&_-Nb F 5mH , 5@, F 5m , 5 1ff $% 15 @H, x B-c!e-\ K\D@5  da5af& f $ec & $e 5e-vf  $e 1ff $% 15 j@p, T B-c!e-8 N`D@5  da5d ff" f $ec%(f $e@ 5e-+Nff l $ede7`w"wB")w<"P ;ew&" w"w "D  5 & & 2He5u A@wT"5 5 5@ 5`u`u w !DC E5<E@e33. @;E  5 , @;% & fE H 5  JU3 3  wN!w :!DE5_F0% _/ _/5`uu '& & 2He5u%%w  @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & 2He5u %%    TD%%%_*/5 J5 5 E4N ff & 2He W _*/%_/%_/_*/*J ww D      + - ̥9 Wp @@`e̥0  ww DC AupB 4  & F%b TD5% 傎& F%`@ @m A &@w@  w "zfef P%5 w w %Vww zxt7rlWpwhAwp\Amu% Nf 3 @m:5uBm"B-"C-Dm 5TD-um@5@- wJ ӁNf mu-Bm B-т̒C-Lw  @@5@Z v vwpJAmDu-@6B *@5  N C! 5ԒS DCUC-f m5D-/+D-!Cmx@5&@5%3-\f 3 5u0B55.*5R DD-N& m-N& 3 -_3wBw .D >5u@-A-/A@E5u@E55  ff& 2He4 4 5- 5- B5ww D Lԋww N 9 j5ww tD el&&&&WpeDf Wpe.f Aew6w "5 5  AaAE f&A@vUU5u %ww D w̥/ 55 H&f : e %Nfe vH fe BH fe BH ԥ.̋De & <= & &H %fe0 ,H% J %,@e05e 5wNe$ 5wNe( 5w%rx_6 p_6% d_6%2_6PWpfDWpem>e, _6@e\5 N 5f&te - @ E3n! - *te"5.N 5f&@.e@.A Ep@.A Ep - s0# -n30# ^n!_6 -N t-B"_6 -20#77te"5  e0#7΃ - _6@e0#7w  Nefe >w 7 AWp@7 7  f Z? 0# vH 0#7H7B w 7 n7 7 7 0# vH 0#77ww  @̋  6  6  2  wTw @  @55 w-w-  t " -  t5, 5, - m!ue"&&fe Xe3 e0#phe0#3ww v& f ewbw N f#Q@f&  e5uQ@f&  e5uumumu _;eeQu  %QQ eu % ff h et ff z e5u< ff 0 et< ff B eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpelu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw!w"w De LN H4ee =  H4e Be v Nfe ND%w*w -@  wN~# A%~#w u@t5#5#@ 5$Nefef C% (3A@u5Btr#2#@ Aup$ fef C% u-u-u-@w@w ,& f 2HeB B`@ `wtwlw  @!,& *B   w 1&R$ ?%7G˕,R$Nf Z? w D  !     +  wPe% - r<N r<&@&]R$ AeR$ ~ ~w  Nef (@ ww D 5  =*& rB% `5ȥ=  = @whe  w H Nef @@w<w " f @@w w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef C,5@ 'Nej C %ʕ/  f &H% %% wDNef Cҕaʋʥzmʕaw BuNefef P%=@@w Ћ Ћ   Ћ Ћ  Jҋ~ @@w D D J4 4  zNw4 w  f &H %  JP 6M4 4 w w D 4-&4-!4 4   &e & ,H%4    w me   s lt  &w W f r @  W f r@  @ wx Dlwh e& 7 F7>gw: w  & f HDew w yw w D85U5_E5P_E  m@e4 ,5Ne & L  uN 6M4USt%n5xz J5t J5& & ,H% 45@e-4  % U5EU  w\ E w : D 2 +   r= wB w 5 a U5ff &H%ށ̥a &  2He 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef P% JU4 4  fef P%5 w2    6v&   6@Cw8w27@ Ћ P ы A@PЋ w FD:5UE5Hw* _J5uNfe & \O% _JbNe & L  uN 6M)U5| m- 5 & \O%St%z  L U   & \O% S U _H @_Hw DE%%"5   & \O% U wv w ^D55@ J  J 3 zN 4 4 4 4 4 ww~w  $n5+ t &5e-~Ve %^ & \    lL ww  5f lL 7 f lL 7wX@ m7n%^e w       lL e-ww D n5 e %^wp  5 e-Vw J Kww  N bOww rDCDpC 6M L wZw FN zNwJ ~5 & E        ~5>wlYwfw Net@f 0Me  w6w.w  ^$U7P$U7F$D$@?84U ew dDE wZw FD5 zN 5N 6M!w5A vBB-  }ee@ !ۃ `!ւ ` `pm & E%÷m Ç%w w7*'$!      7& Az& BF7!\W-S7Hw 8uDAB %u f& & e w5 5  W- W00~u5  .lufBw* J@B |_Q@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& H z   5 , @ :% & f E H  (˥-%0     ,:% &  H 8 5E& z   5 , @ :% & f E H  w/bin/diff/usr/lib/diffh/bin/prjFILE1FILE2diff: -c: bad count diff: use -Sstart diff: -%s: unknown option diff: two filename arguments required diff: -h doesn't support -e, -f, -n, -c, or -I -diff: -diff: diff: ran out of memory diff: files too big, try -h !diff: can't specify -I with directories diff: warning: shouldn't give -s or -l with -e diff - Only in %.*sOnly in %.*sCommon identical files in %.*s and %.*sBinary files which differ in %.*s and %.*sCommon subdirectories of %.*s and %.*s diff: ran out of memory : %s Only in %.*s: %s diff: diff: ran out of memory diff: out of memory Common subdirectories: %s and %s Files %s and %s are identical Binary files %s and %s differ ed - %s << '-*-END-*-' %s%s %s w q -*-END-*- pr-h-f%s %sNo more processesdiff: No more processes   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?`abcdefghijklmnopqrstuvwxyz{|}~`abcdefghijklmnopqrstuvwxyz{|}~*!*!"""#diffhdiff: diff: diff: --diff: can't specify - - diff: -diff: rdiff: rdiff: Binary files %s and %s differ No differences encountered /tmp/dXXXXXdiff: diff: -diff: can't specify - with other arg directory %s/%srrrr*** %s %s--- %s %s,, a%d %d d%d %d a%d %d < --- > . #endif %s %d%s%d#else %s%s !#ifndef %s #ifdef %s #ifdef %s #endif %s *************** *** , **** ! - --- , ---- ! + SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d  ( : L \ h z  ) = Q p    8 V u  6 T  & ? Y u -:Nbu8KdRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator  ,!h%)-159=AIMQU YTZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d. ((((( AAAAAABBBBBB $$$QdPo QxQfQePgQcQsPlPL Qu$QDQOQX6QU0]li : "$&R0R0䣚0 4rp e7cce7:u / %  7%  ,w /wtwtZutt4e7t>JVKJ)8 TKfr`e7zt7 7 7 t7 ntf7)7F==%Rt\ ,X x 7R8t 4t  ,ett V' 7V  tR >(% , 2 *&  7  X7essȥ-e sF >(% sss s  nevs ps7  fs R >(  ,$rI l >s  F * ,wR. sses w (.0snf  _ # _ n_ P6_ l< f< ^<X<_ #L<_ ;@<H -r fR >(% ,?!H H_R >(  ,S fH? bHL\H,;;;> ;DH0-0 fR >(% ,H -r fR >(% ,G0! GG0 -fR >(% , ; ; ; ; ; r ypDq >qfGep.ueXG-TRG f*R >(% ,?2G:_f_  G G  f\R >(% ,eF-F f R >(% ,?FD: @:ȋ_ 4:;_ffR >(% ,_ F fBR >(% ,9 9ȥ  9$ppe f.R >(% ,9 9"o 5 fOo0 oeo-oo feR >(% ,@E _ E E  f\R >(% ,\9 98 8ȥ fR >(% ,XE0PE _^>E \8 88 8ȥ E E  f\R >(% ,\f8 `8\8 X8ȥ D _^D _^D _^D _^D D 7 7ȥ  775 \D _^u@5@(% ,7 7 x7"m 5 CAp _^@5 u@5|mC rm0 ehm-fmbm_^fz_L~C _^pC _^bC _^TC JC  f\R >(% ,6 6ȥ __C _^C B>_^B B _^_DB _^R >(  ,BB0- fR >(% ,tB -jl fR >(% ,g5 5 /2B p5 5B P5 5B wz5_^ p5l5 h5ȥ fR >(% ,% @5 R >(  ,$5Wp(e_^ ߀4Wp(e(% ,~4 x4@p>_^@ ^4 Z4ȥ fR >(% ,% 24 R >(  ,4Wp(e(% ,?_ _ _ _ _f ? _^ _ _ _@ _ ^? 2H 2J?0B? -8i fR >(% ,- _^f_L _ _ _` > T2 N2>0> ,-h fR >(% ,>0!_ __ _ _` d> Z>_ _ _z  _0 _N _ _` > _^ _ _ _` = fBR >(% , g AR >(  ,g =.u?=f  f 1_f=0 w"w l"D0Հ %\̔` e0@ ̥9Fg0w:"̭& ԋw " 0  0@-ӕ C5 @e5 7 5d0ʥ^@e !@e@-60fw!*0ӕ %*  $[ *L .F [Y \=%(% n h ӕӝZ V %)@e@-ӕ S %1 %9 1D-ӕ% %n ӕӕ  _vʭ ӕ _veAe@ f(R >(% ,ӕ5%^ fR >(%0]lk : "$&R0R0䣚0 ,%-B-ʥ] t`EHz !%\ n t`EHz%]5 Nmx %e_vw D _f_zd vd __ ,e\dXd ̥̔\ ̥̔  nd7 dd^d ̥̔\  %07 >dw.̥ : &  0 *@ E & @ E%  ̥\̥   w $$- -   @ /v ,N ,wv/,,5 5 ̥9 f& ff eee@ ee@ 5u̥0-,- * |*t t*p8p8%b* 9R >(  ,  78, w D C ̢̋ ww ~D+˥ ˥  ̥  ˥ ˥  %\̔̋ + w>w * Nf @weu- w 2@ PR >(% ,@ 5 @Ap u@5Ap e-Vaʂww rD** ˥\ ˥ ZawX ˭B @E 5(@ ,\ n @aH@%\ ˥n@aȕ @aȭ@aȋ˭ H*5 @aȋ@aHew   f ( 7P` N~R >(%7 6` V`_L`7 H` , H >_7 4_> t#_ _f_wR#>` 0˥˥"5t7,8 7,82 A@t7,8 7,8  82 ) "  ̥̥"5t7,8\7,8V _e     & 8_ A? 15I -C ?% 5 < -"?%  ߚF& ߎ ) -! zȁ t5rFE&F& RF ) %t . 7 Jf j#5-2^_R] H+w"w   w f Ԕ7f7 CӋ7˥3&  ˥L & 7ԋ& ԋw tDC _ x wXԋ̋74E5@t`AEAz@0e 08 08 58 8@5&f $% Dm 58 8@5DmN&f $% & D ԋԢ E5@t`AEAz@0e _˥L& _ _˥ 58L& _ _-_& _ _R >(%_w  @& 8 wz@ $@ @& 8 @ $*w " f B-5 @E%DR >( 5#%& %E%1%:@ P8@ &b8 ef7~ %DR >( f Ԕ 7w`w LDCB Ԕ%DR >( w.w @  $ xJeD%> R e?  E w@  @ ߊ ~ -~?r% F& ` ) ˋ P݀5PFE&5:, -, ?%  F&  ) F f˥ Ӌ  Ҕ 70 F e_f) 7_  )-)f 7_  f-L@9 0_5, - ?% _:_2  -?% F& ) ˋ ݀5FE&f 7(% @ 4˥Ҕ-^/ʕ\  F >(% !˥  5d-* ʕ\ F >(% @  ˋ  F >(%_ :_f: A 15I -C ?% 5 ߒ < -"?z%  lF& ` ) - Lȁ F5DFE&F& $F ) %tb f j#5-VwU_wB_%t*  , ($ j#5-Uf A - _5_Lz -z_L ?h% _:_2R -R?F%  8F& , ) 5$FE&f= _5_L -_L ?% _:_2 ߾  -?% F& ߔ ) ˥ ˋ ~ڀ5~FE& _f: VAR N15LI> ->C ?0% 5 " < -"? %  F& ) -F ȁ 5FE&F& ߴF ) %t F * ,e%_x_lN @   _: f= 2. *4 "  _@ ]_5 -?%  F& FE& ) - ŀ5 - ?%  ߈F& | ) F  x_7 nj_f4@& >(%@ *_f Ҕ)fҔ 7n )Ҕ_f@` _ w D* Qw --Q (%`7”% -VQ (% FQ H+ BQh`7ebw \ w 6 @  @ A H w w  rN_%F75S -M ?% < ߷ _%? ߮߷  -?% F& ߄ ) ̋ tā n fր5fFE&F& F ) cF  8t& V' 52Ku   ޷ !5 -@?% F& F @& ) A@ EN &5%N *e ߜt? wp w \ D LԋwT w @ D85U5_@'5P_@'  m@e4 ,5Ne & Z-  uN -4USt%:5F *5R *5& & (% 45@e-4  % U5EU  w E w D  +   r= wB w5 a U5ff (%ށ̥a &  (e 3     U̥r 33w D5"E@e44fef 0% *U4 4  fef 0%5 w   @ppC`pww7fL w FD:5UE5Hw* _j*5uNfe & /% _j*bNe & Z-  uN -)U5| m- 5 & /%St%F 8 f- U   & /% S U _() @_,)w DE%%"5   & /% U wv w ^D55@ *  H+ 3 . 4 4 4 4 4 ww~w  "J$:5+ I &5e-IIe %* & I    , ww  5f , 7I f , 70wX@ mlI7jI:`I%*e w  JI wlYwfw Net@f -e  w6w.w  G~uU7G|uU7G~uG|uGAe vBG7 G  G%G 55 a  a!PE -ZG%|u w$ / `e vWt vw(G@ `e @  /%GFe U?FF `e 7F|uU?F a7F FF?FFU ew dDFE wZw FD5 . 5N -!w5A vBB-  }ee@ !ۃ `!ւ ` `Em& E%vշmpՇ%w w7E*'$!      7& A& BF7!W-H47w 8uDAB %u f& & e w5 5  W- W00~u5  .lu2Bw* J@B |_T2@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& ) z   5 , @ :% & f E )  (˥-%0     ,:% &  ) 8 5E& z   5 , @ :% & f E )  wfrcommand garbled: %s Too much text: %s Label too long: %s No addresses allowed: %s Only one address allowed: %s  @FTzzzzzz< R J rCannot open pattern-file: %s Unknown flag: %c Too many {'sFirst RE may not be null Too much text: %s Unrecognized command: %s Too many commands: %s Too many }'s Duplicate labels: %s Too many labels: %s Too many labels: %s First RE may not be null Too many files in w commands wcannot open %s Too many files in w commands wCannot create %s Too many commands, last: %s RE too long: %s Too many line numbers Undefined label: %s   $(*.26:>BFJNRVZ^bfjnrvzDNXLf!! p"""l: VN##\01\02\03\04\05\06\07<->- \13\14\15\16\17\20\21\22\23\24\25\26\27\30\31\32\33\34\35\36\37Can't open %s RE botch, %o output line too long. Output line too long. Output line too long. Too many appends after line %ld %ld %s %s %s %s Too many reads after line%ld %s rduuu1df1or1x02f>2e01g 2c2s@1l@1L1u1Dj1Ov1X1U0^l VJuwy{R0R0飚0 AF \ e7cce7~  / :  7%  ?w >@ C%A-=E 0 &7P '  ʋ̥c%   e  @& ̋ f  =& ʋ= @w?w p?D  v \f  7b  7t  wB?w .? B e &e  &w ?w >@ e Ce7 @   w>w >n \7f  w>w >   B78w> w j> DeEE @  5 55!a7 U ew>w =-?  EU?7m|v 5@nfh@m?`7\ VRe + 7B7|74wx=w d=D-"Ew\=w H= wR=w >= *@U t4 w*=w =   t  *Lttwe4 B j %  "( 4  % & L  *$  4  4%  %  4% * 4  X^e4 b%  > 4% 4%;, " " . j %!(  4_T *%   4!  4_T(  _T *)  2& L5  *e5"F D J FE5 # 4  t= _vw 8 " #% w 8w 7  <= >, < >&@w7U  *e3 5^X L#N 3 TUU %>BU@ .5%&U>U@U7*w 47 "  w47w 7@A @@5@- hw7w 65pt-e * !%5N !% N !w6w 6  !5 p B !2 "$ !` !  e !' !6 !  w*6w 6r  w6w 6, w5w 5 N ! $ !N !  w5w 5 f w5w 5wRE%     : w~5w j57  & 8  J  ?wT5w @5  =7w-w,5w 5B55 2S _ !]Ne& =@E%@ <55 ˋӕ_ ʥ/ 7 Rҋ H: FBN <5?."˥.3C5˵(Ӌ˥// fe   Nfe& % N <7t w 5 fe r 5`u /D @/5@w3w l3DCE5 P *= ?7 [.5#] &  w3-   @E5  @E  ˋ ̋&   w 2 eD Eӕ/D Dӕ/  *+ >w`2w L2D7wL2w 82D%  *% %5   " % 4"  : w1w 1    w1w 1C ; E w1w n1D   R& ; wX1w D1   ˋ x4  7Lw&1w 1@  &@ 0 @ Rf ; @ w0w 0      ^ 0^l VJuwy{R0R0飚0 8 wL tw0w 0DL5j@4e444 4wV0w B0D *,s@`3  3w0w 0D 44 7w/w /   ?7 w/ w /N ,:  @   w/w / f l?  2f w~/w f/DC & &:  ? UwL/w 8/f 9  f w$/w / "B + > Rw.w .B\  (5E 5> +2\V 0 0 SJ@ .5@0  N& ,ӕ &f @% "N ?w,.w . @ @P? @ &5A@ ?u w-w -  $ `` u@ "" } ,%{ "5u wx-w d- _m(_5 5 @e5%{ 5 5Z@(V H( ? 5?` 5`7@5U7 X5(  _%}_L5(U U5( ($=55 (10 - m 5%$%!%#%?%-f _   @x } r} `U7x (%+IQ@ m(*t U ?  , -% %?ˋ%= f  5f 5@A f5_2U7$u@w*` "x7w d*xpNe N H 7T7R r BD -, w(w$ *+w *w )T *+ F  p5%` *+ (Ne  H   L Ne N Ne& &  @0eN ? N+\& + 7  @P@P? 5 f'-"  E%  w)w (PNe N   N " &E5N  w(w (^f @%5n @|x @%j(wh(w T(  *  Nf L 7%U5  @ @m @7  H:t   #x    b鷊^ 2-f $ ?T VE v Ul f` H(5P 4 ? 8 V wH'w 4'85 5   t  %  6 & t  > 55-Nev 9$Ne| 9 ^b  Z  U$x whEb H:  ?\ 7<777   N+ & 56 1. !Ne =  u-u-    !uu. !7 H7dw%  %& @0 >jEpw h%5V    !wR%w >% 8! "7 EB + 7 w*%w %DC& &:  ? f  ?ew$w $ Cu5 f ,w$e w $De (N * 5v  !  Z D wt$w `$ D̵@(f wH$H( ̵̥= N ԕ=s] 5 (f >%  & :5% 33 w #D &N  w#w #@ Nf  w#w #@5 @& Nfe  w\#w H#TDe Ne 5.5  9 & & x?e% .5  H@& + E@0??Nmf  @m7b  Ne 55 @0f  Ne 5 5  f&& x?e w"w !N "B f  w!w ! N *, f + w! w !D , n & & , 5wt! e   3  33 3 3  w !D̵@(  ̵H( ̋w w wp w w D    w w @  != ! ! Zw w z D>& + 2 + & +  N *wH w 4 D5@  & 4  & 4w w D5@  ! 5  ! 5  ! ww  & * ww  ww @   ?ewvw b7 ~ r e *7b! ? VePw8w $ !w(w  !ww 5   !$ !ww D  *, &t @%ww  feR @%ww eu < fe He< ff eB< fe e< ff eC< ff xeD "h ! "m ! "s !ww N "B !ww B 5 C' 55Pe0  r %e0ww z D @( Wp @A@`e 5 D- f w,w  _~$C@ (̋_r$5f5 & @ &   ?> > =A5!( ,E ?/ #% & ! 95  5H5@ & l?  R E $ @ v#ww N/ +5 f w0 +w DC& $  r l?  ww D ˥:Ҕˋ!ҕ/˥: ˋ CҔwZw FC50X $V  7B& % . ww D f $  ( & 9% j X  L UZ7 7 7 R VP ?0 ?& ?4 ? fe r?%#l& &% &  x?e  : j N ` rww DCB5 $ @$ @aA$ ap* $@$ a @$ @a0 *L(*fe(U 9%ww x   e !7 wjw V e % Lw8w $ 5 5 dN 4'_p(  H: Ne 6>7p " !e@ e %K@5@E/%^ !C-! 5!5b ` " F  !5> !   U@5u] j 5N w ww 5D  @Eu5@E7ww N & (ww \E@ e *@ ` e# ( 5 P) E wNw :@@ 5% C- 5A r5w@@5 #@ `5@ `JD  Bm@ `& , C-w  B e & (*` wvw bD 5  -#    e r ` > U  nepݦ +e  @ww N ?@m7ww C E`rww b% P *%Fe>ww ltwtw `Db E77RwPw <D &7!-77 J ww % *ww  <f +  *+ww DC ww  @ 5uw w DCԢӋ w|@w `Dԋ@w\w H e7 7  .5@#5 5   5 @>_$.'_ԕ"'@U@ " 45ԕ" .5@> *+@(7 @U70U5N@(H><@ @e7_.T=w]@H(5 @@u@ .5u@ "b p&e  7DD7B7 :? @ .5A@ @U7$@U7@@7  @0 7 7ww  t5%\0 d5%  "@ .u@@U7f@U5@wpw \ F @7 :@wR,. 5  e H 55  @ !     , e3a3 ?5w \ H:  R r&e& r?%7w^w J 5 6D_1_1E57  _1 x 57  )5 (w   5 &  _ 55_ 555 V ! @ ` ! T@ `  4@ _4 x Nf & & $ 5!f _5  & N N+wN& 8Ne ;ff "% ff % ~ N #N 5 > 76ز2.خ N #7ؤ J@( 5e  N xe _z1 #5%  N@ e &  N N 5 @ N "$ !@  ! h % _z1eN v#7 (5 _z1U@P ܎ D% 5<_t1 N 9 _z1_p1% e t _x1 f'_z1e B7_z1 f L 5%_z1@ `A @ _z1 _z1 _z10 ,@$ e  ]  7 _z1 _z1ef_1 5 %7@t@me5@5 %0N =_z1 =5 =0 !@A tEe0 ! _1f B 5_z1 _1 +5@(7 E5 5 J " 5 N ?@ ?5@v f'_1 `7f%  T9 z5@D 4'_18v  _1U@7 N z5  ;  ; 5  f $ @ ?5 @ & $ N ?5    L & $  v# & @0  @&   D%  8 & $ N& @0 rNe Nef& & @0e N fef& @0e_1N ?N ?_1 & @0 N& @0 _1 & @0_1 & @0_1 55  e5 57  ) (5 (wѷ Nef   & @0֝7z  t njd bN \7Z_15 J" & @0 % @  & @0 57  w_1 & @0_7N&_7 (5 _15 "Ne &5f   N (Nf ,  & @0  uw NNe  N Hu N   hʖ%& @0 TwJw 6 De t4 tt 4 4 Ne&& =% w  eu @wL wF)w@;w: w,w Nt@f ?eww & %f& %wxZw*J w&& e& & %ReR$΂ @  1  n "@! @#E B Ew "  @%wpww D Lԋww |u@t5 5 @ 5b Nefef =% (3A@u5Btr 2 @ Aupb  fef =% u-u-u-@ww DLNe& <wNe F< tNe F<4tNe <Ne F<4t Ne F<4 t w DDA && ef&< && eee@ wuww D ?4 4  &ww  f l? %  ?P 4 4 ww D 4-&4-!4 4   &e & r?%4    wLme   s lt  &wzW f r @  W f r@  @ < w*Sw$mow >lw  e& 7 7gww T & f R>ewLw  @A  v @A  R~55R 5& ER$ ~ER    6v&  @ppC`p   6@Cww7" ww N @ww ww Net@f ?e  w6w.mT& E%Fɷm@ɇ%w w7*'$!      7& A& BF7!W-@7|@(#)args.c 4.4 7/31/85xnvtsierku @(#)blok.c 4.2 8/11/83 @(#)builtin.c 4.2 8/11/83@(#)cmd.c 4.2 8/11/83newline@(#)ctype.c 4.2 8/11/83 @ "2@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@(#)error.c 4.2 8/11/83@(#)expand.c 4.5 8/11/83/@(#)fault.c 4.3 8/11/83@(#)io.c 4.3 3/19/85@(#)macro.c 4.3 8/11/83@(#)main.c 4.3 3/19/85/tmp/sh-T @(#)msg.c 4.4 5/22/85 VERSION sys137 DATE 1978 Nov 6 14:29:22 bad option(s)you have mail no spacesyntax errorbad numberparameter not setbad substitutioncannot createillegal iorestrictedcannot make pipecannot open - core dumpedarg list too longtext busytoo bigcannot executenot foundbad file numbercannot shiftbad directorybad trapis read onlyis not an identifierPATHHOMEMAILFILEMATCHIFSPS1PS2 :/bin:/usr/bin: -end of file unexpected at line /dev/null+ > $ # .profileV Y"^cg!loux$}(!,=E[ev$.DZ!exportreadonlydglprw}     inesaccasefordoneifwhiledothenelseeliffiuntil{}HangupQuitIllegal instructionTrace/BPT trapIOT trapEMT trapFloating exceptionKilledBus errorMemory faultBad system callAlarm callTerminatedUrgent conditionStoppedStopped from terminalContinuedChild terminatedStopped on terminal inputStopped on terminal outputAsynchronous I/OExceeded cpu time limitExceeded file size limitVirtual time alarmProfiling time alarmWindow changedSignal 29User defined signal 1User defined signal 2Signal 32cdreadset:traploginwaiteval.chdirbreakcontinueshiftexitexectimesumask@(#)name.c 4.4 10/31/85 IFS=IFS==@(#)print.c 4.2 8/11/83/bin/csh/bin/cshptrace: @(#)setbrk.c 4.2 8/11/83@(#)stak.c 4.2 8/11/83@(#)string.c 4.2 8/11/83@(#)word.c 4.6 10/31/85@(#)xec.c 4.3 8/11/833@33,3221x33 22P4J1414234h40667l8778$7675H7longjmp botch longjmp botch 0_l R-[]_acR0R0䢚0 @"  e7cce7  /   7%  w ! % ` %@w eW- W-e WuWV @ɋ ,Wo| 2 7f `\  7^ %7P7F 7D< %74 7,$ %7  Ba r vm er KeW  B. e ^w 7 w     *&f@ d &\ ? X  T f&  ы 6 :e  7$ r e0H~ e ! ?,e&-"..f. e wV  `n f ! T  J & d!=K!:7:  th!!x ̵m ݒ ~ v^rZ7Uh-   8 e . e   @W x W E  E б. !;!  H ! > x x  Bw f fe     l N%7 m 7 fŝ & &  ~ 7 | ` Ґ7`  .r vmD7 Pw :er @ ( zew` " Dҋ!< p  j ҋ  P    7 & e re  - f %? 7    %? 7 7~ v t `p j f  f 0  9 0Wq `Wt` b f  .A 7@@ ea be e7 v  Ef> & e 7@ > h f   t fi wxX- ȋ-ȋ7 f& & 4 te7  j w2 &f FD :e *7    yX ZыD7pW 0W 9w 8  ~ x& rU7r f  t  g < p7 0 $ U Z  L< "    \  dҋ  > < Hw  <w Be.   &  xl   e !,  Z e !, ~ < e  !, m  |Ev ~ U \  ! !, 8 4 7 , 7 ! U !, x !("!-1!$B!*H !(  ` e  8 t!+ "  !(7- | b < heT !** 6 B7`6a $    e !)) f+7 Z  j  C!a!k  5f 0  -D$    t y+ ` f!]] B # B}>    tt4 jf rB+ XB`& LB  BA B@ 6BP ,BpB f r A B`+w&PEEE &    U@<L e7&:  mm~   &j 7b^  $e ,eE   e  eJ-FB4w7 *ew      p r-pw  lEf^ EwTR EHC\`Tx @ e@ J7D 670C &7 7> @ew N   & r @ ~  &  :   ~ p   7@NJ& j    &Ћ 6 e  e ǀ z%  D  F@ @ e4-0,7  & F :ԋ7aw @ "@ e-     *e~-zv5J0_l R-[]_acR0R0䢚0h -""? ԋ @E   mm7 7  !  ! & & & & e7 d-B`5:Te2 M& C N  >R U#E   r    m   U ~eH & heH o  x p-p r X L5R  & .eH $eH j  v!!< b&&# 70 L!=`!:7L   - w w!!-x  E   m nE]l7xdr^-Vp B ȝ47@,:&  W E      p .  r EE б! ! w! !;!e teD t BE`eSeSfJ b & e$&   e)E`fUeb ( v v \ e Ԁ B ew$ 7  <!! mfWqDe7 ff>  e 7F> d`eZ !+!<w&       && $ 7  x <  ѕ       #x 4UU E BCwL & l <  \   h #e`e 9 x f_ Z R   P n l%v  # } e J HR  5  8  EU b    \w  P     U  j!, : pE F Z5 -  & | ! !,  hEb&Z V @  <& 4 e & e  & 7  7 !& P L 5U  & !(>!-X!$k!*w !(   U0U  UE UjW!~7U 2 !+  U8  PU ~UU r!(7x- ^ Z 8UU F U *  w W   j  !)) W  |& hr   fEtWt1bDW fE .WtAbVt 7 8f+  `  u  "  7 96!a ,D$  y+ v  X!]] P # K}G    t< x r1L bB`+p VB% JA B@ <BP 0BpB " r A B`+w &PEEE & W!p   Uf7 *Wp @a@` r 6 E7 h7b -4.E www|ww D Lԋwe& ;ewPw u@t585:@ 5Nefef H% (3A@u5Btr:28@ Aup fef H% u-u-u-@w$w  Nef (@ww  f (@w w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef 8,5@ 'Ne 8 %ʕ/  f % %% w Nef 8ҕaʋʥz ʕa&w<< w2\lw" e& 7 7~gwww7f ww J N x!wJw 6wBw .DCDpC L  ww N w ~5 & E        ~5w  U7U7Ae vBn7 p  f%` 55 a  a!PE -(% w$ L! `e vWt vw@ `e @  L!%e U? `e 7U? a7 ?~zU ew dDZE wZw FD5  5N L!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7*'$!      7& A& BF7!W-6"7as: can't create tmpfile f xxxx as: symbol table overflow x//<>%n s t e0r ap& & &  2 H T ` x z   +X -X *X /X &X X X X %X [p ^X f !X + - * /  &   % ! ^ .0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ_abcdefghijklmnopqrstuvwxyz~/tmp/atm1XX-     0  @  P  `   !%)-26:?CGKOSW[_cgkosw{   @  @       @  @       @  @     @  @   @% * / 4 9 = D KOS W [_cgkosw{      @            @& ,048<@DpHrLtPvUxY ] b~flrv}...r0r1r2r3r4r5sppcmovmovbcmpcmpbbitbitbbicbicbbisbisbaddsubbrbnebeqbgebltbgtblebplbmibhiblosbvcbvsbhisbecbccblobcsbesjbrjnejeqjgejltjgtjlejpljmijhijlosjvcjvsjhisjecjccjlojcsjesclrclrbcomcombincincbdecdecbnegnegbadcadcbsbcsbcbtsttstbrorrorbrolrolbasrasrbaslaslbjmpswabmfpimtpimfpdmtpdststmfpsmtpscsmtstsetwrtlckjsrrtssyssplnopclcclvclzclncccsecsevsezsenscchaltwaitrtibptiotresetrttmfptcfccsetfsetdsetisetlclrfnegfabsftstfmovfmovifmovfimovofmovfoaddfsubfmulfdivfcmpfmodfmoviemoveildfpsstfpsfr0fr1fr2fr3fr4fr5muldivashashcxorsxtmarksob.byte.even.if.endif.globl.text.data.bss.commas: write error dtj` BFJhhhT<+B-B*B/B&BBBB%B[b^BVP!B+-*/&%^!   ? a.out . . ((((( AAAAAABBBBBB 0`lȾY+-/13R0 R0 0 K e7cce7 / (  7%  TCw FZ`ght@N & ,De% ht@: & Ce%ht@ & pCe% 2P$ e uFNf  Nf    &  .?e F5 x#5 .*7u *% e~{r *% eb  _@  r y&"w .*7 r? 7k *% eq *% e ?_ _%p_   @k _ N #7f=,_ _  _ _ _ _ _ _ _ %WpBC >%5   %MA rB?WpBew B4 (@. >& .% 5u-u- *, "N    e-  _Ze5Wpmuf XF%%_X (_X _rfN 0 \N N  PTe5@ f!@ fNe<Ne|e& <%%   ߨ 5 - ?%  & t  ? -_ ~_Z TCwtAw `A   ( TC * =  TCe  :+ *wAw @D4c  x& V?%  =  TC te r?֝_Ne +_@E% _s_& V?_& V?_& V?_& V?_& V?_hp<ra4up,hk$xprbrl m_t_k 4_ V?+t'_& V?& *% _t_y_  w?w ?(5, v5u. v5u0 v5u , v 5u. v 5u0 v 5u z  ffl .?eZ >%% wX>t55 t55 t55 05   A@ee@ f& Z5ef& z5e7w@mAm@ 7wwwww @A 7w7  V5 l f^ *% fJ *% $ _> WpDmht    ,"2l4eF vt$6&(8f&e )%?   _(*,.0246^l`4:4 ?e>&e< )%" ff& e_w < ! t-te  *% ew; - $w ;D #& Wpm, Wpm Wpme f r? !  & h%ewl;w X;DCwL;w 8;DC, w,;,w ; 5 CDe   %@w:w :D , , C,? <,8a@   a@  5u ffX .?e W fe6 :2e% w2:@w : f* (2XmPWp N E ,84Wp N 2D7 & = Wp Dm f& )%4tw9w 9DF  Wp Bm -hWp mr1!w\9w H9j"fe C G8 - * I - 50fe $e%  K   TC%!%% %%% a =% TCA vu w =% TCNe 5uNe 5u ff& te jfe $e Z @E5 A@@mAm@ f&f teN fe $e%%,Nfe Ne V?s @3s e@  |AN |A   ( h%ew7w 6N ( TC0`l꿸Y+-/13R0 R0 0w6w 6 r  0( -   &   @/ & efe e e ef e. e $ e |Aw6w 5  - _ _    ,=fe $e $e $ef $eN $e" . hC 7:    TC w5    $ee -w 4 %@7  > 7 ~  > 7| %@7` Z > 7XJ wB4w .44%@7"   TC"Ne + 7 V? 7  vE p j N  &  .?e >%% (    TCZ hC 7     TC N& > .?e* >%w3w 3De&$ &&&e $ <%e  w2w 2De&K <%% w2w 2D$&" &&&E&&& 8&&E <%eH & &   & T  <%ee <%  w2w 1 @*(B.,`@ `e@ f& 6)e5u< ff )ef& e< fe &eff W-  ewZ1w F1D^4|^A4 v 5`u`u  A@e@  f& .?efe >%%Pj@e52 9@e@-35 @ %@e@- ~}  5 Ne = Ne&e| r?   ff& .?efe >%%w 05 Ce@e Z% eʋ 5  @E5 @e@-* $=!% %~  %?%==   &e| r? e|ʥ- ʥ?ʥ  >? V >?  >? 2?__ _ʥ-_ _w .?     TCvp &   ?7f ?m\-V <%  Aw>.w *.Nf =ew. w-|w-w -DC AupB5 S  "̥ ;  & ӄ ? %;  7  & =%bb& ӄ ? % ₎& =%`@ @m A D&@wJ-  w ,-DC E5<E@e33. @;E  5 , @;% & fE ? 5  AU3 3  w~,w f,DE5_% _| _|5`uu '& & .?e5u%%w+ @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & .?e5u %%    ,%%%_5 A5 5 E4N ff & .?e W _%_n%_n_  @A  @C@Aw *D 5u5mu A@w)w )D 5u5 A@w)w )De m@ e@ 5u%% du %e u 5mu A@wd)w P)D 5u5 A@w4)w )D%%055  m@ 5u%% e du %umumu 5umumu A@w(w (    L  w|(  5 ff L% 50  8 & w &(  uN ?5&f %5& w' *5  f V?  0   w ' p  @e5ff l%5& wv' 5  w-   4 w &' d^ > T & b .%7>Nw&J@ V?4V5if - 7 w & 8 w&w & t  w&ww &  07   |A7 wj&w V&ww\&w H&  @ E w4&f ,5% %NB (,%  B )kB h( 7n& h( 7q& h(  #7t& h(  #7w& h( 7z& h(  $7w}& h(  $7w& h( 7& h( 7|& h( 7n_ w %B $ w%  B7 < 4 555 ff e55 $ DB * & =%e, & =%e. & =%ez: & =%e7fw #  _#@ V?_#0_#5 & f >%5= $5u fff .?e5 #u 1B!f >%50B!B! :=B!N AwD#w 0#D      + - ̥9 Wp @@`e̥0  w"w "D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  wT"A@w!w ,"DC AupB 4  & =%b ,5% 傎& =%`@ @m A &@w!  w ! fef G%5 hw! w r!%Vww t7WpwAwpAmu% Nf & @m5uBmB-"C-Dm5TD-umb@5@- w  DӁN6f *m"u-Bm B-т̒C-Lw P @@5@ 2 vwpAmDu-6B @5 ~ N bC! T5ԒS DC6U0C-f m5D-/+D-!Cm@5&@5%3-f & 5u0B555R DD-N& xmp-lN& & -T_&ww Nf F( w~ww D Lԋww rDC  wf5 7@  55@- 7 5!w De LN ?4ee N)  ?4e Be v Nfe ",%ww -@ wN~! )%~! ~ ~w 2 BuNefef G%=@@wЋ Ћ  Jҋ~ @@w hN C HNef C?@E% 8d *2 :+*L-d ! r? e! >? Ne! +u-u- *!w" * w D A4 4  vEww  f > %  AP 2D4 4 ww D 4-&4-!4 4   &e & >%4    wVme   s lt  &wW f r @  W f r@  @ yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_-5P_-  m@e4 ,5Ne & C  uN 2D4USt% 5b A5^ A5& & >% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff >%ށ̥a &  .?e 3     U̥r 33w 4$ 2D w5 4@E%@EU5N&e r?  &e >? Nf&e >%4 IN&e r?  &e >? Nf&e >%  (Ne& C  ff eee@ 4t@t"4 4t A vE_.w N A@ AN vEww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  7 ve@ 4tw"w D55ff %f&& "eff&e e &e h9 55 wvwr!w5 5 w D5#5ff T %f&& eff&e *ew6&e L;'44  && ef&& .?e&e & XF%%U w D5_ 3o5ff %f&& eff&e Ze L&e L;8f f ff&e V e 744  && ef&& .?e&e & XF%%UUw @@m e%fe C  &e h9 55 3ff `%f&e@ &50c &e h9 55 3  = U44  && ef&& .?e&e & XF%%&_ 3fffffe e _ 3&e % _P3_ 3e_P3  mm@ e@ f& ef&& .?efe& XF%%_ 3 8_J2w @0 0 @0 N 577!ww D85_6Ne& Cq fe Ve4-4-/44  &&  ef&& .?e&e & >%%&e C &e h9 55 eww!w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  7 ve@ 4t4-4-/44  && ef&& .?e&e & >%%&e C ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& .?e&e$& >%%&e$ C `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& .?e&e$& >%%&e$ C `Btp$t t"  ff Nef&& .?e&e$& XF%%Uw w r D5#5 5 w6w2!wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& <% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5ll @Et5l 5l u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm =% a@ `` e w D a@@m e  w e  aAm HN@`@m &f =%  aN f`f =%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef G% AU4 4  fef G%5 w    6v&  @ppC`p   6@Cwzwtw D A & & .?e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _@5uNfe & XF% _@bNe & C  uN 2D)U5| m- 5 & XF%St%  C U   & XF% S U _? @_?w DE%%"5   & XF% U wv w ^D55@ A  A 3 vE 4 4 4 4 4 ww~w  $ 5+  &5e-e % &     hC ww  5f hC 7` f hC 7wX@ m674 *%e w       hC e-ww D  5 e %w  5 e-w |A Bww  N ^Fww rDCDpC 2D C wZw FN vEwJ ~5 & E        ~5>wlYwfw Net@f ,De  w6w.w  !U7!U7!!~Ae vBj7 l  b%\ 55 a  a!PE -$%! w$ 2F `e vWt vw@ `e @  2F%e U? `e 7!U?ܔ a7 ܂?zvU ew dDVE wZw FD5 vE 5N 2D!w5A vBB-  }ee@ !ۃ `!ւ ` `md& E%VȷmPȇ%w w7*'$!      7& A& BF7!W-J7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_H@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& ? z   5 , @ :% & f E ?  (˥-%0     ,:% &  ? 8 5E& z   5 , @ :% & f E ?  w@Pfxj;V0SWRIZT/etc/psdatabase/dev/kmem_proc_nproc_hz/dev/tty/dev/ttyproc tablewrite%.*s %.*s swapper %.*s/dev/dev.Can't open . in /dev consoledrumfloppykUmemkmemklogmemnullnrmtps: tty table overflow tty?ps: out of wait channel memory rrInvalid symbol table %s: bad magic number %s: no symbols uwrToo many symbols /usr/sys/core/dev/mem/dev/swap/unixnproc not in namelist ps: not enough memory for saving info USER PID NICE SZ TTY TIME%-8.8s%6u%4d%4d %-2.2s PID TTY TIME%6u %-2.2s F S UID PID PPID CPU PRI NICE ADDR SZ WCHAN TTY TIME%3o %c%6u%6u%6u%4d%4d%4d%7o%4d%*.*o %-*.*s %-2.2s%3ld:0%ld%ld () COMMANDps: specify only one of l and u. CMD%s ps: error reading %s from %s >/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd: Unknown error: %dfnx0BT`v&5D\i +HYx :Qp + C d   + : N d   < Q RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator/dev/ ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired !!!HdGoHxHfHeGgHcHsGlGLHu HDGO HX2HU0 ald UR0R00 ED% e7cce7 / 0  7%  >w :A15 g@ |@ V @m  @mȥ- @m   @m C- 4 7 5 @m . @mȥ-&} @S !_ xN  @m`5 @m C-= 0 :70 4  4    %b ( D p   <    7  @9  1 E7 1 E7 5 _x_J_J_J7 _J_J_J|_Jt_Jl_J @   @m   @m   @m0  _J_Jw.L  _J @m5N N  Ne& & ,%  p C-  z' Ne& b ,% j p >w=w =6 ^1 J. J+H P5#Nef 5@E%N V NJ @9%N R5  R5% @9  >wD=w 0=\ w =f :   w < hN 1 VN 1 w EE4Pu- u-uut t @pH@_w 63  w23 XH P  -  Ne@& X Nefe  \ De̥- ̥-̥@& &%    u w `2D ̋ w`2    f -% ; N& : AE5$%  @ @  N - 5 - t - 0alb UR0R00 - ;w z1D "5C ?  [  *f b%5 4 w41w 1 B` ʋ rC rD (  (f :w0w 0N f (w0w 0 %  0N z44 EE84 4 7 .N V 7N f 0(wD0w 00 /w.0  w 0D& ( & >  w/w /DCB Ҕ@w/w /DCB5ԋӋ@A@  C-R 5! wj/w V/D >  wB/w ./DC ,%d&%  @ w/8}5 ̥ L ̥̋ ̋ LL  Ne P5 @& X @Ű̥$ ̥̋$Be̥(̥{̥()w R. N P55ApEAE1PAA v5)Hf :!;f :=f :?f : NA @9%w-w -   D̥=C  ̥̋: w- ˥=˥ ˥  ̥ ̥  zf 4 Kw 6- f :w*-  07N z44 w ,Nffe V3%Ne w,w ,  Ng @9%y @9  >w,w ,2Nfe V3eNe wn,w Z, 0t  C  @w>,w &, _v7_"Ԕˋԕ u @ 0:a%+ @9 $"w+w +4@ ̥̋(̥(& h  zA1Ne@& 5 A@  % wh+Ne 5w B+Ne 2A@w8+w $+D5 @& : w+u  05VwN zA15 5 /u  =f5 P5 ZF@e5= @& 3%  fe : Ne@& X Ne=fe : 5Ne & %5@ 5_du :=  5 4@f :@&  e 3u  +N *4%   05w@N zA1 n1% mN  @9%  / _ 4 _@e5+-h @ A HN+ l0Ne+f %Ne 5 Ne z 5  05}@pu j45@_w (C@5 N *B ?< [J 0 - ]# , N f l w'@    A @@P5  D   Nf 8  w N' Nf  l w2'w 'Fu (=N : N t( @e5@e5} u-)= (NeB : \w&mE mtmr@ 7`w`w e<w Ne :  w (& ~x ( w2"w "D 5@w"w ! 7|  z f , / ) $ t1e3  w!w !  %G Ne 5- 7  @w~!w j!  < w\!w H!D ̥ ̥ ̋" F7   j,& ) m  >w j,ˋ%f.U  ˥ ˋ ˥ ˋ ˥ ˥ w 8Nef 5 GN|  @9%K  7f 9 5fef 9%% N p;hbCe-J Ne 7Ne 77$&&  @9e  w  D ̥ ̥  05=  zA1w7 ww R5 7 e5 _#p@ E ^_$/5_$ F@ 55 J K  #L ;EKN ":5 C %/\ A @ E 55% % % %  % w%/ T-&ݗ @5% @ @  .D ̋/̥:ԥ=N  ˋ˥; Ne/ X Ce ˋK KDe/@7 ̥ ̥ _# ̋_"w @ *7 (7 &Bee@e  wVe 5l%,  H77 m%@ H5 -@@C ܸ ܵ 5%, j 7`7 Z<e%@ e -*@5  H C xB  % le5% H %@ H_&% 5l@e ֆ_<% _<%_R%@  D@  5@7u@ 5@ b 5%  H A p @  H@ _&% xJ ^0 aA vE- t  @9%&%v"T. 7D>  2$  @9%  07 ? 00 & : & _&% 7h.A v5EtE81P7|z v% d.\0 RR7Z_&%R L0h.%PB_&%C _&% fe V3%NeR  _&%7 7 _&% 07? 0 _&%_&%_&%7_&%77_&%7|?ww Nef ) ww   25 /f 3 @Nevf& *%@ 6   &w v@ev5xt%t t@t @aAt AmpxNevx *  %ч .Nfev *      w DCB̥:̋ ҕ/Ҕˋ ̋ w F ;eww DE5_,% _+ _+5`uu '& & 9e5u%%w @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & 9e5u %%    5%%%_x+5 ;5 5 E4N ff & 9e W _x+%_+%_+_x+w D      + - ̥9 Wp @@`e̥0  w:w "DC AupB 4  & 8%b 55% 傎& 8%`@ @m A 0&@w  w fef A%5 w w hD H25u@-A-/A@E5u@E55  ff& 9e4 4 5- 5- j45ww 4De _0 t4 t t4 4t Ne&& X5% _0t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 (0 55 Nefe l5% & %5u7  && X5% x fe l5%ff l% fe& X5%wA@E f& <w ^"wdw PD LԋwHw 4DC % 5 ̥+̥- %$ ! ̥0 ̥X̥x % ̥0 ̥X̥x 5 5 % 0 e e  ff eee@ 5u %  = A@  w6A@\we& ;ew~w u@t5V45X4@ 54Nefef l5% (3A@u5BtrX42V4@ Aup4 fef l5% u-u-u-@wRw >& f 9eB B`@ `ww  fe 2@w @pHA@tw>w  Nef 2 ww D 5  =& 3% `5ȥ=  = @wPe  w 0 BuNefef A%=@@wЋ Ћ   Ћ Ћ  Jҋ~ @@w D <4 4  "@wp w \  f 9 %  <P >4 4 w0 w  D 4-&4-!4 4   &e & 9%4    w me   s lt  &w W f r @  W f r@  @ w Sw mow n5lw e& 7 7gwb bBXI I7XIw  & f 5ew w w D85U5_,75P_,7  m~@e4 ,5Ne & >  uN >4USt%5, ;5( ;5& & 9% 45@e-4  % U5EU  wf E w D D < +   r= wB w& 5 a U5ff 9%ށ̥a &  9e 3     U̥r 33  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw FD5"E@e44fef A% ;U4 4  fef A%5 w   @ppC`pw w7(  ы A@PЋ w FD:5UE5Hw* _;5uNfe & A% _;bNe & >  uN >)U5| m- 5 & A%St% ~ > U   & A% S U _h: @_l:w DE%%"5   & A% U wv w ^D55@ ;  < 3 "@ 4 4 4 4 4 ww~w  $5+ t &5e-jVe % & H    > ww  5f > 7  f > 7vwX@ m7%e w       > e-ww D 5 e %w\  5 e-Bw (< =ww  N Aww rDCDpC > P> wZw FN "@wJ ~5 & E        ~5>wlYwfw Net@f >e  w6w.w  J25U7<05U7225005(Ae vB7   % 55 a  a!PE -%05 w$ @ `e vWt vw@ `e @  @%tpe U?^^ `e 7L05U?@ a72 *,?$ U ew dDE wZw FD5 "@ 5N >!w5A vBB-  }ee@ !ۃ `!ւ ` `\m& E%ηm·%w w7*'$!     > 74& A$& BF7!W-E7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_C@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& @: z   5 , @ :% & f E @:  (˥-%0     ,:% &  @: 8 5E& z   5 , @ :% & f E @:  wf-XDvbl !)/7?FNU]epww#*:AWs"7TaqAx" ' b l Au s " T+T4        <&H&H&&"(&%(((&%) )B)L))V)^)j)=|^();&<>*?[]:$`'"\ :;&>|$No description argument after -f flagCannot open %sUnknown flag argument %s-MFLAGSMACHINEpdpmakefileMakefile.IGNORE.SILENT.SUFFIXESNo suffix list. No arguments or description file@ *** %s removed..PRECIOUSrDescription file errorOpen directories: %d: %s Macros: %s = %s %s: done=%d (MAIN NAME) depends on: %s commands: %s VPATHdoname(%s,%d) TIME(%s)=%ld ?Too many command lines for `%s' .a*<.DEFAULTDon't know how to make %s Don't know how to make %s`%s' not remade because of errors `%s' is up to date. touch(%s) %s%s *** %s*** Signal %d - core dumped*** Exit %d (ignored) Hash table overflowout of memoryinfinitely recursive macro?Warning: %s changed after being used Make: %s. Stop. Stop. line %d: %s$? list too long .SUFFIXES : .out .a .o .c .F .f .e .r .y .yr .ye .l .s .cl .pYACC=yaccYACCR=yacc -rYACCE=yacc -eYFLAGS=LEX=lexLFLAGS=CC=ccAS=as -PC=pcPFLAGS=CFLAGS=RC=f77RFLAGS=FC=f77EFLAGS=FFLAGS=LOADLIBES=.c.a : $(CC) $(CFLAGS) -c $< ar r $@ $*.o rm -f $*.o.c.o :.p.o : $(PC) $(PFLAGS) -c $<.cl.o : class -c $<.e.o .r.o .F.o .f.o : $(FC) $(RFLAGS) $(EFLAGS) $(FFLAGS) -c $<.s.o : $(AS) -o $@ $<.y.o : $(YACC) $(YFLAGS) $< $(CC) $(CFLAGS) -c y.tab.c rm y.tab.c mv y.tab.o $@.yr.o: $(YACCR) $(YFLAGS) $< $(RC) $(RFLAGS) -c y.tab.r rm y.tab.r.ye.o : $(YACCE) $(YFLAGS) $< $(EC) $(RFLAGS) -c y.tab.e rm y.tab.e.l.o : $(LEX) $(LFLAGS) $< $(CC) $(CFLAGS) -c lex.yy.c rm lex.yy.c mv lex.yy.o $@.y.c : mv y.tab.c $@.l.c : mv lex.yy.c $@.yr.r: mv y.tab.r $@.ye.e : mv y.tab.e $@.s.out .c.out .o.out : $(CC) $(CFLAGS) $< $(LOADLIBES) -o $@.f.out .F.out .r.out .e.out : $(FC) $(EFLAGS) $(RFLAGS) $(FFLAGS) $< $(LOADLIBES) -o $@ -rm $*.o.y.out : $(CC) $(CFLAGS) y.tab.c $(LOADLIBES) -ly -o $@.l.out : $(CC) $(CFLAGS) lex.yy.c $(LOADLIBES) -ll -o $@.:/Directory %s: Cannot open! %s is not an archive` #1//bin/sh-c-ceCouldn't load Shellbad wait code%s: Too many arguments.Cannot load %stouch: file %s does not exist. Cannot touch %s Bad character %c (octal %o), line %dline too longyacc stack overflowsyntax errorInconsistent rules lines for `%s' Multiple rules lines for `%s' Too many leftsMust be a separator on rules line %s/bin/shPATH:/bin:/usr/binsh  # , E L V i y  . F \ t Signal 0HangupInterruptQuitIllegal instructionTrace/BPT trapIOT trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionStopped (signal)StoppedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesSignal 29User defined signal 1User defined signal 2 ((((( AAAAAABBBBBB 5<5<5BdBoBxpCf~CepBgJCcVCsBlBLBuBDBOBXBU0"bl R0ڢR0ڢ0 w@ e7cce7R/ / W  7% x hkw lpN fff ew\pw Hp fff& ew:4 4 44 4 A A m m@ 4t@t44@77  Z@ Bwlw ~lu-u- u- u- wdlw Jl     w_  ? b_ w_ Uv5  %* 5H U @55%=* 5  L_ W_ lh m w_ L_(  _, < b5Z455e5u @%%e@  %?@$_ @$_ / _ < bL%@%<% >%4%:%0% _(%"%$%%N%% p%55 7N  f& p%75u  A@$$B C @@7 $$w $!  w$w$X"fn$h$ RLe_ d$`$R$ T7B$w@$< b $$#f$# RLeNffe e7 w#w###f## e #f  f&## Lex#t#) &Nffe e %  pw0#w,# "_   /B:%-"-"  7 a .f"" RLeNf  "" e_ 7 \ 5@ =5%< mx b"@ mj @ m^ &z Ve@ m> %K "" t""% 8! 2@ 5%_7 7  v1   .7 7 t!4 &  %;_ _  !_ `! \!__w e7t  pN | 5? %n &_$  )_`  *P +  - |_F _p NU | wm wm w NU | A@ 7 w h  * #NU |   ff eNU | ff\, EeNU | L F ff ZNU | A@@ A 7@ w@ NU | w] w] 5~ b @wPdw Af \, Be 5@- bA 7` w`w    xvXn jRD.D%    755  5&55 e&55 0'bl~ R0ڢR0ڢ0 5&55@ wBw>__#_.E   ! ~  \% % T __~_> T7w5 "+^<3 5@ =5% mD7@7 : @t7*7&w_@ 5% b'l57 7 % v7w52,Wt 7PwP @  b  w ^z/%/ԝ   w^w ^ ;!f (Q w^~f& > & %  ;  f (Q _f& f> & %   XPw ^@ @e@ew^@Dw ]\ _   w]w ]@ e@Ee w]@w h] ff R8% & b ~z/ < & % w,]w ]DC& jg & jgw\T w \ 57 A@ee@ f& p%5@ A@e@ f& p%70(e& p%5e& p%%  `@ &f-E?%  %  5@E?%  D w[%  @m& L %7 rl @ H& p%%e0e& p% vD`% % %%ew 2[   _u N  L  F  XPL & lh5 = =@55 AWp u@e5`@5  N f ff e5@7ww   7 w4Z b A@v T7w _ b_w Y _uuA Z A @@f @P5 a +N p%57N  f& p%7x5uu5 FN  f& p%5N x f& p%5 @wX  bwwu 7",aU &@ r y8`f  RLe7   T7w  2_ffp ,_C N  N % ' T7dwbS@ @ % N82 p%E5 @ 7ww N{_ffffffffNf \"  %_xN_ff_5uu5& e l_xuu5& e D_x %_t7 0  @ %"_x _x upN T7w_N@     _D b_x _l N_ _x 2 _ ff  RLe_x  + NU _ ,  N]%  _ _ _  = NZ & _ _ _z _\ _Nk & _x _ _ _P _ Nv & _ _x _z _^ _ __w zT8 l x 55" ,`  ,` ? f `e hk*% b! ,` Ne c5@-%& ,` ! % wSw SE% %~%@%@@`A@x & N %wxSw dSA mm@ 5uxxvv( bA@w.Sw S ; wSw R   wRw R ,72 )-  Qw *Qf ,` & d Bge wQw PD L7 JF7 D l 7 | x g5& JR & JR  jg$ jg7e% jg e %7%7w~ ~$ d'f Plzfvbjbf^rZnVdp jP|Lx8t4p 6N2J ,` 7 %   ,`  ,` 7  NW  NW   V  7  H   &  7 7  %  &  R N  ln% ln%7      - 7    V  (7  & nN  bw pN V hkwpNw \ND  w  e@ A @@, &E5@ @ b x: | b % # b r wMtE&E #: b %t&tE # E  #%    &w 8MN # N # w(Mw MDN &5U me&& RLewLw LDEEN &%_%5_%5* %5 , ? %I e Tf  f& .ee77 ~5  $ %   f& %7@7 :5& ,& RLeej   &  ( (! 0* 8#wK *  & & * %* %* % ? %!  f& %7t7 n%8 & ZT RLee w K _&@?@% L5 5 ,5 @5,5  5  ,@- N8    }    ,5 t%-nh,,Z ln%,PwJw I%,B %wIw I\u@e5_t*@ %_t*%-l rNe *5*ue . Ne *5* ue @e7@5555ue5 @5 D 4_) x  @&f +%_) _ *@_* f& +u ff@&f& ~,e_)ff >%e_) @&ff ~,e ff +xN %_)u_)eNefef=& ne 5 -+?\ X 0@ ?> :  .* & @    0Ae@%7` e  df +%5 $u Tu J, 5ru@ % ?X@e5N g55 _'@55r %@ @ %@   %@ @e7@ 5_'wBFw .FNe Xa?  %a?  %wEw ED5 9AWp B`eu5 %0 @wEw ED Ce %d -  A 7A 7 @e  5@ 0W@`? @e w$Ew Euu  A@  5u-^ +P L5 @@mAEpA@v5u % 5 @@m @@me0?  wNDw :D@@e5D6f& 5b7 `\V V5f& V5x0#\ X*@e@-^= eXww 55 - 55u5u  5 555u u=e 5u@ 0W@`? @e@-wCw B  >8 i7 0 ~7 x[rWp D/dWpND/ ' G i%> b0WpD/"Wp@H/F/ 7 #   i7  WpwD/Wp@7F/r7H/nw&Bw B%X  N iDwBw A:,-> %wAw A5 ppll@ r yvh `Z  B 3 H_r1 nB_r1l b$   B3  nBJ  L Fl bJ33 -j^-bV 3 3 ?e 5 d =   = @  :_r1 C_r1 b  | & ,_r1 b  ^ j d `Nf >XW ,   b)  _T/  ! & b   !_/ & R. >5 _/  _T/ #_b0 & wV?w B? @ r y   ,%  w ? %<5 5  % _&3@@aҔ %? b % @@m0%<e fe g ,fe Rg Nefe Rg .fe jg f -  fe 6g 7 fe 6g 7l  & ` Bge T7 N b_1 40_1& _1 fe 6g%7&  Bge_1%<  - _1 d_12_1P w_1 w_1W@m %@tf&; @e %#_1_: N & [ & | _1%F  X<_1 ld^  hFJA E5u7 D 0A@e@ f& p%  7 v_5 ffg :eff 0ߖ%5 XPn & A@e@ 5u ff p%r & !y &V RLew %%C8@eu ff p%u p%5 XP & &7 N & ff % wff p%E55 %_l4 _1@ _1 _l4 _l4  _1  U   U& p% d & &% A 5u_8 ff p%5A@e@ f& p%5A@e@ f& p%55 %A&fffff e%_8 6  bA@ee@ f& p%% A@ee@ f& p%%  bh &c &A@ee@ f& e@m5& lK fe& p%5 &f& p%5eE5@5@ %@ % @ " % &A @mAm@ f& p% & e@  %u5 ~z tv_67 _1 &J)$ & 7 && RLee 5@ %J wn_1 _3 b_1 _6  _6  _P3_V3  _3  _3 _3  _3  V_^3JD_d3 _1 7 J_1  _(6  _(6 4B ; ZH ; _1 _1 _3 _3 _90 &5 @t  _3% _l30_p3 _3 _9 _F3 _9_9w 5 @5$ -^4,f &%@f& ~e@f& be@ f&* Fe@  *@ f&5 e@f&D e@f&O e@f&[ e@f&g e@" f&r e %wt4w `4 N} &  5  t@m0t@m05&& e %w4w 3 ! 5& &%f lK  %e%? m<5& &%%f lK  %e%ڂ N p7 d & fw63w "3 w3 $5@-e%%o vp  w 2^7F7 @60 RLe" % \"  %w2w l2  %  " & wL2w 82 w62@w 2 " 6 B & ^ f& W Nf Ve  H b `8Re B-<07:&e n   @5 ew 45 H @w&1w 1  &  Ve7 J w0w 0 i 87~ & & & Ve ,`  ,`  hk*%>! B  &"0 6g 7   &  bw40w 0 u@f Ve& W  f Ve  \f Ve@w/w /F@e5@e50Ӵe % ]}  x rö v b= @ 5@ȥ<, i f 6g N &  hku if 6g% N@ȥ>e ž= eNeP "R w.w .B L-  J w.w l. nBJ w^.w J.@   B@f Vew&.w .7 6  @2 Ve @ & w-w -` CJ w-w -D@   B &B VeA1&$ Ve 4 &Lf& RLew8-w $-  ,` Ne c-%H ,` & JR & W %7 L4@E%@E7T 45 N &X i 7 LnD@t7% 7 ^wh,w T,   t m& VeWtA m  %  6 2 Ve5@7F @@7@  & Ve 1 %w+w +2&4 k * K 7F70fe4 T:P6`2\AeP~($  e7w5 mm@ mm@ Btr2A A 7`w`w %%  mm@ f& @e7wzmZmX@ m`m^@ 7zwxlfm:m8@ 7\wZ_*Fw (T K 7l7b\ J _xJ _J _xJ7 7 $7 "7 7 7 7 7 7 7 7 ѼѸ _J _J<%%5  v ew 0_J7P J _J7 x7 v82m2m0@ 7bw` l@ H& e7\wZѡmm@ e@   e7wmm@ 7w7 7    ~x Be `@ `f& *e7wmPmN@ 7w~ 7 n7 lЊ"fbw%w %No jg&ff 6g w- L BUf 6g% Nq & w`%w L% Nf L 5- XP & N & w%w % X EB5%9 Pȥ~2% %  @m%% N` mB   @7@7 :w~$ w f$ Nf L 5- ff Ve XP & N & N &w$w #5 v r%  b-\u5  _M _M5 U!E%E @-35,55 A@@A 5 u u-u-A@@A 5u5 e  - A r7w@w"w "w"w "-  w" WpmwB@w p"5  e b _O & `%AA vw8  jRe5 5 "fe Ve%.%)N & - lf jReAWpN Fl7E5 7 $ fe Ve %% L-JFAWpN Fl7.  & 7 w!  jRe7 /fe Ve  %% Lttte -w & & w ` D/ 6 %0u/'+5 0u3!s-e-C  m3 Q W ww D/   %0u'w!e-h Qw /  ~_f& % e-&- %0u'wL w 4 0 Am@ f&$ jRe  @ E c5  %  0w&  @ppC`pLRݦ ;ew< w,w nNt@f @lewbw NDE5_ T% _rS _rS5`uu '& & Bge5u%%w @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & Bge5u %%    c%%%_R5 ,i5 5 E4N ff & Bge W _R%_dS%_dS_Rw :D xU5u5mu A@ww D HU5u5 A@ww De m@ e@ 5u%% du %e u 5mu A@ww pD T5u5 A@wTw @D%%055  m@ 5u%% e du %umumu 5umumu A@w7 hwZw DC AupB 4  & e%b c5% 傎& e%`@ @m A z &@w,  && e& & %ReR$ @  1  n "@! @#E B Ew  ln%w~w j Ne& f Xc%5wZ UE fef Xc%pww N g 5 Fl5 wNff e%@w D Lԋww N tf @leww N f\ 2Xww D el&&&&Wpe^f WpeHf0 be0wHw 45 5  AaAE f&A@vUU5u %ww D w̥/ 55 g&f  e %Nfe g fe Rg fe Rg ԥ.̋De & ` & 6g %fe0  r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44  ttw!wj\wddπe& ;ewJw u@t5858@ 5j9Nefef Xc% (3A@u5Btr828@ Aupj9 fef Xc% u-u-u-@wtw w T b!,& b   w 1&9 a%7˕,9Nf La w lD   !     +  w8e% - r<N r<&@&9 be9 ~ ~w  Nef b ww D 5  =4& b% `5ȥ=  = @wPe  w 0 BuNefef q%=@@wЋ Ћ  Jҋ~ @@W f r @  W f r@  @ mlclw e& 7 >76gw w  & f cew w w D85U5_d5P_d ʶ m@e4 ,5Ne & l  uN Fl4USt%5n ,i5j ,i5& & wlYwfw Net@f @le  w6w.w r 9U79U799Ae vBp7 r  h%b 55 a  a!PE -*%9 w Fn `e vWt vw@ `e @  Fn%e U? `e 79U?̔ a7 ̈?|U ew .D\E w$w D5 m 5N Fl!w5A vBB-  }ee@ !ۃ `!ւ ` `ml& E%^mX%w w7w 8fff 5& new&w  fff 5& neww  5 %O N  = :555Ne5& te5P:55'0Ne5 B& te57` Be0" 5%P:55 5 B5@B e: a=%:7B:w %P:5 B5Ne& te55e0%P:7G`Jʕ0%:ʕ1  %:˕0 ʥ9 *'$!      7& A& BF7!W-v7ҩ& & e Ӌ  &7& ne ӕ-ӕ0B~pӕ.  ӕ0~ B~&7D & e *ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_s@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff Je w5  @ 0   Wp `e06@~ w DCB P  5 , :% & E& g z   5 , @ :% & f E g  (˥-%0     ,:% &  g 8 5E& z   5 , @ :% & f E g  ww Nefef 5& ne C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @w:.. Znot in write modeoo"= "^i=:%16t=%8t:%16t%s ~@v  %s:%16t%16m%T%M:%16t%16t%-8u%-16U%-8o%-8x%-16X%-24Y%-8q%-16Q%-8o%-16O%-8d%-16D%-16.9f%-32.18F/bin/shsh-c@%c /usr/lib/adbadb-w-k-I%s %s > bad modifierbad commandsymbol not foundautomatic variable not foundc routine not foundcannot locate valueno breakpoint setunexpected ')'address expectedno processbad variabletext address not founddata address not foundodd addresstoo many breakpointsbad a68 framebad a68 linkaddress wrap aroundunexpected `='wait error: process disappeared!process terminatedtry againsyntax errornewline expectedbkpt: command too longfilename too longcannot open$<< nesting too deepT X 0\ @` Pd `h l ? p ?@ t ? x ? | ?  ?@  ?  ?  ?  ?@  ?  ?  ?@ ? ?@ ? ? ? ?@ ? ? ?  ?  ? ?@  ?@ ? ? p r t v          $ ( - 1 5 9 = B G K O S Y ] b g l q v {              ? ? ?  x     ?  ~     % * 0 5 ; A G L S Y _ f l r x  !)29?FLX^cku ",1<CJS^gpx  &,3;GQ[eov##"""F#"x#x#N##""movcmpbitbicbisaddsubclrcomincdecnegadcsbctstrorrolasrasljmpswabldfpsstfpsststclrftstfabsfnegfsxtmtpimtpdmfpimfpdmfpsmtpsmuldivashashcbrbnebeqbgebltbgtblebplbmibhiblosbvcbvsbccbcshaltwaitrtibptiotresetrttmulfmodfaddfmovfsubfcmpfmovfdivfmoveimovfimovfomoviemovifmovofcfccsetfsetisetdsetlmfptcsmwrtlcktstsetjsrxorrtscflgsflgemtsysmarksobsplold indirexitforkreadwriteopenclosewait4creatlinkunlinkexecvchdirfchdirmknodchmodchownchflagsfchflagslseekgetpidmountumount__sysctlgetuidgeteuidptracegetppidaccesssynckillstatlstatduppipeprofilgetgidgetegidacctphyslockioctlrebootsymlinkreadlinkexecveumaskchrootfstatgetpagesizevforksbrkvhangupgetgroupssetgroupsgetpgrpsetpgrpsetitimerold waitgetitimergethostnamesethostnamegetdtablesizedup2fcntlselectfsyncsetprioritysocketconnectacceptgetprioritysendrecvsigreturnbindsetsockoptlistensigvecsigblocksigsetmasksigpausesigstackrecvmsgsendmsggettimeofdaygetrusagegetsockoptreadvwritevsettimeofdayfchownfchmodrecvfromsetreuidsetregidrenametruncateftruncateflocksendtoshutdownsocketpairmkdirrmdirutimesadjtimegetpeernamegethostidsethostidgetrlimitsetrlimitkillpgsetquotaquotagetsocknamenostkfetchiucallfperrgldavr0r1r2r3r4r5sppc%8t%8t,%8t%8t%s%8t%d%8t%o%8t,(%s)(%s)+-(%s)(%s),X()())))))))t()()))X())(@()))))))))(')())))))))') ()()'))$(0 1B1%d: killedbreakpoint%16tstopped at%16t fed c#b&a)`|9999 :8:~::pspcspr5r4r3r2r1r0spr5r4r3r2r1r0/-variables = %Q ? map/ mappcs id = %d no process %07O: %s(%o,%o) from %8t%s:%10t? %o %s:%12t%o %8O:%8t%-8o,%-8o,%-8o ? %8t%8t"%24targs:%8t%8t%obreakpoints count%8tbkpt%24tcommand %-8.8d%24t%s%12t`%s' -b1 = %-16Qe1 = %-16Qf1 = %-16Q { bo = %-16Qeo = %-16Qfo = %-16Q} b2 = %-16Qe2 = %-16Qf2 = %-16Qfpsr %o fr%-8d%-32.18f %s%8t%o%8t%s%8t%o%8tov%8t%o :%16t%sunknown signal %d%s: running %s: cannot execute %s: cannot open %s: cannot create cannot change to overlay %d cannot set breakpoint: - core dumpedD,dja.outcore-cannot open `%s' 0%s+%o%Q%s+%orsymbol %d string offset > 64k - ignored %s: no memory for symbols %s: could only do global symbols ??longjmp botch longjmp botch bkr|&;LT^k2Signal 0HangupInterruptQuitIllegal instructionTrace/BPT trapIOT trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionStopped (signal)StoppedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesSignal 29User defined signal 1User defined signal 2SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT[_gksw,{h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB 9P:P:=(\rdrorxsfsergrsc~ssrlrLrurDrOrXsU0Icl R0R00 & . e7cce74  / :  7%  w $  B  B  B   @m % D- w w f  +  N %D)% <%%4!%,%$N B >D0& & % % 5/& m@ 5u7 Uff& <e )  & & e& & % rw wD w D 5u5mu A@w w D |5u5 A@wr w ^ De m@ e@ 5u%% du %e u 5mu A@w w D 5u5 A@w w D%%055  m@ 5u%% e du %umumu 5umumu A@wB w . fef %5 w w  D Lԋw w De LN 4e2e   4e5 Be v Nfe z%wt w ` -@ JwZ N7\ %\ w . u@t5p 5r @ 5 Nefef :% (3A@u5Btrr 2p @ Aup  fef :% u-u-u-@ww v BuNefef %=@@wJNlw e& 7 x7pgw~ywvw D5"E@e44fef % U4 4  fef %5 w ww7F Ћ w FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%  U   & % S U _R @_Vw DE%%"5   & % U wv w ^D55@   r 3 4 4 4 4 4 ww~w  $5+ &5e-e % & v    ww  5f 78 f 7wX@ m7 %e w       e-ww D 5 e %w  5 e-pw  ww  N ww rDCDpC  : wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  xJ U7jH U7`J ^H VAe vBB7 D  :%4 55 a  a!PE -%H  w$  `e vWt vw@ `e @  %e U? `e 7zH U?n a7` XZ?RNU ew dD.E wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7\*'$!      7x& Ah& BF7!JW-r76w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_~@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w 0Ncl R0R00DCB P  5 , :% & E& * z   5 , @ :% & f E *  (˥-%0     ,:% &  * 8 5E& z   5 , @ :% & f E *  wstrip: strip: %s not in a.out format strip: : Unknown error: %d,DNhz *9IXi} $7H^x#:Tv !Ef%8Zmz"4H^xRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator0 T T doxZfheZg4c@sjljLuDOXU0Rdl* S0S00 r B e7cce7T  /   7%  lw 8 e "%g%Ne@ @m& U@E%@N5 5 ?@ȥ-  i p r 6 @  R   @ȋ@ @m@ @m& T 5P @ @-N l|R  lww x f t 5N _N N Nef Nef _@E%@_/f f 5 uN &f  e%dNfR e@E%@e5 N Nef @EUf LN@E%@ NR %_v Nf  5 NEf : @w8Nffe &e@e5 ~@E%@ NR %Nef  5Ru- u-Nf_ ?  8NDR %  ߲ : 55%  ߆ : 5% %y_NEf @ 5N_  p NEf F fef z %5 fef p%@-N N N_NN N  Nef  _ _w T <N 55  ?Nef 6N Nef  @m N  t@w Nefsfe &eNfe T 5`N 5 Sfe Ufe Ne &f  e %NefXR e w 4 @5555 u55uNef N w w yR N nw w8 w2 |w, w& w D Lԋw w De LN 4e~e   4e Be v Nfe %w w ->@ w N| &%| w BuNefef 4%=@@w   Ћ Ћ w b D 4 4  wR w >  f t %  P J4 4 w w D 4-&4-!4 4   &e & z %4    w me   s lt  &w<wyww L D85U5_ 5P_ N mD@e4 ,5Ne &   uN J4USt%: 5F 0 5R 0 5& & z % 45@e-4  % U5EU  wE w D5"E@e44fef 4% 0 U4 4  fef 4%5 w ww ы A@Ћ w FD:5UE5Hw* _ 5uNfe & p% _ bNe &   uN J)U5| m- 5 & p%St%F   U   & p% S U _ @_ w DE%%"5   & p% U wv w ^D55@ 0   3  4 4 4 4 4 ww~w  $: 5+ ^ &5e-v@e %* & T     ww  5f  7 f  7wX@ m7: %* e w        e-ww D : 5 e %* wh  5 e-Nw  ww  N vww rDCDpC J  wZw FN wJ ~5 & E        ~5>wlYwfw Net@f De  w6w.w  V U7H U7> < 4Ae vB 7 "  % 55 a  a!PE -%  w$ J `0Wdl& S0S00e vWt vw@ `e @  J%|e U?jj `e 7X U?L a7> 68?0,U ew dD E wZw FD5  5N J!w5A vBB-  }ee@ !ۃ `!ւ ` `hm& E%m%w w7*'$!     L 7B& A2& BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu2 Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& z   5 , @ :% & f E  (˥-%0     ,:% &  8 5E& z   5 , @ :% & f E  w@(#) Copyright (c) 1983 Regents of the University of California. All rights reserved. @(#)cp.c 4.13 (Berkeley) 10/11/85Usage: cp [-ip] f1 f2; or: cp [-irp] f1 ... fn d2 cp: %s/%s: Name too long%s/%scp: %s: Not a directory. cp: %s: Is a directory (copying as plain file). cp: %s and %s are identical (not copied). overwrite %s? ...cp: %s/%s: Name too long. %s/%scp: : Unknown error: %d<DNhx*6LXdv 2?Udp/No'FVm:\q$:\n ' RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ,doxfegcslL4u8DO"XJU0]elD RR0R00   e7cce7  /   7%  w D%h%$-  e5@ @f I x~  %<@ a5 f  E%@  N a& F P @  % &    l ww N  &f  e% f ,%wffe eNef  w  f  f  w~ f  5F-- Nf ,% R N` l N f  , l NE% % Nf  %E%x N  ufE%@L ,_ E%;fef %N h_@a0E@  Nfe N jl`f % BLE% >E%`0E%r f  Ef   N h N _fe& %. N  N 5 5 5 5 Nef  N  __ f   N fe % f>f_w Nff le    %  ߪ  % %y w\ w B Dӥ/ˋˋw4 w  l Nff le l w w Nfe %Ne w w Nffe eNe w w (w w :w w w l D Lԋwd 9w !w w D De LN 4ee   4e Be v Nfe %w w -@ w N. %. w BuNefef %=@@w` &w< wwyww 0 D85U5_V5P_V ( m@e4 ,5Ne & `   uN 4USt% 5 5 5& & % 45@e-4  % U5EU  wE w D5"E@e44fef % U4 4  fef %5 wz wwЋ w FD:5UE5Hw* _p 5uNfe & % _p bNe & `   uN )U5| m- 5 & %St%  l U   & % S U _. @_2 w DE%%"5   & % U wv w ^D55@   N 3  4 4 4 4 4 ww~w  $ 5+ &5e-e %z &     ww  5f 7n f 7zwX@ mD7B 8%z e w  "     e-ww D  5 e %z w  5 e-w  f ww  N ww rDCDpC   wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  \ U7Z U7\ Z Ae vBx7 z  p%j 55 a  a!PE -2%Z  w$  `e vWt vw@ `e @  %e U? `e 7Z U? a7 ?U ew dDdE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7R*'$0belB RR0R00!     B 78& A(& BF7! W-N7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_Z@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w@(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)mv.c 5.3 (Berkeley) 5/15/8600usage: mv [-if] f1 f2 or mv [-if] f1 ... fn d1 (`fn' is a file or directory) %s/%s: pathname too long%s/%sCannot access%s and %s are identicalremove %s? override protection %o for %s? renamecan't mv directories across file systemsCannot unlinkreadwrite%s: unknown file type %oCannot unlinkmv: mv: %smv: %s: %s: Unknown error: %d(8DVhz-L[j2Qn0`w5Qi *>Q`t ' @ b w RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorB f f dloxx6fDe6gcsFlFLuDpO|XU0ggl)$H**0 This release incorporates all fixes and changes made since the release of 2.10.1BSD in January 1989 as well as several missing pieces of 4.3BSD (the namei cache, tmscp driver, long filenames, etc.) Bug reports, technical questions: Report bugs using the standard sendbug format (see bugfiler(1)) WITH AN INDEX LINE OF "2.11BSD". General questions can be directed to Steven Schultz at sms@wlv.iipo.gtegsc.com. At this time, contact by phone is not available due to a high degree of travel. If you're really desperate, print out a hardcopy example of the problem, and carefully mark your place with a picture of your favorite president, preferably a large denomination. Send it to me. Bug fixes will be posted to comp.bugs.2bsd. Archives may be requested from Steven Schultz by electronic mail. For an explanation of how unsupported this release is, read the the remainder of this and the "changes" document, and keep in mind that this activity is not what pays the mortgage each month. Credit where it's due: Paul Taylor of SUNY Oswego for volunteering to put 2.11BSD on his 11/73's back when it was known as 2.10.2SMS and fighting the beta test problems, proofreading and critiqueing the documentation. Terry Kennedy of St. Peter's College for final testing on a 11/70 and for putting together an 11/73 for me. Bob Karlicek of AT&T for loaning me his 11/73 (on the basis of an Internet developed acquaintance) to develop the TMSCP driver and related standalone support. Steven Schultz sms@wlv.iipo.gtegsc.com Paul Taylor taylor@oswego.oswego.edu Terry Kennedy terry@spcvxa.spc.edu Bob Karlicek rfkjr@mhuxo.att.com In general: - The system hasn't been fit onto a non-separate I&D or machine without a floating point processor in a long time. Lots of overlay schemes need to be worked out; the floating point simulator in the kernel hasn't been tested; sendmail won't run on a non-separate machine, so bin/mail and ucb/Mail have to auto-configure not to use sendmail; csh is overlaid now even on a separate I&D machine, /lib/cpp is pushing the limit to handle all the #define'ing that is required to compile the kernel... It is not anticipated the split I&D restriction will ever be lifted. The historical trend is for systems and programs to increase in size, not decrease. Kernel: - Profiling hasn't been looked at in years. It won't work as it is because the supervisor mode has been allocated to the networking code. - The networking is very stable. The DEQNA, DEUNA, DELUA, Interlan, 3Com, PRONET, ACC LH/DH-11 drivers are known to work; others will require some work. Diffs are provided in /sys/OTHERS for the VAX Excelan EXOS 204 driver. The XNS code is ported, but has to my knowledge never been compiled or tested. The residual PUP support has been removed (as it was in 4.3BSD). SL/IP works but can hang and not restart when you run out of CLISTs. It would probably be a good idea to increase CLISTs to the maximum when running SL/IP. The DEQNA driver is a fresh port from 4.3BSD and is more stable and much less susceptible to hanging than the old version. Don't even THINK of using TRAILERS on *ANY* of the machines in your LAN. In many cases the trailer code has been ifdef'd/commented out from 2.11BSD drivers, in other cases the trailer code has simply been ripped out. In any case, the current drivers drop trailer packets and increment the input packet error count. - The rtp call is wrong, any superuser call to turn off rtp will turn it off, even if it's not the process itself requesting to have its special status revoked. The whole 'rtp' call should probably go away. As far as i know it has never been tested with the present kernel and probably doesn't work. - There should be some way to monitor which overlays you're switching between to aid in determining the best overlay scheme for your kernel. - 2.10.X has not been made to run on the PRO series machines. See sys/OTHERS/PRO 0lgl#$H**0for more details and some helpful diffs. The OTHERS directory is quite useful, as it contains many other versions of various drivers and such things. - The directory /sys/vaxif contains the source for the VAX networking drivers. This is an excellent reference for adding new drivers and fixing current ones. Applications: In some of the major source subdirectories you'll see, variously, subdirectories named OLD and PORT. The OLD directories contain old 2.9BSD versions of software which were kept around for porting purposes. The PORT directories contain 4.3BSD code that we didn't have time to port, but felt should be ported eventually. Due to the amount of software ported from 4.3BSD (and the Internet) the number of PORT directories has been cut down in order to fit the distribution on two 1600bpi tapes. Many of the sources not included are available from INTERNET archive sites, others will have to be acquired from a friendly 4.3BSD site. There are only four OLD directories present in the system: /usr/include/OLD, /usr/src/include/OLD (two .h files for support of 'ps'), /sys/pdpstand/OLD (unused standalone programs) and /usr/src/new/OLD where the 2.9BSD remnants are kept. - User level gprof profiling has not been implemented. It should be doable, just hasn't been time to do it. Regular profiling seems to be working fine however. - Lint hasn't been ported yet; the old version is in an unknown state. (it doesn't work) - Ucb/sysline compiles but doesn't run. not a big loss really unless you have a 25 line terminal. - Ucb/systat hasn't been ported. but should be pretty easy EXCEPT for the '-vmstat' display, much of the information there is simply not applicable. - The acucntrl program in the usr.bin/uucp directory doesn't work. It sets flags properly in the kernel, but the tty drivers don't pay any attention to them. See /sys/OTHERS/acucntrl for a fix and comments. The temptation was to simply adopt the 4.3BSD soft-carrier mechanism and modify autoconfig to pass flags to the driver. For now the old method has been left in place. - The PDP-11 lisp hasn't been converted over to the new system calling protocol; it's a fairly straightforward, mechanical process, though. You can find it in /usr/src/new/OLD/lisp11.tar.Z - Most of the applications under /usr/src/new have been tested and work properly. However, a large number of the 4.3BSD new directory remains to be ported ... - Only some of the games have been tested. Most compile, but ... Man pages: The 4.3BSD-tahoe manual page system remains inplace from 2.10.1BSD. Manual page source is generally contained under /usr/src/man. Only preformatted manual pages are stored under /usr/man. The script /usr/man/manroff is used to help format manual pages. Man(1) has been modified accordingly. I'm not happy with this setup, it broke a symmetry i liked, but ... Because the 14 character limit on file name lengths has been lifted there are no manual page files whose names required truncation. The man program will automatically truncate any names over MAXNAMLEN-2, but since MAXNAMLEN is now 63 this should never be a problem unless manual page filename lengths take on the attribute of a novella. The following manual pages are NOT in 2.10BSD but ARE in 4.3BSD: dbx.1 gprof.1 symorder.1 vlp.1 fp.1 liszt.1 systat.1 ad.4 dn.4 kg.4 uda.4 autoconf.4 drum.4 mt.4 up.4 crl.4 ex.4 np.4 ut.4 ct.4 fl.4 pcl.4 uu.4 ddn.4 hdh.4 ps.4 va.4 dmf.4 ik.4 vp.4 dmz.4 ix.4 tu.4 stab.5 config.8 fasthalt.8 restore.8 The following manual pages are NOT in 4.3BSD but ARE in 2.10BSD: mkdep.1 nslookup.1 fetchi.2 gldav.2 nostk.2 rtp.2 fperr.2 lock.2 phys.2 ucall.2 l3tol.3 loadav.3 strcasecmp(3) ldfps.3 ltol3.3 strncasecmp(3) (since block numbers of files are no longer 3 bytes long, the l3tol and ltol3 routines are historical dregs) br.4 ram.4 rp.4 xp.4 dr.4 rk.4 si.4 dvhp.4 rl.4 sri.4 ra.4 rm.4 swap.4 dtab.5 stack.5 tzfile.5 bj.6 ttt.6 warp.6 words.6 moo.6 hostname.7 autoconfig.8 restor.8 The following manual pages DIFFER between 2.10BSD and 4.3BSD: adb.1 f77.1 man.1 px.1 nm.1 pxp.1 as.1 ld.1 pi.1 pxref.1 cc.1 lisp.1 pix.1 make.1 ps.1 adjtime.2 ptrace.2 sigpause.2 write.2 getitimer.2 read.2 sigreturn.2 getrusage.2 setitimer.2 sigsetmask.2 profil.2 sigblock.2 sigvec.2 (differences in the sig* man pages consist of substituting 'long' for 'int') bstring.3 gethostbyname.3 resolver.3 usleep.3 compat-sys5.3 inet.3 setjmp.3 vlimit.3 ctime.3 mktemp.3 signal.3 vtimes.3 execl.3 printf.3 string.3 rand.3 ualarm.3 acc.4 dz.4 inet.4f null.4 arp.4p ec.4 intro.4 pty.4 bk.4 en.4 intro.4n qe.4 cons.4 hk.4 lo.4 rx.4 css.4 hp.4 lp.4 tb.4 de.4 ht.4 mem.4 tm.4 dh.4 hy.4 mtio.4 ts.4 dhu.4 il.4 ns.4f tty.4 dmc.4 imp.4 nsip.4 vv.4 tmscp.4 a.out.5 core.5 dump.5 resolver.5 fs.5 bcd.6 chess.6 mailaddr.7 bad144.8 dump.8 icheck.8 quot.8 badsect.8 dumpdir.8 mkfs.8 reboot.8 clri.8 fastboot.8 named.8 rxformat.8 crash.8 fsck.8 ncheck.8 savecore.8 dcheck.8 halt.8 newfs.8 ======================================================================= The original README file as distributed with 2.10.1BSD ======================================================================= Please see the file /ERRATA for distribution errata notices. Bug reports, technical questions: Please, if possible, report bugs using the standard sendbug format (see bugfiler(1)) WITH AN INDEX LINE OF "2.10BSD" and e-mail it to uunet!ucbvax!bugs or bugs@ucbvax.berkeley.edu. General questions can be directed to Keith Bostic at one of the e-mail addresses below; if that's not possible, he may be contacted at 415-642-4948. If you're really desperate, print out a hardcopy example of the problem, and carefully mark your place with a picture of your favorite president, preferably in a large denomination. Send it to us. All bug fixes will be posted to comp.bugs.2bsd; archives may be requested from Keith Bostic by electronic mail. For a detailed explanation of how unsupported this release is, read the kernel changes document. Credit where it's due: Cyrus Rahman, of Duke University, is responsible for much of the work done on various applications for 2.10.1, as well as for making us do select(2) and adjtime(2) correctly. Steven Schultz, of Contel Federal Systems, did the original port of the supervisor space networking, as well as much of the debugging. Keith Bostic {uunet!bostic, bostic@ucbvax.berkeley.edu} Casey Leedom {uunet!ucbvax!vangogh!casey, casey@vangogh.berkeley.edu} Cyrus Rahman {dukempd!cr@mcnc.org} Steven Schultz {sms@etn-wlv.eaton.com} In general: - The system hasn't been fit onto a non-separate I&D or machine without a floating point processor in a long time. Lots of overlay schemes need to be worked out; the floating point simulator in the kernel hasn't been tested; sendmail won't run on a non-separate machine, so bin/mail and ucb/Mail have to auto-configure not to use sendmail; -DNONSEP needs to be passed up and down the make files (or better yet, the new environment inheritance feature of make should be used to pull out the environment variable MACHDEFS and SEPFLAG); ... The reason this hasn't been done now is, as always, lack of time. Kernel: - Profiling hasn't been looked at in well over a year. It probably doesn't work. - The networking is stable. The DEQNA, DEUNA, DELUA, Interlan and 3Com drivers are known to work; the PRONET and others will require some work. Diffs are provided in /sys/OTHERS for the VAX Excelan EXOS 204 driver. TCP/IP is in place and working; XNS has been ported, but will contain more bugs than the mainstream networking. PUP hasn't even been looked at. SLIP works, but can hang and not restart when you run out of CLISTs. DON'T EVEN THINK OF USING TRAILERS on *ANY* of the machines in your LAN. - The rtp call is wrong, any superuser call to turn off rtp will turn it off, even if it's not the process itself requesting to have its special status revoked. Probably need 3 defines: #define RTP_ON 1 /* turn it on */ #define RTP_OFF 2 /* turn it off if I set it */ #define RTP_FORCE_OFF 3 /* turn off everyone's */ If rtp(2) gets RPT_FORCE_OFF, it should find the process and turn off the stuff, if necessary; question is if rtpp is the flag that everyone checks for the existence of a run-time process. - There should be some way to monitor which overlays you're switching between to aid in determining the best overlay scheme for your kernel. Alternatively, and more correctly, gprof should be implemented for the kernel. - The device number is not currently included in the buffer hashing function, and probably should be. - 2.10 has not been made to run on the PRO series machines. See sys/OTHERS/PRO for more details and some helpful diffs. The OTHERS directory is quite useful, as it contains many other versions of various drivers and such things. - A new directory has been added, /sys/vaxif, which contains the source for the VAX networking drivers. This is an excellent reference for adding new drivers and fixing current ones. Applications: In each of the major source subdirectories you'll see, variously, subdirectories named OLD and PORT. The OLD directories contain old 2.9BSD versions of software which were kept around for porting purposes. The PORT directories contain 4.3BSD code that we didn't have time to port, but felt should be ported eventually. - User level gprof profiling has not been implemented. It should be doable, we just haven't had time to do it. Regular profiling seems to be working fine however. - Lint hasn't been ported yet; the old version is in an unknown state. - Ucb/sysline compiles but doesn't run. - Ucb/systat hasn't been ported, but should be pretty easy. - The acucntrl program in the usr.bin/uucp directory doesn't work. It sets flags properly in the kernel, but the tty drivers don't pay any attention to them. See /sys/OTHERS/acucntrl for a fix and our comments on it. - The PDP-11 lisp hasn't been converted over to the new system calling protocol; it's a fairly straightforward, mechanical process, though. You can find it in new/PORT/lisp11. - Most of the applications under /usr/src/new have been tested and work properly. However, a large number of the 4.3BSD new directory remains to be ported ... - Only some of the games have been tested. Most compile, but ... Man pages: The new 4.3BSD-tahoe manual page system has been set up. Manual page source is generally contained under /usr/src/man. Only preformatted manual pages are stored under /usr/man. The script /usr/man/manroff is used to help format manual pages. Man(1) has been modified accordingly ... Because of the 14 character limit on file name lengths, the names of the following manual pages have been changed: Old name New name -------- -------- getdtablesize(2) getdtabsize(2) getdiskbyname(3) getdiskbynam(3) gethostbyaddr(3) gethostbyadd(3) gethostbyname(3) gethostbynam(3) getprotobyname(3) getprotobyna(3) getprotobynumber(3) getprotobynu(3) getservbyname(3) getservbynam(3) getservbyport(3) getservbypor(3) inet_makeaddr(3) inet_makeadd(3) miscellaneous(7) miscellaneou(7) The man program will automatically truncate any names over MAXNAMLEN-2 (leaving room for the ".x" extension), so this should be transparent (at least until we run into names which aren't unique within the first 12 characters ... The following manual pages are NOT in 2.10BSD but ARE in 4.3BSD: dbx.1 gprof.1 symorder.1 vlp.1 fp.1 liszt.1 systat.1 ad.4 dn.4 kg.4 uda.4 autoconf.4 drum.4 mt.4 up.4 crl.4 ex.4 np.4 ut.4 ct.4 fl.4 pcl.4 uu.4 ddn.4 hdh.4 ps.4 va.4 dmf.4 ik.4 tmscp.4 vp.4 dmz.4 ix.4 tu.4 stab.5 config.8 fasthalt.8 mklost+found.8 restore.8 The following manual pages are NOT in 4.3BSD but ARE in 2.10BSD: mkdep.1 nslookup.1 fetchi.2 gldav.2 nostk.2 rtp.2 fperr.2 lock.2 phys.2 ucall.2 l3tol.3 loadav.3 strcasecmp(3) ldfps.3 ltol3.3 strncasecmp(3) br.4 ram.4 rp.4 xp.4 dr.4 rk.4 si.4 dvhp.4 rl.4 sri.4 ra.4 rm.4 swap.4 dtab.5 stack.5 tzfile.5 bj.6 ttt.6 warp.6 words.6 moo.6 hostname.7 autoconfig.8 mklost.8 restor.8 The following manual pages DIFFER between 2.10BSD and 4.3BSD: adb.1 f77.1 man.1 px.1 ar.1 file.1 nm.1 pxp.1 as.1 ld.1 pi.1 pxref.1 cc.1 lisp.1 pix.1 ranlib.1 date.1 make.1 ps.1 w.1 adjtime.2 ptrace.2 sigpause.2 write.2 getitimer.2 read.2 sigreturn.2 getrusage.2 setitimer.2 sigsetmask.2 profil.2 sigblock.2 sigvec.2 bstring.3 gethostbyname.3 resolver.3 usleep.3 compat-sys5.3 inet.3 setjmp.3 vlimit.3 ctime.3 mktemp.3 signal.3 vtimes.3 execl.3 printf.3 string.3 getenv.3 rand.3 ualarm.3 acc.4 dz.4 inet.4f null.4 arp.4p ec.4 intro.4 pty.4 bk.4 en.4 intro.4n qe.4 cons.4 hk.4 lo.4 rx.4 css.4 hp.4 lp.4 tb.4 de.4 ht.4 mem.4 tm.4 dh.4 hy.4 mtio.4 ts.4 dhu.4 il.4 ns.4f tty.4 dmc.4 imp.4 nsip.4 vv.4 a.out.5 core.5 dump.5 resolver.5 ar.5 dir.5 fs.5 bcd.6 chess.6 mailaddr.7 bad144.8 dump.8 icheck.8 quot.8 badsect.8 dumpdir.8 mkfs.8 reboot.8 clri.8 fastboot.8 named.8 rxformat.8 crash.8 fsck.8 ncheck.8 savecore.8 dcheck.8 halt.8 newfs.8 0|hla//̚0&0}ila//̚0&0~jla//̚0&0kla//̚0%0lla/ / ̚0%0mla/ / ̚0%0nla/ / ̚0%0ol ' /P/P0%0plǠ! 000$0qlǠ! 000$0rlǠ! 000$0slǠ! 000$0tlǠ! 000$0ulǠ! 000$0vlǠ! 000#0wlǠ! 000#0xlꇐa000#0ylɠ!000#0zlꄐa000#0{lꅐa000#0|lꇐa000"0}lꈐa000"0~lꇐa000"0lꈐa000"0lȠ!0@0@0"0lȠ!0?0?0"0lȠ! 0>0>0!0lȠ! 0>0>0!0lȠ! 0=0=0!0l"!  !엸!엚0!0l !  !엸!엚0!0l!  !엸!엚0!0l!  !엸!엚0 0l! !엸!엚0 0l! !엸!엚0 0l! !뗸!뗚0 0l! !뗸!뗚0 0l! !뗸!뗚0 0lpa0000l͠!0000l͠!0000l͠! 0000l͠! 0000l͠! 0000l͠! 0000l͠! 0000l͠!0000la0000la0000la 0000lȠ! 0=0=00lȠ! 0<0<00lȠ!0;0;00lꯑa 0;0;00l갑a 0:0:00lIɠ!0000lIɠ!0000lꮑa 090900lꭑa 090900lꮑa 080800lꯑa 070700lꮑa 070700lꯑa 060600la 0000l>ɠ!0000l?ɠ!0000la 0000la 0000la 0000la0000l7ɠ!0000l8ɠ!0000lٰ! --v--v00lƱ! ----00lð! ----00l֥! !뗸!뗚00l԰! --v--v00l!  ----00l꿰!  ----00lҥ!  !ꗸ!ꗚ00l4!  %kL%kL00l 5!  %^L%^L00l4!  %^L%^L00lϥ!  !闸!闚00lͤ!  !闸!闚00l̥!  !闸!闚00lʤ!  !闸!闚00lɥ!  !闸!闚00lȤ!  !闸!闚00l! &,g&,g00l! &+g&+g00lڼ! 0 ~0 ~00lڻ! 0 ~0 ~00lp! 0z#0z#00lo! 0z#0z#00l ɠ!0000la 0000la 0000la 0000la 0000l 6R0˦R0˦0=s`HST0l 6R0˦R0˦0=pYST0l 6R0˦R0˦0=PST0l 6R0˦R0˦0=MST0l 6R0˦R0˦0=CST0l 6R0˦R0˦0=EST0l 6R0˦R0˦0<AST0l R0˦R0˦0<q0T S06 q50jRZQJ4:3* ڠٰ 0 0r b0R B~02a "`0} |_^A@#"" j氥d T0C 30# 0 0 Ӌ0̨m0l|klN\ML00? @0ABk|0CdDTED{F4zG$]H\I?I>J!K L> MN O0P Q}0Rl S\0TL U<0V, W0XĠYðYZ奰[Ո\Ň]j^i_L`Ka~i be-c^K dNJ0e>- f.,0g h0h i0j k0lmnѠoаpqvrfsVtFwu6vv/ wXxv xu0yX zW0{: |90} ~0 pYDTYST0l R0ǦR0Ǧ0<c FE (q' jDZCJ&:%* ꐋ頌̐ˠ  rb RqBp 2S"R o nQP32jؠcS C3 #  ~} ̚_ |{^|]l@\?L" ?@ ABkn CdDTEDmF4lG$OHNI1I0JKL0MNO PQ| RlS\ TLU< V,W XYYZ嗠[z\y]\^[_>`=a~[bec^=dN< e>f. gh hi jk lmnÐo pqvrfsVtFiu6hv/wJxhxg yJzI {,|+ }~ PDTPST0l R0æR0æ0<U87qj6Z5J:) ܀ې龀ٽrbRcBb2E"Da `CB%$逢萣jʐcSC3#pǒQnmP|Ol2\1L<+„}d|]M={-z] \?>! >϶=Ц і҆veUE5.ĀÐޥΈ޾߮jiL~Kwi^-WKGJ7-',рАo_O?w/v(XvuXW:9wqaP@0ހ5 5  ࡐ ٿ yeidYGIF9))("E '& ̀ ̐!"q#j$Z%J&:'*() r)q*T+S,p-5.R/Q04132s3c4R5B62ڀ7"ِ89 9:;ۻ<˺=>?@~ABk`Cd}DT|ED_F4^G$AH@I#I"JKL"MNOPQ|RlS\TLU<V,WXYYZ剐[l\k]N^M_0`/a~Mbec^/dN.e>f.gh hijݷkͶlӀmҐnopqvrfysVxtF[u6Zv/xwp~=wZ^W?p@pApBkRCdopDTnEDQpF4PG$3pH2IpIJpKLM؀NOPQ|RlS\TLU<V,}W}XpYY|pZ{[^p\]]@p^?_"p`!a~>bec^ dN e>f.gh hijݨkͨlpmĀnpoppqvrfkpsVjtFMpu6Lv/iw.xKxKy-z-{|}~CDTCST0l R0R00;8pj`ZpI`9p)`p `p`١pҾp𒒂rdbcRFBE2("'E` Dp'`&p `p`p`pjpcSC3#qpSRp`4R`Qp4`|3pl`\pK`;p+`pԺĹ𿴜~„}}`d_]}`M|p=_`-^pA` @p#`"p`p!϶ Ці҅ueUE5.``p`މpl`޾kp߮N`Mp0`~/pwL^pW.G-7'ֶƵ`p`p`op_y`Oxp?[`/Zp(w?b@aA`BkCCda`DT`pEDC`F4BpG$%`H$pI`IpJ`KpLMpNOPQ|RlS\TLUpv/[w px=x^`W G7'֨ƧP`P`Po`_kPOj`?MP/L`(i.`KJ-,wpP``PP@`0P ` 5P xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P `!P"q`#j$Z%J&:'*e(d) G)F*)+(,FP- .(P/'`0 P1 `2rP3b`4RP5B`62P7"`89 9:;ې<ˏ=r>q?T@SAqPBk5CdSPDTR`ED5PF44`G$PH`IPI`JPK`LM`NOPQ|RlS\TLU<~V,aW`X~PY}`Y`PZ_`[BP\A`]$P^#`_P``a~"bd`c^dNe=f-gh hij݌k͋lƩPm`nPo`pmPqvl`rfOPsVN`tF1Pu60`v/Mw`x/x.yz{|}~ADTAST0l<  R0R00;U08 70 x0q6a5QA0 ܠ ۰ ཰  0 0y i0Yc Ib09E )D0"a &0CB%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k pYDTYST0l?  R0R00;G *)  x q(a'Q A 0 ΐ ͠ ௠    ysir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]PDTPST0l@  ~R0R00;9wqaP@0ހ ݐ  ࡐ ٿ yeidYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~OMDTMST0lD  |R0R00:+ wq pa Pp@0p π p p ٰ uttyViVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~ACDTCST0lG  zR0R00:wp``pP`@p0` p ` p ` p ٢ gpfeyHiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEDTEST0 lJ  xR0R00:wpP``PP@`0P ` P ` xP w` ٔ Y`vuXWy:i9YI8("PP`P`P`P u!P"U#j$5%J&'*e'`) G)ޗ`*)+y`,FP-[`.(P/~=`0 P1gY2rP3G;4RP5'62P7889:;ې<`=r>`?T@o`AqPBO`CdSPD/h`ED5PFJ`G$PGfIPIHJPK*LM NOwPQa `RlS@`TLU `V,aW`X~PX`Y`PZu`[BP\]$P^s_P`iUa~"bI7c^d)e=f6`gg`hi`j݌k`lƩPm`nPoq`pmPqZrfOPs:tF1Puv/Mvbx/xDyz&{|C`}~%`ADTAST0 lM  vR0R00:wpH`XPH@X0H X H X qH pX ٍ RXonQPy3i2YI8("HHXHXHXH u!~H"U#j$5%J|&'*^'X) @)ސX*"+rX,?H-TX.!H/~6X0H1gR2rH3G44RH5'62H7889:Ƽ;ۉX?M@oXAjHBOXCdLHD/aXED.HFCXG$HG_IHIAJHK#LMNOwPQaXRlS@XTLxU XV,ZWXXwHXXYYHZnX[;H\]H^l_H`iNa~bI0c]d)e=f/XggXhiXj݅kXlƢHmXnHoqXpfHqZrfHHs:tF*Huyv/Fv[x(x=y z{|?@oܠAABOCdD/EDmFG$OG I1II؁ JKc L0ME NOx' PPiQaCRlSA%TLU!V,WXX(+XˠYZ[z\ ]\^ _>_`i a~[bIp c^=d)R e>fngg0vgPhi2jklmnÐn8oqؠpqZ rfs: tFiu v/v8v xhx} yJz_ {,|{}}~] PDTPSTPWTPPET0l }pR0R00?  kȟ8MȡCHˉ=aI8ՍsHzhlXzhs`HDTHSTHWT0l hnR0R00? :ˉ aMDTMSTMWT0l hlR0R00? p`p`ˈp`EDTESTEWT0l  .jR0R009 V#8ˉ(a4 0t s0V U08 70 x0q6a5QA0Q ܠ 0 ཰  0 0y i0Yc Ib09E )D0"a &0CB%$ v90!ˠ"V0#j $50%J &0'* ') )ݰ*p +,ӌ-.n/~0P1g02s23G04S5'd0627F08 8(09 : 0; <&= >? @oABO̰CdD/ED{FG$]G0I?I؏0J!Kq0L> MS0N Ox50P QaQRl SA3TL U!V, WXĠXٰYZ[Ո\0]j^0_L`i0a~i bI~0c^K d)`0e>- f|g g^h i@j k"lmnѠoqpq[0rfs:0tFwu0v/ v0xv xڋ0yX zm0{: |} ~k pYDTYSTYWT0l  .hR0R00? H*ˉa& fe HG *)  x q(a'Q A 0C ΐ ௠    ysir YUIT 97)6 "S  54ې v+ !"V #j$5 %J& '*') )Ϡ*b+,~-.`/~u0B1g 2s$3Gt 4S5'V 6278 88 9: ;<=>?@oܠABOCdD/EDmFG$OG I1I؁ JKc L0ME NOx' PQaCRlSA%TLU!V,WXXˠYZ[z\ ]\^ _>`i a~[bIp c^=d)R e>fnggPhi2jklmnÐoqؠpqZ rfs: tFiu v/v xhx} yJz_ {,|{}~]PDTPSTPWT0l  .fR0R00> :ˉ auXW:9wqaP@0ހ5   ࡐ ٿ yeidYGIF9))("E '& ̀ v!"U#j$5%J&'*'ߐ) r)*T+,p-.R/~g041g2s3Gf4R5'H62ڀ7*88 9:;ۻ< =>?@oΐABOCd}D/ED_FtG$AGI#IsJKUL"M7NOxPQa5RlSATLU V,WېXXཐYZ[l\]N^_0`ia~MbIbc^/d)De>f`ggBhi$jݷklӀmnoqʐpqZrfys:tF[uv/xvxZxoy<zQ{|m}~OMDTMSTMWT0l  .dR0R00> ,ppˈa gII++ wq pa Pp@0p' p p ٰ uttyViVY8I89)"7pppp܀p v!p"U#j$5%J&'*'р) c)޳*E+,bp-w.Dp/~Y0&p1gv2sp3GX4Rp5':62p7889:;۬<=>ހ?p@oApBOCdopD/EDQpFfG$3pGIpIeJpKGLM)NOx PQa'RlSA TLU V,}ẀXpXீY|pZ[^p\]@p^_"p`ira~>bITc^ d)6e>fRgg4hijݨklpmڀnpoqppqZrfkps:tFMpuv/ivxKxay-zC{|_}~ACDTCSTCWT0l  .bR0R00> p`p`ˈp`X;:wp``pP`@p0`p ` ` p ٢ gpfeyHiGY*I)9 ) ")` ` p`p`p` v!`"U#j$5%J&'*s'p) U)ޥp*7+p,T`-ip.6`/~Kp0`1gg2r`3GI4R`5'+62`7 889:;۞p?b@opA`BOpCda`D/vpEDC`FXpG$%`GtI`IVJ`K8LMNOwPQapRlS@pTLU pV,oWpX`XpYn`Zp[P`\]2`^_``ica~0bIEc^d)'e=fDpgg&phipjݚkplƷ`mpn`oqpp{`qZrf]`s:tF?`uv/[vpx=xRyz4{|Qp}~3pEDTESTEWT0 l ;^R0R008 GMT+13000"l ;\R0R008 GMT+12000$l ;ZR0R007 GMT+11000&l ;XR0R007 GMT+10000(l ;VR0R007 ~GMT+09000*l ;TR0R007 pGMT+08000,l ;RR0R007 bpGMT+07000.l ;PR0R007 T`GMT+060000l ;NR0R006 FPGMT+050002l ;LR0R006 8@GMT+040004l ;JR0R006 *0GMT+030006l  ;HR0R006  GMT+020008l  ;FR0R006 GMT+01000:l  ;DR0R006 GMT-01000<l  ;BR0R005 GMT-02000>l  ;@R0R005 GMT-03000@l  ;>R0R005 GMT-04000Bl  ;<R0R005 GMT-05000Dl  ;:R0R005 GMT-06000Fl ;8R0R005 GMT-07000Hl ;6R0R005 GMT-08000Jl ;4R0R004 pGMT-09000Ll ;2R0R004 s`GMT-10000Nl ;0R0R004 ePGMT-11000Pl ;.R0R004 W@GMT-12000Rl 6,R0R00>GMT0Tl  E*R0R004hs|d lU!\F"L7#<($,% & ''p'p( p)p*p+p,p-p.p/tp0dp1]2M3=4-56 q6b7S8D95:&;Rp%p?vp@fpAUpBEpC5pD%pEpFpFGH޺IΫJKL~MoN~`OnQPg}pQWnpRG_pS7PpT'ApU2pV#pVpWpXpYpZp[\]^_o`_aOb?c/d|emfpfpg{phlpi]pjNpk?pl0pm!pnxpohppa.qQrAs1t uvvwxЧyz{p|p}p~ypiyp8@*0????0Vl  L(R0R004h e|H lG!\*"L)#< $, %& ' P' `(P)`*P+`,P-`.P/t`0duP1]2M3=4-s5r6 U6T77869:;6P<5`=P>`?uP@e`AUPBE`C5PD%`EPF`FGHޞIΝJKLbMaN~DOnCPgaPQW``RGCPS7B`T'%PU$`VPV`WPX`YPZ`[\]^_o`_aOb?c/odneQf`fnPgm`hPPiO`j2Pk1`lPm`nwPog`paqQr@s0t uvvwxЙy|z{{P|`}{P~yz`i]P8@*0EET DSTEET0Xl  L&R0R003h | lr!\c"LT#A?v2@f#AVBFC5D%EؐFɐFGHIJKLMN~}OnnPgQWRG{S7lT']UNV?V0W!XYZ[ \]^_o`_aOb?c/deffg藐h؈iyjjk[lLm=nx.ohpaKqQ<rA-s1t!uvvwxyz{ѐ|}~yi*0 EET DSTEET0Z l  L$R0R003h |s ld!\U"LF#<7$,(%& '5'&()*+,ۀ-̀./t0d1]2M3=4-56 6q7b8S9D:5;`3?v$@fAVBEC5D%ـEʀFFGHIκJKLM~N~oOn`PgQW|RGmS7^T'OU@V1V"WXYZ[\]^_o`_aOb?c/de|ffg艀hzikj\kMl>m/nx ohpa=qQ.rAs1t!uvvwxжyz{À|}~yi MET DSTMET0\ l  L"R0R00=h | lr!\c"LT#A?v2@f#AVBFC5D%EؐFɐFGHIJKLMN~}OnnPgQWRG{S7lT']UNV?V0W!XYZ[ \]^_o`_aOb?c/deffg藐h؈iyjjk[lLm=nx.ohpaKqQ<rA-s1t!uvvwxyz{ѐ|}~yi MET DSTMET0^ l 6 R0R003WET0` l  LR0R003h | lr!\c"LT#A?v2@f#AVBFC5D%EؐFɐFGHIJKLMN~}OnnPgQWRG{S7lT']UNV?V0W!XYZ[ \]^_o`_aOb?c/deffg藐h؈iyjjk[lLm=nx.ohpaKqQ<rA-s1t!uvvwxyz{ѐ|}~yiWET DSTWET0b l HR0R003hk lr!M"LT#ji$,6%JK& '*-'4) )*+,-ڐ./t01]2r3=4R562x688a9v:C;X<_=:>A?@f#A9BFCdD%ECFɐG#GIIJKL̿MNOnnPQWRleS7lTLGUNV,)V0XFXY(Z[ \]^_`_a}b?c]̐de=fgg藐hriyjTk[lqm=nSohp5qQ<rfs1tEuv/vxxyِz{λ|}~yBSTGMT0dl  R0R002 ` ` ` ~^>xgXIf8+`!H`e`*`G` `)``g `` F`!`"0 #i$%I%')'ϯ) t)*V+`,s`-x`.U`/Xr`07`18T`2r`36`4Q`4`61`64889:;ڽ<=>`?@I`A`B)`Cc`D `ECb`E`G#D`Ga`I&`IC`J`K_L$MrANOR#PQ2RkSTKTV+V`X`X`Y`Z`[o`\z`]Q`^Zn`_3``Ca}Ob#lc]1dNe=e0gghijܹk`l`mk`n`oK`p`q+`re|`s `tE^`tv.zvԗx\xyy>z[{ |t=}~TNZDTNZST0fl|  R0R002p9 P8/ ߀  ~^>xXf8H矀!dǁFc(E y Y~!w"B#`$"}%@&_' t'A)V)#*8+?,U-!.7/k01J2h3*ǀ4H5 6(68ۀ8Ө9:;џsN?c@\jAzBHr\^s*t<@uGv%\v)x>x y z{|}~fƀEST0hl  R0R002p@ #P"?0!   Ȉ   ^>xXm8O禈!kLjMj/Lg. Y!w"B#`$"%@&f' {'H)])**?+F,\-(.>/k 0 1J2i3*Έ4H5 6(688ӯ9Ĉ:;ѦsU?j@\qAzBOr\es1txXf8H矀!dǁFc(E g' Y~!w"B#`$"}%@&_' t'A)V)#*8+?,U-!.7/k01J2h3*ǀ4H5 6(68ۀ8Ө9:;џsN?c@\jAzBHr\^s*t<@uGv%\v)x>x y z{|}~fƀEST0rl 6 R0R000pSST0tl 6R0R000~JST0vls$ 0000127.0.0.1 localhost.arpa 0xl\cOQSUWR0R000 @Qp e7cce7@ /   7%  Iw L V7   2 5w @p   &  n% e ;% ( > J %D ( $  0P :D  X*7JwHN 5u e7DBҥ-) x7 "f P :D% I@ E Ne E @  < A@~ w 7e@ f& BeuA r<5A r<uNe 5e B ( %dffY (%%uwfg (% )  )  )  )   ) $  ) & & @%D zG   x (  I  BE  " I t7\ WtAZ 7  w t \ ) |%r pj f&WtAZ &%  >Wt@Z7, *-$, D 7 >ff % 7 w   X*7JwH &  Ee_6_6 /% _6N  _6 E  % :  \4 5W : f T f :D fff  e A@pn W <  f :D%N  N   : N G : , HE%%,_ c _ (   ~e LB 1 \ ( D P 2 B & ><5) e " & NI? e  D  X*f&A@ 7 w    7 w x t n N Lb 7^ w\ V 5 _ w FDQ& E_ ̥+N 5 5 A f& ff >eee@ ee@ 5u5@   < fe le X*@mAm@ 5u_ 5 5 ! f& ff ^=eee@ ee@ 5u E%̥: _ W-_ < ff =e5u5 5  f& ff e X*5uNe 5AWp<Ao f& AA f& 2   p67    G7 w>w >ww>w >   @ E w> 35% %  2%   /  7h &  7Z &   7B &   7* &  7 &   7 w &   7 w &  7 &  7 &  7 _w n=  wh=  0}lVcOQSUWR0R000j7 dl 4;b f;55 ffB 'e55(  D  p& C%er& C%et& C%e& C%e7w b<  _h E_ X_5 & f BE%5=D 5u fff Ee5 #u 1f HE%50 :=N >Hw;w ;D      + - ̥9 Wp @@`e̥0  wR;w :;D5 5      + -! ̥9 f& ff 2eee@ ee@ 5u̥0 A@  w:A@w:Ww:w :  3  BE  Wp,f&  Ee, HE%%, >H >H ҥ "w(:w :Dfef ~M%5 w: w 9D 3 KEtU4 4 w9&& e& & %ReR$T @  1   "@! @#E B Ew 9 L%w9`w|8pwv8w 84De _ t4 t t4 4t Ne&& 1% _t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5  55 Nefe 1% & L%5u7 t && 1% d fe 1%ff % fe& 1%w7A@E f& w n7wt7 ы ~ w :7D Lԋw27w 7DC  w75 7@  55@- 7 r5!w 6 @e5ff %w6w 6D5 N# ~%EAEt =_jp5]Ne X*N(fej @,%CaejNe -Aej@ H#e`5   7 @,%`5j  : @,%` Rӕ:ӕ Bej%_mo N #? @,%` 5 Nfej "2%`Aej@55 *@e`5^}^f@ej@A^1e^B^@^fe` 2%x  |Uv n%hNfejV L%@-`R ffej2 <#e O5$K &5h%D 4 D BE%5Qfej E e>fej /  NAej@f L%N >H L & fh `2%%%w3w 3D wvwn 57d%V<HT +%5:,  B#%7 %  BE 77%' ~"%% %% >Hw2w 2 >H7~w2w 2D 7xw2bw22w 2N  w2w 2D el&&&&Wpetf Wpe^f @,ewX2w D25 5  AaAE f&A@vUU5u %w2w 1D w1̥/ 55 E&f \* e %Nfe E fe E fe E ԥ.̋De & x" & BE %fe0 HE% >H %,@e05e wNe$ wNe( w%r_V _V% _V%2_VWpf~Wpemxe, _V@e\5 N f&te -4 @ E3 - *teV"5.N f&@.e@.A Ep@.A Ep - s" -3"  _V - t-|\"_V -l"77teV"5  e"7 -2 _Z@e"7w  r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 !ttw*!wD*\w>*w *De LN E4e"e #  E4e% Be v Nfe 2%wF*w 2*-@ :w,*N'" @,%"ew)awz)w )w@7% ?@w)N f #w )DC_)̥%_( 5 r y _( 9% 5afe & C%5@e5 5 N v) _( 5 N v) _( w) #_( #_( #_(  )% _(0 )% _(0 r  r f )% _(0 )% _(  )% _(  r  r f )% _:$_(0 )% _:$_( v) _:$_( #_:$_(0 )% _:$_( #_:$_( v) _:$_(0e r& )% _:$_(0e  @ r& )% _:$_(0 )% _(_:$ #_(_:$ _:$ v) _(_:$ _# _# _( _:$% _:$b_$fe & C%5@e5_*$ _( _@$ _$ _( _d$ _$ _( _% _% _(0 el rdf )% _(_:$ _% _(0 )% _(_:$ _% _# _( v) _(_:$ _$ _% h_& _$ _R$ Y% _n% _r% _ & G0 )% H_:$ _% _v$ - #2_:$ ! 0 el )% _:$ _P% _& _%  _:$? ̋_#_<$w ,$#A r e0@ A r 5   % # @  L % #  v)w#w #D w# z v?rw #u@t5#5#@ 5#Nefef 1% (3A@u5Btr#2#@ Aup# fef 1% u-u-u-@w"w " fe *@w" @pHA@tw$"w "T +!,& /   w" 1&# +%7%˕,#Nf + w <"D   !     +  w"e% - r<N r<&@&# @,e# ~ ~w ! Nef + w!w n!D 5  =n& /% `5ȥ= H = @w !e  w BuNefef ~M%=@@w w  / /  / w / /  ,5   & E 6@ ,w H  \4 7 NEw2 w   G7 w w  D 5 %" 5x@ #w%̥\" %%#r % % % X% % %  w rD=& /  wh w N  \4 7 _/ $ 2% % % %  %#77 8-7 8-7 8-7 7 _N/& /% % % % UbK % % N& /% % % % E(& /% % % % U& /%  -7 8-̋#̥#7̋7  & /   %wЋ Ћ   Ћ Ћ  Jҋ~ @@w FhN \J HNef PJ?@E% 8 02 1*L-% E e% E Ne% 1u-u- 0%w 0 w D >H4 4  Kww z f BE %  >HP J4 4 wNw :D 4-&4-!4 4   &e & HE%4    wme   s lt  &w wSwmow n1lw e& 7 >76gw*0B&I I7HIw  BuNeff ~M%=@@ww  fff ~2eww>yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_F45P_F4  m@e4 ,5Ne & PJ  uN J4USt%85D zG5P zG5& & HE% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff BE%ށ̥a &  Ee 3     U̥r 33w 4$ J  w5 4@E%@EU5N&e E &e E Nf&e BE%4 IN&e E &e E Nf&e BE%  (Ne& PJ  ff eee@ 4t@t"4 4t >H K_^5w N >H@ >HN Kww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  b= ve@ 4tw"w D55ff %f&& "eff&e e &e ? 55 ww8%w5 5 w D5#5ff T %f&& eff&e *ew6&e A'44  && ef&& Ee&e & L%%U w D5_9o5ff %f&& eff&e Ze L&e A8f f ff&e V e 744  && ef&& Ee&e & L%%UUw @@m e%fe J  &e ? 55 3ff `%f&e@ &50c &e ? 55 3 P :D U44  && ef&& Ee&e & L%%&_n9fffffe e _n9&e % _9_n9e_9  mm@ e@ f& ef&& Eefe& L%%_n9 l>_8w @0 0 @0 N f;77<%ww D85_reC ff e5u4 t "-t t"  ff ef&& Ee&e$& HE%%&e$ J `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& Ee&e$& HE%%&e$ J `Btp$t t"  ff Nef&& Ee&e$& L%%Uw w r D5#5 5 wZwVD%wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& $C% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm C% a@ `` e w D a@@m e  w e  aAm HN@`@m &f C%  aN f`f C%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef ~M% zGU4 4  fef ~M%5 w    6v&  @ppC`p   6@Cwzwtw D zG & & Ee 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _`G5uNfe & L% _`GbNe & PJ  uN J)U5| m- 5 & L%St%D @ \J U   & L% S U _F @_"Fw DE%%"5   & L% U wv w ^D55@ zG  >H 3 K 4 4 4 4 4 ww~w  $85+ &5e-e %( &     I ww  5f I 7 f I 78wX@ mZ7X8N%(e w  8 *    I e-ww D 85 e %(w  5 e-w G VIww  N Lww rDCDpC J J wZw FN KwJ ~5 & E        ~5>wlYwfw Net@f Je  w6w.w  b%U7`%U7b%`%Ae vB7   % 55 a  a!PE -H%`% w$ L `e vWt vw@ `e @  L%e U? `e 7`%U?ٔ a7 ٦?U ew dDzE wZw FD5 K 5N J!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%~ŷmxŇ%w w7*'$!      7& A& BF7!W->Q7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu0Bw* J@B |_JO@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& E z   5 , @ :% & f E E  (˥-%0     ,:% &  E 8 5E& z   5 , @ :% & f E E  w/dev/-n NO LOGINS: System going down at %5.5s /etc/nologin/fastboot@8 X,X,,x<<FjVjj8jj>jjjN???shutdownshutdown: '%c' - unknown flag Usage: shutdown [ -krhfn ] shutdowntime [ message ] shutdown: Incompatible switches 'fast' & 'nosync' NOT super-user Shutdown at %5.5s (in %d hour%s s%d minute%s) s[pid %d] /etc/utmpshutdown: /etc/utmpFINAL sleeperw ...%s System shutdown time has arrived %s by %s: %sreboothaltshutdownbut you'll have to do it yourself /etc/rebootreboot-l/etc/halthalt-lnowThat must be tomorrow Can't you wait till then? Bad time format  *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %d minute%s sSystem going down in %d second%s sSystem going down IMMEDIATELY ww %s `/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd/etc/utmplongjmp botch longjmp botch /usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d 4>Xj|)9HYm'8Nh * D f  5 V o  ( J ] j ~  $ 8 N h { RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator % , 4 > G N W _ h n t x } &''0'N''''(H(r(((SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y[_gksw,{h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/etc/ttysrronoffsecurewindow=/dev/ ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired H%l%l%vNd\NohNx&Of4Oe&NgOc Os6Nl6NL~NuND`NOlNXNU0l ?-/135R0R00/ @7\ e7cce7 /   7%  /w 2D  D&%"  /e( -# R_ c f_~ r_ ti xf_  TW ˋx9x # % # x # % #  V+%7H u   /f@& %x ' /w17 w 1 p V+ 7 `   /@ R_ r_ t x%w<1\    /^   b   \    ' /\     ' /  @  BN 5A Et&A v AX5 Ne/  tpTtTNfD %e %; b . R ʘ  _ʘ .7  V+ 7 \    ݠ\   \  \ x %\ xX H  "WtAT Et&WtAT v AX5tT tT \  \  \ x %  tT_ tT_\ x\  0tp-T(tT  tTU r'%U  7 U   tT`Z""f xe _(<6@ %.(*f Fe tT ._(f V+ 7 N!   /R2 ʘ %JQ  ʘ .74,NS  &  $ D(%  & eet76\  y  / ݶ\   ݤ   /\ L\ x %px H. Et& v Ax5*X Z>Q*X *X *Xn  d-b^Ά & %\   \  P\ x %  . & %_\ x %X H\ x fP_  _FP  72P-|jXr P~*X^ Z 7 P7 P*X *X X /֝OvX $PVP PRP PE%@ 7OOOH e *XjXJ@2@2@2fObO OO "e2r @22 @244266@2882::@2<<2>>e X )%*X0  7N_(w )H  \  5 (fe + @e E5FX HA\ x .w`)rDE%@JWpJWp J@zt"Z e Ne \ \ x %\ x %xw (DCF / &ee n%%e +3e E3wz(w f(X@e\,P~w -fe x\Ae,P~7 w*(@a+Ne W-   D-Ne  * 5f f fe fe / W-  f f fe e  \  \ x %w >'X% <_  t 0 ܘ % 7 (ʘr \+%bJ  L t eʘ& / %  P   . ݲe   ߪ $ D(%  v V+ 7% v Ne   Hfe N f&t eʘ& )%w&w & Wpq- %  w% Wp@f&: b+e7 H7 HN +   fe '% w % D̥/ K wn%ˋ ˥/  7K/w % Wpu,Hu,DWpeff )%Wp1   ff ef&$ b+ef 2%%ff< e /w$Wp %w h$  *%$7 Wpu,u,N fWpef )%Wp1 fؽWp Wp@ĽWpp, %  ff ef&" b+eWpef \+%%ff  e /N fWpef )%Wp1 Wp@ppwR#w >#D5 x@& / w0l ?-/135R0R00/0#w #D 3E%@%*!ta5 5    xff % ݀4 4 w" & ff e w ~"feff et@a55    f ff e ߀ff %w"ff %w !%2% t  f&t@a %27 XNeff %@t 8p p ew w!w r!  t  u5  < N*  / &feff ew t@af&t  %2fe / Neff % A@w w  W- u5f&@t@mA@wl    eA@v5u@-A- uu    t@mu5 ^ \ Zu5f&t@mIfeff e &A@v Dt@a55   5ut@appNeff %uu %_w N N w w D %kC 7CE%l C" 7C w w }- ww ~D e~%I M  whw N@p- wJ w 2N   f xww Nfl 2%ww ww  H b+eww BB fff eRCLCX e5uNff %e"Cw Cwtw `eCw Cwbw NLZB#@e5u Nef V Ne \eu-w5 `%DDmAE@  5m  \w De E4`?Z?m@ W pUU 2%7 $?7 "??eU& )% ?7m?w >wDw 0pUU 2% w>7>wn& d b+e7RwPww  ->>3->>.7 >7 > > |>U \+%7h> b> `  t y  w|.>eU  >> 7m >w > &e +w "NNe *DeCBm5 5 [ WNe V @@m%8@mAp@e!&p@j@X e5uNeff %e>@w 8@Ne *Dee5 N&Nmfe )%uume &@mAp??X ve5uNeff %e?w ? ww D& /  `e%ww A v@55 eu feff e@f@ Et@ae& )%w^w J5 A ve@55 feff e@@ Et@ae&f )%Neff %ww D^ e \  ww  ' /ww DeCԔԔԔ@pHwhw{w$  h     SW ~#r`J   w D      + - ̥9 Wp @@`e̥0  ww 0fef P3%5 wn w VD LԋwNw :N   w8w $D el&&&&Wpef Wpef r'eww 5 5  AaAE f&A@vUU5u %ww D :w̥/ 55D +&f  e %Nfe + Rfe r+ fe r+ ԥ.̋De & # & V+ %fe0 \+% . %,@e05e <wzNe$ <wlNe( <w^%rT_ L_% @_%2_,Wpf Wpeme, _@e\5 N <f&tͰe -֮ @ E3҃ - *te<5.N <f&@.e@.A Ep@.A Ep -^ sԵ -J3 :_ -* t-B_ -77te<5  e7 -ԭ _@e7w  Nefe z$w7 AWp@7Ĵ 7  f $  + 7:74 w d7 J7 7 7 T + 77wFw 2ڴX %̋      2  ww   @55 w-w-  t @ -  t5, 5, -h ue<&&fe Xe3 epe3w:w && f e[_ww  Q@f& e5uQ@f& e5uumumu _!eeQu  %QQ eu % ff et ff * e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 cttwf!ww Lu@t55@ 5ZNefef (% (3A@u5Btr2@ AupZ fef (% u-u-u-@wtww  %!,& '   wt 1& n%%7˕,Nf $ w ,D d !     +  w e% - r<N r<&@& r'e ~ ~w x Nef % wr w ^ D 5  =& '% `5ȥ=  = @w e  w Nef b&@w w  f b&@w w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef ',5@ 'Ne  ' %ʕ/  f V+% %% w Nef 'ҕaʋʥz#ʕaw BuNefef P3%=@@wp Ћ Ћ  Jҋ~ @@&w w (lw e& 7 7gwR w D85U5_~)5P_~)  m@e4 ,5Ne & "0  uN f04USt%$5>0 L-5:< L-5& & \+% 45@e-4  % U5EU  w E  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef P3% L-U4 4  fef P3%5 wZ    6v&  @ppC`p   6@Cw8w27t Ћ P ы A@PЋ w FD:5UE5Hw* _2-5uNfe & 2% _2-bNe & "0  uN f0)U5| m- 5 & 2%St%0 Z .0 U   & 2% S U _+ @_+w DE%%"5   & 2% U wv w ^D55@ L-  . 3 1 4 4 4 4 4 ww~w  §$$5+ &5e-e % & t    / ww  5f / 76 f / 7RwX@ m 7 $%e w   ܦ    / e-ww D $5 e %w  5 e-nw - (/ww  N 2ww rDCDpC f0 / wZw FN 1wJ ~5 & E        ~5>wlYwfw Net@f `0e  w6w.w  vU7hU7^\TAe vB@7 B  8%2 55 a  a!PE -% w$ f2 `e vWt vwȤ@ `e @  f2%e U? `e 7xU?l a7^ VX?PLU ew dD,E wZw FD5 1 5N f0!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%շmՇ%w w7D*'$!      7& A& BF7!W-77w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_5@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& + z   5 , @ :% & f E +  (˥-%0     ,:% &  + 8 5E& z   5 , @ :% & f E +  w/dev/rmt1rstXXXXXX lUsage: restor x file file..., restor r filesys, or restor t Bad key character %c restor: %s - cannot create directory temporary %s: cannot open tape Tape is not a dump tape Dump date: %sDumped from: %sTape is not a dump tape Tape is not volume 1 of the dump %s: not on the tape %s: inode %u Mount desired tape volume: Specify volume #: Volume numbers are positive numerics tape is not dump tape Wrong volume (%d) Can't find inode mask! end of tape extract file %u %u%s: cannot create file %s: cannot open Enter starting volume number: Last chance before scribbling on %s. Missing volume record Tape is not volume %d Missing header block End of tape Unknown header type Resynced at inode %u %u: ilist too small Can't find directory header! /Missing address (header) block Tape read error: inode %u Mount volume %d Cannot open tape! Not a dump tape.Try again Wrong tape. Try again disk write error: block %ld read error: block %ld Out of space. Convert old direct format to new Was converting old direct format, not now Checksum error %o error reading directory corrupted directory: bad reclen %d /SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec26mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT,h  TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d. ((((( AAAAAABBBBBB H4d.4o:4x4f5e3g4c4s4l4LP4uT4D24O>4Xf4U0l R S0Y~S0Y~0.:CX ecce7S "  7w :N 5%N \DC_ EN@&@&ZC L$e@5 l7 SN@&@&& .e5%N \%  R}C t# 7Cq N \C L$  7N @m&f \%%ZR C L$ 7BR D.De6D G"D,D$De$DGDDDeDGDDCeD"GC 6 3 5 6 t# 7C5 5 50l{ R S0Y~S0Y~0.CCCC.G L$%eC CCCC 5hC7G\Q 3e 7e^C-TCXC 5_ & f 3efef 3%$CA Am@ e@ 5u%%Ae? ve vWtWt@ 5u %%A fef 3%e u %Ae? ve vWtWt@ 5u 5 A AaA 5`u`u % fff 3edfeDf 3% B&& A 3edfeA 3% 5C5NefeD 33AYG\Q 3e 7N (6w )w )A N& 3w)e-lAN -?^AZAeTAw (w(w (Nefe  U@&  p  p   w\(w H(N  5    NeR7  Ne  Ne&  Ne   p  p  N&  w'w p'Nf U&  5 (  N&  w.'w '7 ?N  t?w'w &Ne  Ne&  w&w &Nf $ U @&  Ne  p  p  N  wL&w 8&N  5   N  w&w %Ne  NA  5   N&  Ne  w%w ~%Nf U@&  5   N&  w<%w (%7 =N  =w%w %NeM  5   Ne&  w$w $Ne  5   ND  5   N  wF$w 2$ND  N  5   N&  w#w #Ne@  7 ."N 5 p  N 5  w"N  5 X  N&  w !.w-.. @m7.ȥ- |.x.> j.-d.^. Z.79%:f . (<. 4. .. \Qf  \Q%H  \Q9  \Q  ?w! ̥:7 p9-*+--\9 -w--:H- -\Qf  \Q;H- @m79]H- -9 9 E5 @@l ww R DC E5<E@e33. @;E  5 , @;% & fE 3 5  d5U3 3  wDQ  d     SW ~#r`J   w (^Hf f1 5wN0fe "e%_H%%%  %%%cNe ,!5uu5 Ne 2 5u fff e ?`Hf f1 55D 55444  35@-5e  %bH\Q 3 N 5N 5@_*CeXN "e%  @ A@bl@ f&f e Nffe* "eDNe*& 3 4 e   w DE5_% _& _&5`uu '& & 3e5u%%w @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & 3e5u %%    0%%%_5 d55 5 E4N ff & 3e W _%_%__w D ,!5u5mu A@ww D 5u5 A@ww De m@ e@ 5u%% du %e u 5mu A@wDw 0D 5u5 A@ww D%%055  m@ 5u%% e du %umumu 5umumu A@w~w jD* /R ?x/E p/Gj/ b/ ^/V/ -V/?J/% PQ& 8/ 3  (/݀5(/PQE/ -/ ?/%  .PQ& . 3 w5.PQ w D      + - ̥9 Wp @@`e̥0  w^w FDC AupB 4  & N2%b 05% 傎& N2%`@ @m A &@w  w De LN 34etHe-&// I /wHS .%S 34eH Be v Nfe /%w&w -6&@ Iw NHS .%Sw PQfef d<%5 ,w w NefDQ $%ww Neff $%ww |D A555  ԋuNeffe $%wFw 2DC 5 5 _<&%%_^&5 %*e5  AWp `euCP 0u%l5  %h%[ *CPe  _&Neffff &e   * O  A@ EN 05% % % %Nf >/ &    %_% A@ E%Nf >/ @wN 05 w N%c%s%[Nf ff f& )ewN5 5 5 5 %e%f %o%xDe5 5 A @ EN 0% % % %- Ԑ A @ EN 0 _(%+_(  _(%a%f %A_(%F_( % A@vN 0O% A@v@mAm@ vA@v5uCP0 %a%fW7 5`u`u C% S P Ԑ A @ E =CP%%.%e%E- *% ' $ ! Ԑ A @ EN 0%+%-%0%9 A@  5u% N  >/ =   @e! @e! _&@t@]   xINe +A _&Ne +A @H@pHw BDC = 5%c%0u5 %s    0%rH%c5 %[rH      0%%   >/ =  D- %cwZ w BD ̥^  HHH % %]%-+ H $%-̥]4  H ̠ H HH %]  ww D*\5% %-%+ 5 55 55  B5eA5 CP%.55  B5eA5 CP %E%e$%+%-  Wp B`eCP  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& p-e5 55w 6 m 7<"&w D 3 9EtU4 4 wd w P N 3 5 ~85 w< Nff N2%@w  BuNefef d<% = @ 5@ @- =% Ne& NNe& 3 @w Ћ Ћ   Ћ Ћ w W f r @  W f r@  @ w D% 5     |@w 4- yw &  4  b '     ` TW ~  s`K6!  w  D85U5_P15P_P1 ! m!@e4 ,5Ne & :8  uN ~84USt%DQ5 PQ d55 \Q d55& & 3% 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff 3%ށ̥a &  3e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw $D5"E@e44fef d<% d5U4 4  fef d<%5 w w&w 7   ы A@PЋ w LD:5UE5Hw0 _J55uNfe & :% _J5bNe & :8  uN ~8)U5| m- 5 & :%St%PQ b F8 U   & :% S U _4 @_ 4w DE%%"5   & :% U w| w dD55@ d5  (6 3 9 4 4 4 4 4 www  $DQ5+ L &5e-.e %4R &     7 ww  5f 7 7J f 7 7Zw^@ m 7DQ%4Re w &      7 e-ww D DQ5 e %4Rw  5 e-w 5 @7ww  N :ww xDCDpC ~8 7 w`w LN 9wP ~5 & E        ~5>wrYwlw Net@f x8e  w6w4w  TU7|TU7rTpThAe vBT7 V  L%F 55 a  a!PE -%T w* ~: `e vWt vw@ `e @  ~:%e U? `e 7TU? a7r jl?d`U ew jD@E w`w LD5 9 5N ~8!w$5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%7w7*'$!      7& A& BF7!W-:C7& & e Ӌ @  o x d u        ӕ- f&@Ew ӕ0 J r@A r  f  e0 9e' $ ABRҋ D~@B l @  A  fff <e w 5  @ 0   Wp `e0w DCB P  5 , :% & E& 3 z   5 , @ :% & f E 3  (˥-%0     ,:% &  3 8 5E& z   5 , @ :% & f E 3  ww Nefef 5& bAe C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& Aeww  fff 5& Aeww  5 %O N  = T555Ne5& ,Ce5lT55'0Ne5 B& ,Ce57H Be0" 5%lT55 5 B5@B eT a=%T7|Tw %lT5 B5Ne& ,Ce55e0%lT7`Jʕ0%Tʕ1  %T˕0 ʥ9 6@~ (06V unit already in use attach: ucall %o(PSL_BR0, %o, %o) ucall attach failed no address found for %s Too many vectors to configure vectorset failed vectorset attached : br%d is not supported. Assuming 7 Hfx4x`Grab %o = %oStuff %o @ %o stuff 0%o%s %d csr %o vector %o: namelist doesn't match running kernel. skipped: No autoconfig routines.Reading CSR skipped: No CSR. interrupt vector already in use. does not exist. interrupt vector wrong. didn't interrupt. bad interrupt value %d. bad probe value %d. vector = 0, %sVec undefined 'nextiv' error for %s ucall %o(PSL_BR0, %o, 0):probe %s: return conf_int:%o%oucallEEE/unix/etc/dtab/dev/kmemPcdi:k:n:vusage: [-c] [-d] [-v] [-i file] [-k file] [-n file] r%s: line %d too long. %s %s %o %o %o %s: missing information on line %d. %s: warning: more than three handlers for device %s on line %d. _%sprobe_%sattach_%sVecendvec_conf_intCGOODCBAD_nextivtrap_versionKERN_NONSEP%s = %o %s: couldn't find symbols in %s. %s: %s is not the running version. GGGG(GzGGG@GRGGGG6HHHd HlHH6H`HHhkhprarkrlsixphttmtsdhdmdrdudhvdzcnlprxbrdntms$H: illegal option -- : option requires an argument -- rrnlist: sym 2 big : Unknown error: %d Unknown error: %d)))))))))))))))))))ZJbJlJJJJJJJJKK$K6KHKTKjKvKKKKKKKKKL)L8LPL]LsLLLLLLLMMf$>e =g=c=s=l=Ld=uh=DF=OR=Xz=U=(\0l+[ R0ʤR0ʤ0- - e7cce7x> / S  7%  Xxw {fe x & f xF%%& f xF%9 E  f xF%N   Qf  g =%_ f xF%_ - nf   4  =%b! E ?& &< Ee   e@ f& qef& re4t .; Q ; =% @55uNe& f w zw yD E ' $E    e@ f& qef& 4qe4 t7-;7- ; 7-;7- ;   Q MwJy4 4  @Nfe "r%@e4 55 & &" x;e ENfe "r%t#z'5@w xD & &" ;e 6J  4 t 8 E B > ;-6e"& ,et   3 3& D"ww && oe    -e"lt   && Poe  e" -  &  && oef53`tmt t & Dw vD e E @f& nef5-9* '4 $5  @ f& &%  %?  wlve ʋҵ -ʋw 6vN E N   Q%-Z8<!N  6= <E%@" 6E%<' 6E wuw uD s- & P 0& z%H7-7 E%@DH6 E  NM Q% 6 d Qf 6E| Q5 =%swtw tJ@ @e E5 e E55 @@-wt@5tDm@ t@ t4 &e@& "r% w 8t@ @&&e q% wt@  w s$fe x N E%@ 5 E N 4_> _> _> _  XNe& f %-5 w5? = L_  E3 = *   7R5!H5 % 3&5  7 53 Q 5 6E Q\3 Q<4/4 4?4 4_`4 E%@f 6E5 = 0@+4   7456Ne & f 5l 6E wqh/u f H% fe 0  & f H%3 & 3 xF%% t5 3 "r%wm3Nfe  5Nef3 %  6E_8  f H%/H3 D3N :3f "r%wm*3 CN u5 3Ne& f 2  > 2 H%N E N Q֝D1  Q_ w Np % -2%-|2 w4pfe x uu5 uN 5 @ f& gev$  @ e@ f& gef& 4geBr 2&Nef f 5N Nef f Ew 8oD  v5u W  _>  5u5 @ta f&@ta@tapp e t @taf&" 1e <rfe" "r%ff" 0e ["fe "r%$f "r%e%&@taf&" 0e '" "r%< E֝.# Q0 = fTwm@taf&@ta @ta0 0  ff L4%_ w FmAf  57dwf 5 f&" /e N  wm" "r%$f "r%e%&j@P% @& f H%@& f xF%5%% ff xF%%@& f H% f H%N 5 w l u- N 5 0lP R0ʤR0ʤ0-N wkw k Ce.  r  #@5D  r e0@# r C-˕#@wkw xkDD 4 4 @4 4 @E%`@E% wBk@eA P~Ce    ; :e@e Ce   A@ee@ f&f& 6e55e % 55@w ljD@5 55@7, ,w:j@7,`,7, X,@7,N,5@ f&fe j,e   5 & fe 6e 5!fff f ae u%@%`#;%7BeCtCae"  @Bfe` _%Ne`f D 3 e ܂Ne* > BtBaeCe0  '@  (fff L`ef&A @ f&&f ee ΂_N 55_w PhD%-*a E e v@55 w-(7 (((e@ 5 0u ,((,* JAe7tff,* .@e  wgwj(wf(A@X(V( v Ce,eEt`w dgD %E%@f E% ' =%#' Qh) b) f Z> P~ & xF%t wfw f@0#wf @&&e "r%w f@  %-(@0whf@&e Ztw 3<38s: e&w & w d fe x h/uN 5Nef f @Z> P~b  f xF%& &wcw cfelL R%feX R%X ZR $<_X Y` dC nU p: s t yN@ E H#e@ E ; Te@ȥ-   EN= vt# #e@ȥ-e@ Np#7n#h#7b#  Z1 C$ E  pM 6{7.#&#e7# # 6{7$#%@#%"%"N E T] %:D T] "ND T]  7"Ne @   Xx5 5 .0 _B` E _B@& Zt@& Zt @& ZtW*" %@p-N 5 ?!<7@p-/@p-) d.5 \ Xx pD T] N 5 XxN  Xx v/5r! A vEuPNe a% _6  Xx / # Xx XxwD`w 0`w N 6  _ 6E_ R( Q֝  Q Q %*6   6E Q  C Q a Q 8n  Q "* >֝P  Q   !!!! )e  "!e 7!w! !!!vv V!r!l! Qe F%*L  Q<f&3 4e %*9 QJ, e-f-`; QJ,  h Q e-8n QdJ, x * x D( ^ !  p Q Q 6 Xxw^w ]5 X7Ne `) QYNQu-N 5Z@ZFN= XN 5 XNef `Ӂ5`N 05ZNe\fZ `NZ5 `NZ5 N! Q w$]w ]6/f R` 5Nef `@E% @r ef vt @w\w \ /f R` 5_T w\=N> vt /B> Bt N > Bt >w N\&  & BG%  7 vw pfe x `# wt7nwd7^7^w\o 5mf>e q%    F 6E e =% Z> P~,  xF%2 k d1e 6E%  xF%: =%  xF%Z> P~ -Tw[L E%y =%  l  e@ f& Re5uE%`E% eu uub  f>e q%  E֝ Q =%  xF%Z> P~_ Dt`   _ t` f&& /e_ eu W-χ  & fe ,Oe " t`   &_ t`f&_~ % 6= _ exw r&  H% %,  6E =  E e  E%@ xF% 77 Ne f _ w ~XD55 w-w- w-6w-1ff@& e % D E֝\ Q i = r EwWff BG% e,w & ff BG%mffs& e % w E֝X = %F,  6E = *e-",~pHen-lff&VeJHpHe8et @_#w V fe x %$%N u& f xF%% Ne f 5 -؂* > wBVw .VD55 w-Zw-R w-L0w-D+&,*ff& He0, 3 pH%*wU*"e-w Ufe x '<&  xF% _' x 6E =  E  %d E_   %Q?  6E4 = [ = 6d E1   %+ e 6E~ =  =  E EU@  xF%fe L w4T&  xF% Ew T @5 @ _n) _n) ( &e Zt@0#_n) @&  @  =%_h)_n) @&  @7JH > vt 6e E5  &e Zt e 6E Vt-( 6EM@ -7N&> "r%S =%24@5wN&> "r%@ep  & H%DmN& x tW =%U@ _*,_*@7,*[ > vt e E5@ 4 1e E5@m-_*@7t@ep  & H%DmN& x t #^ &e Zt@0#Pa @&  @ { =%9; @&   &e Zt e 6E t- 6E7N&> "r% =%U @ @&   =%,.%0.,@ ',"%. @&   =%U@UwvP/ m-j ?e< E% j&e "r%7mX@ep 5 -L >. &  = =5_f-D &  P W &  _ =5%_f- 5 @E%@& xF%& & xF% e x@ ),$&? C%?p <f Ee Q  =5%C & H;f L & & xF%%& & xF%% U& & xF% E & & "e& E%w? _p+ @U _x+w VN"fe x b& f xF%%U<\?V R?NX uu%#-4N 5 uNe& f & f xF%%Nf  %'Nfe L -wtMw `M fe x h/15& & xF% C x  & H%5fe 0  ! fe z% -$̆wLJ, e- fe z% & & e& Ew vLD55 w-w- w-w-, 3w&Lff BG% *"e-Pff BG%< 6w K(fe x   _d2 R _l1 r l "r% 7 7 :&5 @t&&Btr"2" %2 b  ( 6E  B E L F H B f ` V P R L \ Qe _H20 * m. m, @ f&  &% a fe DX\ n5 5 ;A@m m @ f&& e5A@m m @ f&& e5fe fe "r%@ eu X R B @ 5 _d0u _d0-: .-4 ( fe D   ^z  fe D7b ^ T  Q   77wXIw DI   5x'& f xF%  -w"I E  Q ' =% 7tw H A %2z + 6E= Q .\ue" && t%%%"  && N%% &&" e wXHw DH7 777 7 7 77 \  X |zH B   %? QHFfe x  5 @a rD@ @a p@a` rD    m m @ f& >ef& >e5u" x g [ AaA f&A@ 5u7 J Dw D @w-> <w-6 7ff BG% ,e4w .%2zrwdw`"* > " x Ftp"p" 2  5u     t""f&t&& %2w,Fw Fw-Xw-P w-J?w-B:b 6E P% J'{ Q =  E4 %d) Q =  ff BG% ew ff BG%wVEw BEZNe ` EuNef `N Q ,u- f s 7N 7@E%`@E%  =  wDzN/ Q ^ f s 7<4F5 6EE Q0Q Q7 7 777& &* .@e 7    f& h;ew |7 tpnj-- vf& :  &% S 6Eer Q _>7R(t Q & &  TNe@ f& n:ee@ f& \:ef& |:e7$w"& &   e@ f& :ee@ f& :ef& *:e5u&  & :e5uA@@mAm@ 7 w  @A 5utn@mAm@ @mAm@ 5uNf x *7@7>J, _ =u-_ =  e@ f& 9ef& 09e7w  A@e@ f& 8ef& 8e5u  A@e@ f& 8ef& 8e5u^X@mAm@ @mAm@ v5u6ff $ e QP=L >%5% ENe= ` @E% E = s%7,  = s 7 = Q _8= ` Ne= `@E% u-= 6E A r Wp Amu7 @0 @~wv u-d5 5 @pp@ N* > eu u-u-އ 747.7(7 *7 7  z 6emrmp@ 7lwj ff r6emNmL@ 7HwF<B8>7 w@m77@m7_@7w >@E     @ `w> NN* Q w X>P0= 6EN\ Q֝ b Q h Qw">PfeL >%%o Eq QyYw =CBm %w=    A@ EN a%  @w j=D ff * %**5-5-wD= > ff&e  .@e4ttw &* > %%7 &* > * > v  v  v  vw;w ;D  A @v f&& 2te 8f f ef f e A @v f&& 2te f f e  6Eu 8N f& s%@-  w;f& s%  r @mAm @ f& ef x eeC-  Qw :D Y A @v f&& 2te 9f f ef f  e A @v f&& 2te f f ~e 6Eu5 6N f& \{%@- w9f& \{% C r @mAm @ f&D eeeu- J Qw p95 5 #ff BG%  ff BG%ew A@w69eu w-`w-Xԇ w 9uuNe h/w8w 8"& f xF%5% % Lf vt _6Dfe x De u-u%NuXNNef & f 56uuuNef & f 5N t5@e?!N&f "r%/u%Q@ef& "r%w7w 7 V Xxw7w 7S Q:  T] w7w n7 R T]   T] wX7w D7D + xN&  N E Q w7 =  E w 6N fff Qe Xxw6w 6$t Q N f fff Qe QB Q  XxN f fff QewJ6w 66 Q Nff f fff Qe w 6w 5D̋@̥33̥4 ) P7̥: ̋̋  P7 - %  Q 77wz5w f5 A vCBEt 45 *`$ v@ mm@ f&& e5  EEDme @ ! xt @t @ @w4 f vE@w 4A@v5uAEt5 R>  Dm"A@v@mAm@ f&& e , EDE`e @E  x  w3@ @ w 3  D m%A v@ mm@ f&& e = EDE `e @  x"L  wP3    4w *3* w"3,,w 2 %  T]  % & K w2&  @ppC`pL w1w v2D̥: ̋̋wh2w T2 C Wp De` ˋ ˋ =K ˋˋ w2w 2j@ ,a%w1= hI@0 hI@0 hI:&fe I% &fe I%w r1  $[P b 77 wZ1w @1  v7 w61w "1   @ I5%%@w0w 0 p  N& Ztw0 w 0 B  N& Ztw0 pw 0   N& Ztwz0 @%w/w V0 ~  z L  wH0 d 5 ff L% 50\  8 Aw /  uN t5&f %5Aw/ 5  f Zt  0   w n/ p  @e5ff l%5AwB/ ^5  w-R Z  4 w .  s  & N c%7:w.n, Zt z5f b 7 w |. pMw.w n. t  wp.ww P. |v e7 n  jd v7 \w6.w ".ww(.w .  > 8@ E w. a5% %2A ,a%  2A 4`2A JT 7& JT 7& JT  P7& JT  P7& JT 7& JT  @Q7nwl& JT  @Q7\wZ& JT 7B& JT 74& JT 7&_Mw , Q w,  .7 ( i j55 ff he55 Q D2A~A& "r%eA& "r%eA& "r%eD>82*A& "r%e7w +  _P, Zt_HP_LP5 & f s%5= @Q5u fff 2te5 #u 12Bf s%502B2B :=2BBN vw+w *D      + - ̥9 Wp @@`e̥0  w*w *D5 5      + -! ̥9 f& ff !eee@ ee@ 5u̥0 A@  w *A@w)w )Xfef |%5 \w) w )D 3 zzEtU4 4t w)w )D  v & & R% 6y5 f& R%UwT)w @)4De _T t4 t t4 4t Ne&& `% _Tt 4     6t-t- t-t- t- t- 55 eAePPPP 5 5  T 55 Nefe `% & %5u7  && `%  fe `%ff % fe& `%w'A@E f& w ':w'w 'D Lԋw'w 'DC  w'5 7@  55@- 7 5!$w 0'N X Tw.'w 'D el&&&&Wpef Wpef>hB _ehBw&w &5 5  AaAE f&A@vUU5u %w&w &D fwv&̥/ 55p t&f  e %Nfe vt ~fe Bt fe Bt ԥ.̋De & \ & s %fe0 s% v %,@e05e Uw&Ne$ UwNe( Uw %r_tU _tU% _tU%2_tUWpfWpeme, _tU@e\5 N Uf&tBBe - @ E3PH -f *teI5.N Uf&@.e@.A Ep@.A Ep -  sJ -3J PH_tU - t-I_tU -J747.teI5  eJ7 - _xU@eJ7w # Nefe L^w#7   t5,B 5,B - OHueI&&fe Xe3 eJpeJ3w0"w "& f e(w"w ! HJQ@f& Je5uQ@f& xe5uumumu _pZeeQu  %QQ eu % ff et ff e5u< ff let< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A: 5 8u 4  A: f&A@ 5u r  r   A: @mAm@ 5u e4 tWpe u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw\!ww BDe LN t4ee "]  t4e Be v Nfe &a%ww -"@ wN`J _%`Jw u@t5tJ5vJ@ 5JNefef `% (3A@u5BtrvJ2tJ@ AupJ fef `% u-u-u-@ww  fe L^@w @pHA@tww  h_!,& 4`   wr 1&4K @_%7˕,4KNf ^ w *D L !     +  we% - r<N r<&@&4K _e4K ~ ~w v Nef _ wpw \D 5  =& |`% `5ȥ=  = @we  w  BuNefef |%=@@wЋ Ћ   Ћ Ћ  Jҋ~ @@&w wSwmown`lw e& 7 L7Dgwbw  & f aeww>yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_b5P_b X mN@e4 ,5Ne & x  uN 6y4USt%L5X v5d v5& & s% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff s%ށ̥a &  2te 3     U̥r 33w 4$ 6y w5 4@E%@EU5N&e vt *&e Bt Nf&e s%4 IN&e vt /&e Bt Nf&e s%  (Ne& x  ff eee@ 4t@t"4 4t v zz_dw N v@ vN zzww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  l ve@ 4tw"w D55ff %f&& "eff&e e &e ln 55 w&w"fKw5 5 w D5#(5ff T %f&& eff&e *ew6&e Pp'44  && ef&& 2te&e & \{%%U w D5_$hXo5ff %f&& eff&e Ze L&e Pp8f f ff&e V e 744  && ef&& 2te&e & \{%%UUxw @@m e%fe x  &e ln 55 3ff `%f&e@ &50c &e ln 55 34d r U44  && ef&& 2te&e & \{%%&_hfffffe e _h&e % _Th_he_Th  mm@ e@ f& ef&& 2tefe& \{%%_h m_Ngw @0 0 @0 N j7p7ljKww D85_kNe& xq fe Ve4-4-/44  &&  ef&& 2te&e & s%%&e x &e ln 55 ewwnKw4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  l ve@ 4t4-4-/44  && ef&& 2te&e & s%%&e x ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& 2te&e$& s%%&e$ x `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& 2te&e$& s%%&e$ x `Btp$t t"  ff Nef&& 2te&e$& \{%%Uw w r D5#5 5 wwrKwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& q% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l*5l,u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm "r% a@ `` e w D a@@m e  w e  aAm HN@`@m &f "r%  aN f`f "r%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef |% vU4 4  fef |%5 w    6v&  @ppC`p   6@Cwzwtw D v & & 2te 4E05Ew7b Ћ P ы A@PЋ w FD:5UE5Hw* _v5uNfe & \{% _vbNe & x  uN 6y)U5| m- 5 & \{%St%X  x U   & \{% S U _t @_tw DE%%"5   & \{% U wv w ^D55@ v  v 3 zz 4 4 4 4 4 ww~w  $L5+ &5e-pxe %< & N    lx ww  5f lx 7 f lx 7wX@ m7L%<e w       lx e-ww D L5 e %<wb  5 e-Hw v www  N b{ww rDCDpC 6y x wZw FN zzwJ ~5 & E        ~5>wlYwfw Net@f 0ye  w6w.w  PKU7BKU78K6K.Ae vB7   % 55 a  a!PE -%K w$ 6{ `e vWt vw@ `e @  6{%zve U?dd `e 7RKU?Fє a78 02?*&U ew dDE wZw FD5 zz 5N 6y!w5A vBB-  }ee@ !ۃ `!ւ ` `bm& E%mꢇ%w w72*'$!     r 7h& AX& BF7!:W-7&w 8uDAB %u f& & e w5 5  W- W00~u5  .luDBw* J@B |_}@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& t z   5 , @ :% & f E t  (˥-%0     ,:% &  t 8 5E& z   5 , @ :% & f E t  w=....lost+foundBAD INODE %u TO DESCENDZERO LENGTH DIRECTORYREMOVEDIRECTORY TOO SHORTFIXDIRECTORY %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTwrong type to dirscan %d DIRECTORY CORRUPTEDDIRECTORY CORRUPTED%s NAME=%s %s=%s DIRFILENAME=%s UNREFLINK COUNT %sDIRFILE COUNT %u SHOULD BE %u LINK COUNT INCREASING (ADJUSTED) ADJUSTUNREF %s DIRFILE (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%u CONNECTED. PARENT WAS I=%u NO SPACE LEFT IN %s (EXPANDED) EXPANDPARTIALLY TRUNCATED INODE I=%ubad inode number %u to ginode %s %sDIRFILECLEAR (CLEARED) I=%u OWNER=%s %u MODE=%o %s: SIZE=%ld MTIME=%12.12s %4.4s %ld %s I=%u BAD STATE %d TO BLKERRBad -t option%c option? Can't open checklist file: %s /etc/fstabCan't get memory Can't open checklist file: %s /etc/fstabrwrorqforkCAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Free List %ld files, %ld used, %ld free %ld files missing, imax: %u tinode: %u The following duplicate blocks remain: %ld, The following zero link count inodes remain: %ld, ***** FILE SYSTEM WAS MODIFIED ***** ***** REBOOT UNIX ***** /Can't stat root Can't stat %s Can't stat %s %s is not a character device Can't make sense out of name %s Can't make sense out of name %s /rPARTIALLY ALLOCATED INODE I=%uCLEARbad size %ld:HOLD BAD BLOCKSIZE=0 FILE HAS ALLOCATED BLOCKS. I=%u (CLEARED) CLEARbad direct di_addr[%d]: %ld bad indirect addr: %ld LINK COUNT TABLE OVERFLOWCONTINUEUNKNOWN FILE TYPE I=%u mode: %oCLEARBADEXCESSIVE BAD BLKS I=%u (SKIPPING) CONTINUEDUPEXCESSIVE DUP BLKS I=%u (SKIPPING) CONTINUEDUP TABLE OVERFLOWCONTINUEDUP&Z''''Z',,,,,,ROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECANNOT ALLOCATE ROOT INODE CONTINUEROOT INODE NOT DIRECTORYREALLOCATECANNOT ALLOCATE ROOT INODE FIXBAD STATE %d FOR ROOT INODE.BAD INODE NUMBER FOR '.'FIXMISSING '.'...CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' FIXFIX....BAD INODE NUMBER FOR '..'FIXMISSING '..'.CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' FIXEXTRA '.' ENTRYFIXEXTRA '..' ENTRYFIXNAME TOO LONG %s%s I OUT OF RANGEREMOVEUNALLOCATEDREMOVEDUP/BADREMOVE%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED) REMOVEBAD RETURN STATE %d FROM DESCENDBAD STATE %d FOR INODE I=%u../.*/.@/@/UNREFUNREFBAD/DUPBAD STATE %d FOR INODE I=%u%d BAD BLKS IN FREE LIST %d DUP BLKS IN FREE LIST n_files %ld n_blks %ld n_free %ld fmax %ld fmin %ld ninode: %u BLK(S) MISSINGFREE BLK COUNT WRONG IN SUPERBLOCKBAD FREE LIST** Phase 6 - Salvage Free List ALLOCATED INODE(S) IN IFREE LIST (FIXED) FIXBAD FREEBLK COUNT Default free list spacing assumed BAD BLOCKS IN FREE LIST.EXCESSIVE BAD BLKS IN FREE LIST.CONTINUEEXCESSIVE DUP BLKS IN FREE LIST.CONTINUE/Can't stat root Can't stat %s file is not a block or character device; OKCan't open %s ** %sNO WRITE ACCESS (NO WRITE) Size check: fsize %ld isize %d File System: %.12s NEED SCRATCH FILE (%ld BLKS) ENTER FILENAME: Not a good scratch filenameCan't create %s TMP FILE (%s) ON ROOT WHEN CHECKING ROOTDDDG(GGHHHHHHbad file type 0%o INTERNAL ERROR: GOT TO reply() %s? no yes WRITING ZERO'ED BLOCK %ld TO DISK CANNOT %s: BLK %ldCONTINUEProgram terminated SEEKREADSEEKTHE FOLLOWING SECTORS COULD NOT BE READ: %ld, SEEKWRITESEEKTHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld, ?..?returning to single-user after filesystem check (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d %s: %s: UNEXPECTED INCONSISTENCY; RUN fsck MANUALLY. %s: Invalid -s argument, defaults assumed Fatal I/O error Fatal I/O error Fatal I/O error /etc/fstabrb/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwdSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec^bmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %dNV`z*<H^jv,DQgv0A`"9Xh+Ln"6Ln$9RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired vKKK}d|o }x}f}e|g}c}s|l|L }u$}D}O}X6}U0l (R0sR0s0+   e7cce7 / t  7%  ,w f ^ 57v ;@ȥ-6 M P nL e p w!2% N % , ewl% | ,%wF@ = N Zu :f & 5r ,wlw XFzCN p N % w.FN |  77 ~ 5" ʋ N\ e_>  | Ne ( J / D 5=z*  | Ne   % %  vՀ@E%@_  %5 A@ EN %._ A@ EN %s_ A@ EN %o_ A@ EN % NE < % fN T_  _ @._ .fe D 5_  @ _  @ _  _ Ne& J /~  5_1  _  \   \0 < n %  @ %N TNe J Ne uuNe~ u-_ u-_  @Ne @E%@E% `  N |%A   %[ %_~o e   |  5 eN 5_N _ 5_  eX_ www 6 fef %5 $w" w D Lԋw9wn!whw De LN \4ee V  \4e Be v Nfe 6 %wpw \-8@ wVN %w * w(&  %5u 8 - x ff %5 EU@ff % f   e 6  5  5 fe&  %ff J%N  N  %\e& ;eww u@t55@ 5Nefef % (3A@u5Btr2@ Aup fef % u-u-u-@whw T Nef x wNw :D 5  =H& n % `5ȥ= " = @w e  w BuNefef %=@@w Ћ Ћ   Ћ Ћ  Jҋ~ @@w  D 4 4  Nw w  f . %  P 4 4 w w D 4-&4-!4 4   &e & 4%4    wn me   s lt  &w < w mn lwz e& 7 7gwL BI I7Iw  fff 0 ew w yw &  4  b '     ` TW ~  s`K6!  w D85U5_ 5P_  m@e4 ,5Ne &   uN 4USt% 5J 5F 5& & 4% 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff .%ށ̥a &  :e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef %0l  (R0sR0s0+ U4 4  fef %5 w ww7 PЋ w FD:5UE5Hw* _5uNfe & 0% _bNe &   uN )U5| m- 5 & 0%St% <  U   & 0% S U _ @_w DE%%"5   & 0% U wv w ^D55@    3 N 4 4 4 4 4 ww~w  $ 5+  &5e-e % &     @ ww  5f @ 7 f @ 74wX@ m^7\ R% e w  < .    @ e-ww D  5 e % w  5 e-w T ww  N 6ww rDCDpC  | wZw FN NwJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  U7U7Ae vB7   % 55 a  a!PE -L% w$  `e vWt vw@ `e @  %e U? `e 7U? a7 ?U ew dD~E wZw FD5 N 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%zmt%w w7*'$!      7& A& BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& l z   5 , @ :% & f E l  (˥-%0     ,:% &  l 8 5E& z   5 , @ :% & f E l  w@(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)catman.c 5.7 (Berkeley) 5/27/86manx/catx/../catx/Zcn/usr/man12345678ln/usr/lib/makewhatisMANPATH%s: missing path usage: catman [ -p ] [ -n ] [ -w ] [ -M path ] [ sections ] catman: %scd %s mkdir %s catman: mkdir: %scatman: %scatman: %s: Not a directory rcatman: %sman../cat../catln -s %s %s catman: symlink: %snroff -man %s > %s%s catman: nroff: %s: exit status %d: Owooooo! %s %s%s catman: %s: exit status %d : Unknown error: %d"4DPbt%9Xgv >]z<l'A]u  " 6 J ] l  3 L n RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator/bin/shsh-c ((((( AAAAAABBBBBB doxfegvcslLuDOX U0lr 0&0&0+# # Internet server configuration database # ftp stream tcp nowait root /etc/tcpd ftpd -l telnet stream tcp nowait root /etc/tcpd telnetd shell stream tcp nowait root /etc/tcpd rshd login stream tcp nowait root /etc/tcpd rlogind #exec stream tcp nowait root /etc/rexecd rexecd #uucpd stream tcp nowait root /etc/uucpd uucpd #nntp stream tcp nowait usenet /etc/nntpd nntpd finger stream tcp nowait nobody /etc/fingerd fingerd -s -l #tftp dgram udp wait nobody /etc/tcpd tftpd comsat dgram udp wait root /etc/comsat comsat #talk dgram udp wait root /etc/talkd talkd #ntalk dgram udp wait root /etc/ntalkd ntalkd echo stream tcp nowait root internal discard stream tcp nowait root internal #chargen stream tcp nowait root internal #daytime stream tcp nowait root internal #time stream tcp nowait root internal echo dgram udp wait root internal #discard dgram udp wait root internal #chargen dgram udp wait root internal #daytime dgram udp wait root internal time dgram udp wait root internal 0 lt hLR0R00* @=  e7cce7| /   7%  5w 8 <&7*w(%@-  5@ 1@& 5    5 b'% 5  6% ( " %  : d,%  %  %  %  % ` ut   "5 N   r w 7 f  4 %  17 , %         % -%  zw7  7w 6 : , "1 57Bf 8%  5  t 4 w6w 6   %   4 %   "1 * p'%" p'%1 p'%B <&, 8% 4w6w 5P L%N& F% N 8w5w 5  & fefefe <+e % & F%wx5@w ^5 55 6 fe& & fe <+e % ff& Fe Nf Few4w 4    E  %   %   %  %  , "1%5 f  &  &     h%% L 5 -!%% %w"4w 4 X A C "1    &  &  5EN5W5  ff  h%e  5Ne -!  wv3  "1 ;a p'%c" p'%j1 p'%  ~ v . r * 7 j 7 h B <&, 8% 4w 2    | d,% -%w2& %%5u# % % &      ff n%w (2J4  V!_>5_>$/& +% $&e +% &e p'%   5 l FJk&e +% A3 ~ x b& p'%&e p'%  1 &e p'% !_ @  5  ` 27 7  `      wh0w T0D   &  4 &  w*0w 05 Ne <&@ @f&A@  W < @%@pp@ 5  %  % & "% Nfe Fe R  Nfe R  5@0w8/w $/D85  "1 _L Ne 06 _ _H w-b_ @e7P NF 7 8 t672 F  [ XN (1%5 r,5=& +% 2/   f& p1ee p'%e p'%e( <&, 8% e,AWp,md  4 :  "1 )& p'%" p'%1 p'%B <&, 8% 44 4 4 4 wf-w R-` 4 wP-w <- 4 w:-w &-  % #& H %     -%   w,w ,D  &  4 w,w ,D5 Ne <& A@  W <% tt 1  %  % & V% &e Fe  &e R  5w+w +,DCe @a= u @ap @a0 5 Nefef l%N F% V w\+ ̥ ̋ %S5@e w + \5< F  , "1%5 f  &  &    h%e F% 5Ne -@-5@t5@  x F wL*+K3w)w * De t4 tt 4 4 Ne&& P,% w)  eu @w6);w0) w")%w)Zw)w )D      + - ̥9 Wp @@`e̥0  wD)0 lm hLR0R00*&& e& & D%ReR$ @  1  4 "@! @#E B Ew (p 8%w(pw(w (4De _ t4 t t4 4t Ne&& P,% _t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5  55 Nefe d,% & %5u7  && P,%  fe d,%ff p% fe& P,%w*'A@E f& @w 'w'w &D Lԋw&w & @e5ff j%w&w &D5 N# F%EAEt =_25]Ne <&Nfej $(%CaejNe Aej@ e`5 n f^ Z T $(%`5>   $(%` &ӕ:ӕ Bej%_rmo N  $(%` 5 Nfej ,%`Aej@55 *@e`5^}^f@ej@A^1e^^@^fe` F-%p  PUJ 6%<Nfej* 8%@-`R ffej e O5K 5h%D 4  "1%5fej 1 e>fej *  NAej@f 8%N 4 8 & fh "-%%%\w#w #D wJwB 578%*<@ p'%5,  %7%  "1 77%' F%% R%% 4|w#w "h 4^7vw"w "DT 7Lw"bwJ"w "N  nw"w "D el&&&&Wpef Wpefl $(ewp"w \"5 5  AaAE f&A@vUU5u %w("w "D w "̥/ 55 1&f t e %Nfe 1 fe 1 fe 1 ԥ.̋De & @ & "1 %fe0 (1% 4 %,@e05e wNe$ wNe( w%r_ _% _%2_WpfvWpempe, _@e\5 N f&te -, @ E3 - *te5.N f&@.e@.A Ep@.A Ep - sf -3f _ - t-t_ -df77te5  ef7 -* _"@ef7nw T Nefe |&wD7 AWp@7 7  f & f 1 f77 w 7 7 7 7 f 1 f77ww 0 '̋      2  ww z  @55  w-w-  t  -  t5, 5, - ܣue&&fe Xe3 efp4ef3ww & f eww  Q@f& e5uQ@f& e5uumumu _eeQu  %QQ eu % ff `et ff re5u< ff (et< ff :eL A@e@ f& et e  =  r  rd > r 8 8 rd ( Ah 5 8u 4  Ah f&A@ 5u r  r   Ah @mAm@ 5u e4 tWpe8u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw!w\\wVw De LN 14ee   14e Be v Nfe F-%w^w J-@ wDN $(%ewaww w@7% ?@wN f Nw DC_$̥%_$ 5 r y _$ 9% 5afe &z 0%5@e5 5z N >% _$ 5 N >% _$ w(I N_$^ N_$p N_$  $% _$0 $% _$0 r  r f $% _$0 $% _$  $% _$  r  r f $% _ _$0 $% _ _$~ >% _ _$ N_ _$0 $% _ _$ N_ _$ >% _ _$0e r& $% _ _$0e  @ r& $% _ _$0 $% _$_  N_$_ _  >% _$_ _ _ _$ _ % _ b_fe & 0%5@e5_ _$ _  _  _$ _,  _  _$ _J! _  _$0 el rdf $% _$_  _`! _$0 $% _$_  _|! _ _$y >% _$_  _X  _! h_" _r  _  Y% _6!{ _:! _! G0 $% H_  _|! _>  - N2_  ! 0 el $% _  _! _H" _!  _ ?  ̋_b_ w DA r e0@ A r 5   % @  L %  >%ww D w x r n?j6e& ;ew w u@t55@ 5VNefef d,% (3A@u5Btr2@ AupV fef d,% u-u-u-@ww  fe |&@w @pHA@tw w  '!,& *   w 1& p'%7˕,Nf & w 8D   !     +  we% - r<N r<&@&W  $(e ~ ~w  Nef ' w~w jD 5  =& +% `5ȥ=  = @we  w  BuNefef ^9%=@@ww   p d / 7 .1ww   37 ww tD 5 %" 5x@ #wV%̥\" %%# % % % % % %  w D=& *  w w   r d / 7 _* L-% % % %  %#7 7 (7 (7 (7 7 _*t & +% % % % UK % % Nw & +% % % % El({ & +% % % % U: & +%  :)7 (̋#̥#7̋7  & *  w:Ћ Ћ  Jҋ~ @@w %Nf f fff J,e _F,g %]@ D  %0  Q% 80 - f 1 % x c  = ?   @ ǃJw wR SwL mowD nx,lw. e& 7 @78gw ,*B I I7Iw T BuNeff ^9%=@@w* w   & f @-ew w  fff @-ew w\ ywV &  4  b '     ` TW ~  s`K6!  w N D85U5_/5P_/  m@e4 ,5Ne & 06  uN t64USt% 5p Z35l Z35& & (1% 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff "1%ށ̥a &  p1e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5b   6v&   6@Cwzwtw D Z3 & & p1e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _@35uNfe & 8% _@3bNe & 06  uN t6)U5| m- 5 & 8%St%  <6 U   & 8% S U _1 @_2w DE%%"5   & 8% U wv w ^D55@ Z3  4 3 7 4 4 4 4 4 ww~w  $ 5+ H &5e-*e % & r    5 ww  5f 5 74 f 5 7wX@ m 7 %e w       5 e-ww D  5 e %w  5 e-lw 3 65ww  N 8ww rDCDpC t6 5 wZw FN 7wJ ~5 & E        ~5>wlYwfw Net@f n6e  w6w.w  tU7fU7\ZRAe vB>7 @  6%0 55 a  a!PE -% w$ t8 `e vWt vw@ `e @  t8%e U? `e 7vU?j a7\ TV?NJU ew dD*E wZw FD5 7 5N t6!w5A vBB-  }ee@ !ۃ `!ւ ` `mT& E%Fַm@և%w w7*'$!      7& A& BF7!W-=7|w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_*;@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& 1 z   5 , @ :% & f E 1  (˥-%0     ,:% &  1 8 5E& z   5 , @ :% & f E 1  w/bin/sh-/etc/rc/etc/utmp/usr/adm/wtmp/dev/console WARNING: Something is hung (wont die); ps axl advised @/etc/autoconfiginit~shutdownfatal signal: %dcannot get kernel security level: %scannot change kernel security level from %d to %d: %skernel security level changed from %d to %d/fastbootautobootpowerfail~rebootno space for '%s' !?!'%s %s' failing, sleepingutmp malloc failed'%s %s' failing, sleeping-%s: %mconfigure system autoconfig-vcinit: couldn't exec %s configuration setup error SERIOUS CONFIGURATION ERROR unrecognized return from configure longjmp botch longjmp botch /usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d|(4FXjv <KZr"A^o Pg % A Y z   . A P d z   0 R g RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator      % / 7 @ f""""#^####$:$f$$SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y     ,  h # ' + / 3 7 ; C G K O S TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/etc/ttysrronoffsecurewindow=/usr/bin:/bin:/usr/ucb:/usr/local:/usr/new:/etc++++,+++,,,,,,,,,,,V:d<:oH:x;f;e:g:c:s:l:L^:ub:D@:OL:Xt:U0 !lS$ R0'R0'0*# Copyright (c) 1980 Regents of the University of California. # All rights reserved. The Berkeley software License Agreement # specifies the terms and conditions for redistribution. # # @(#)gettytab 5.7.1 (2.11BSD GTE) 12/9/94 # # # Most of the table entries here are just copies of the # old getty table, it is by no means certain, or even likely, # then any of them are optimal for any purpose whatever. # Nor is it likely that more than a couple are even correct # # # The default gettytab entry, used to set defaults for all other # entries, and in cases where getty is called with no table name # default:\ :ap:fd#1000:im=\r\n\r\n2.11 BSD UNIX (%h) (%t)\r\n\r\r\n\r:sp#1200: # # Fixed speed entries # # The "std.NNN" names are known to the special case # portselector code in getty, however they can # be assigned to any table desired. # The "NNN-baud" names are known to the special case # autobaud code in getty, and likewise can # be assigned to any table desired (hopefully the same speed). # a|std.110|110-baud:\ :nd#1:cd#1:sp#110: b|std.134|134.5-baud:\ :ep:nd#1:cd#2:ff#1:td#1:sp#134:ht:nl: 1|std.150|150-baud:\ :ep:nd#1:cd#2:td#1:fd#1:sp#150:ht:nl:lm=\E\72\6\6\17login\72 : c|std.300|300-baud:\ :nd#1:cd#1:sp#300: d|std.600|600-baud:\ :nd#1:cd#1:sp#600: f|std.1200|1200-baud:\ :fd#1:sp#1200: 6|std.2400|2400-baud:\ :sp#2400:ht: 7|std.4800|4800-baud:\ :sp#4800:ht: 2|std.9600|9600-baud:\ :sp#9600: g|std.19200|19200-baud:\ :sp#19200: # # Dial in rotary tables, speed selection via 'break' # 0|d300|Dial-300:\ :nx=d1200:cd#2:sp#300: d1200|Dial-1200:\ :nx=d150:fd#1:sp#1200: d150|Dial-150:\ :nx=d110:lm@:tc=150-baud: d110|Dial-110:\ :nx=d300:tc=300-baud: # # Odd special case terminals # -|tty33|asr33|Pity the poor user of this beast:\ :tc=110-baud: 4|Console|Console Decwriter II:\ :nd@:cd@:rw:tc=300-baud: e|Console-1200|Console Decwriter III:\ :fd@:nd@:cd@:rw:tc=1200-baud: l|lsi chess terminal:\ :sp#300: X|Xwindow|X window system:\ :fd@:nd@:cd@:rw:sp#9600: # # Fast dialup terminals, 2400/1200/300 rotary (can start either way) # D2400|Fast-Dial-2400:\ :nx=D1200:tc=2400-baud: 3|D1200|Fast-Dial-1200:\ :nx=D300:tc=1200-baud: 5|D300|Fast-Dial-300:\ :nx=D2400:tc=300-baud: # # Wierdo special case for fast crt's with hardcopy devices # 8|T9600|CRT with hardcopy:\ :nx=T300:tc=9600-baud: 9|T300|CRT with hardcopy (300):\ :nx=T9600:tc=300-baud: # # Plugboard, and misc other terminals # p|P9600|Plugboard-9600:\ :nx=P300:tc=9600-baud: q|P300|Plugboard-300:\ :nx=P1200:tc=300-baud: r|P1200|Plugboard-1200:\ :nx=P9600:tc=1200-baud: # # XXXX Port selector # s|DSW|Port Selector:\ :ps:sp#2400: # # Auto-baud speed detect entry for Micom 600. # Special code in getty will switch this out # to one of the NNN-baud entries. # A|Auto-baud:\ :ab:sp#2400:f0#040: 0"l} RR0&R0&0) =z e7cce7x / 6  7% T 2w 4 .  *  N w4w 4t *  N w4w x4 5  *   v%  ֝ 1 % @& 1  - 1S 1 @& D%f 1: &  %    1e * . 1  2    *   % %@5 &  %ysmie  t& b2e  "A r  %  <_f h d ^X n %7p > :4.  4 0 *$ : %7= w6 t& b2e t& b2eNet& b2e  t & b2e  P _v    ~   7s7l t& b2e 2 p l L * X . @ _ V .  * ~ z_ 5uwvu NBU t& b2eut& b2eNe}t& b2e  *    mp  m  e @ &  e  2 .  *  *._$__w /    * w/t *  w t& b2e w     7 7  t& b2e7 7 7 7  nfe& 1%  2@E  2% % % ~ * %  >_<A .HA A %#% % = s %@@   O %  _A % _%~_Ԑ@ _w .D A !Wp Ce`AWp C̥. Ae`e    r` r  wt-w `-D ̋wZ-w F- u@E(E5 @x5p %   fe 4%w,w , ~ 4%7 lw,w , ~" w,w ,D@ ̋;̥%  %. d" h t -5/f - 5N  N zNe Ne% w,w + 7 ~Nf L %;, Ne&  4e   u% 3 e j s  H5%2e wz+A@x2w P+, 4e   e j e w+w *, 4e   e je w*w *  ˋ    wv* w V*@  x bZT \V ` XRw&* B5 5 vU bU@NU<U  5PuP%RU UA@U  U UUUUUU@w 0) N % N %P N %P N %P  N %Pw(w (D   w(  L-ew (Dz * # @  ˋ ˋҔ% ̋ˋ z@  ,% 7w*(w ( W- @u  w(2 5 e w 'B   ~ 1 ~, - ̋ w'w ~', .5 fe& 1% ŀ  B5 @@mp %؂@@m0e Ne& 15 @w&w &5 Net& b2e  5 5 Ne& & fe e Bfe& 1%%65 5  Ne& & &  eNet& b2e @     @w%w % 5 w@ ( 1 56 4% N  N 2 jw|%D N 2 @e!نԐB-fef 1%5 @a0"ly RR0&R0&0) % D-Ć\ w % 1mv:-hO 4% c ̥t]cYefe 1 Ce˥:  % cNefe L %Ce ˥: 1A@`5%} 4% @` & 1 w w $w #~ ˥#%  ̋ ̋˥|˥:ˋ w#˥:˥| ˋˋ˥: Dw #D̥: ̋ ̥:w#w r#  x̋T̋AA@ ̥@@wF#̥#  ̥0 5 5 fffe ee 5`u`u AA@w "P  x̋T̋AA@ ̥̋: w"̥!̥@w t"  x̋T̋AA@ ̥@ wP"̥= N&  w &"DC=%::\  x"EB @  A0teP ADw!w !  fe + Ne 5"  % %%  %@e5( el && &&f+f H-ew w De t4 tt 4 4 Ne&& /% w  eu @ww&  @ppC`pL)w e& 6 ;ewWw]w&& e& & %ReR$ @  1  p "@! @#E B Ew |F 4%wvpww \4De _ t4 t t4 4t Ne&& /% _t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 6 55 Nefe /% & %5u7  && /%  fe /%ff % fe& /%wA@E f& |w bw ы ~ w D Lԋww  @e5ff %wzw fD5 N# %EAEt =|_r5]bNe `+Nfej H-%CaejNe Aej@ P$e`5    H-%`5   H-%` ӕ:ӕ Bej%_mo N $ H-%` 5 Nfej "0%`Aej@55 H*@e`5^}^f@ej@A^1e^^@^fe` 0%*  U v%Nfej 4%@-`R ffej D$e O5K 5h%D 4  1%5fej 1 e>fej -  NAej@f 4%N 2 4 & fh `0%%%,ww D ww 57%< ,%5,  J$%7% p 1 7rn7b%Z'L #%%@z, %% 2Jww  270ww D 7wbww xN  wvw bD el&&&&Wpef WpefB H-ew$w 5 5  AaAE f&A@vUU5u %ww D jw̥/ 55t 1&f f e %Nfe 1 fe 1 fe 1 ԥ.̋De & # & 1 %fe0 1% 2 %,@e05e wNe$ w|Ne( wn%rd_^ \_^% P_^%2_^<Wpf0Wpem*e, _^@e\5 N f&te - @ E3$ - *te&5.N f&@.e@.A Ep@.A Ep -n s`& -Z3`& J$_^ -: t-.&_^ -`&7N7Hte&5  e`&7$ - _b@e`&7w  Nefe +w7 AWp@7 7  f , `& 1 `&77 w 7 Z7 7 7 `& 1 `&7t7nww p ,̋  H  H  2  wBw .  @55 w-w-  t & -  t5, 5, -x ܝ$ue&&&fe Xe3 e`&p e`&3wxw d& f eBwPw < &Q@f& Je5uQ@f& Pe5uumumu _Z!eeQu  %QQ eu % ff et ff e5u< ff let< ff ~eL A@e@ f& \et e  =  r  rd > r 8 8 rd ( A> 5 8u 4  A> f&A@ 5u r  r   A> @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw!w\w w De LN 14ee $  14e Be v Nfe 0%ww -6@ wN& H-%&ewLawFw wj@7`% ?T@JwN f $w DC_*̥%_) 5 r yv _) 9% 5afe &P 0%5@e5 5PN ~* _* 5^N ~* _* w $_*4 $_*F $_*  *% _*0 *% _*0 r  r f *% _*0 *% _*  *% _*  r  r f *% _B%_*0 *% _B%_*T ~* _B%_*W $_B%_*0 *% _B%_*i $_B%_*r ~* _B%_*0e r& *% _B%_*0e  @ r& *% _B%_*0 *% _*_B%t $_*_B% _B% ~* _*_B% _$ _$ _) _B%% _B%b_&%fe &^ 0%5@e5_2% _) _H% _% _) _l% _& _) _& _& _)0 el rdf *% _*_B% _& _)0 *% _*_B% _& _$ _)O ~* _*_B% _% _& h_' _% _Z% Y% _v&Q_z& _' G0 *% H_B% _& _~% -] $2_B% ! 0 el *% _B% _X& _' _& _B%? ̋_$_D%w &A r e0@ A r 5   %& @  L %&  ~*w w D w 2 , (?$w h u@t5&5&@ 5P'Nefef /% (3A@u5Btr&2&@ AupP' fef /% u-u-u-@w w  fe +@w @pHA@tww j  ,!,& -   wP 1&' ,%7˕,'Nf , w  D ~ !     +  we% - r<N r<&@&-' H-e' ~ ~w T Nef , wNw :D 5  =& -% `5ȥ= x = @we  w  BuNefef R5%=@@wЋ Ћ   Ћ Ћ  Jҋ~ @@w hN 02 HNef *2?@E% 8: .2 /*L-:' 1 e' 1 Ne' /u-u- .'w . w pD 24 4  3w`w L f 1 %  2P h24 4 w w D 4-&4-!4 4   &e & 1%4    wme   s lt  &wSwmown/lw e& 7 Z7RgwFB8I I7ILw  BuNeff R5%=@@ww  fff ~0ewwyw  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5b   6v&   6@CwwЋ P ы A@PЋ ww  N 4ww w>wfw Net@f b2e  w6w.w  t'U7f'U7\'Z'RAe vB>7 @  6%0 55 a  a!PE -%' w$ h4 `e vWt vw@ `e @  h4%e U? `e 7v'U?j a7\ TV?NJU ew dD*E wZw FD5 3 5N h2!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%޷mއ%w w7*'$!     D 7:& A*& BF7! W-X=7w 8uDAB %u f& & e w5 5  W- W00~u5  .luHBw* J@B |_7@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& 9 z   5 , @ :% & f E 9  (˥-%0     ,:% &  9 8 5E& z   5 , @ :% & f E 9  ww D:5UE5Hw _|:5uNfe & 4% _|:bNe & *2  uN h2)U5| m- 5 & 4%St% t 02 U   & 4% S U _:9 @_>9w zDE%%"5   & 4% U w. w D55@ :  2 3 3 4 4 4 4 4 ww $5+ " &5e-ve %x & T    < wVw B z5f < 7 f < 7rw@ m7%xe w      < e-ww D 5 e %xwh  5 e-Nw T: l/dev//dev/console5MS7) gettyAmnesiac-+%s: %mdefaultdefaultlogin-p        # & ) ,/258;>ADGJMPSVY\_behknqtwz}nxclimlmlogin: erkletpcttevlo/bin/loginhnheinquxnxfbksudsrpflwelnisosspndcdtdfdbdtof0f1f2pfhtnlepopapeccocbckceperwxcigpshcubabdxHN~T   0S 0d@@@ d2Kn,X  `  % K& TERM=+08=EJRW_dlr{B110std.110B134std.134B150std.150B300std.300B600std.600B1200std.1200B2400std.2400B4800std.4800B9600std.9600B19200std.19200default1200-baud300-baud1200-baud2400-baud4800-baud9600-baud@(#)gettytab.c 5.1 (Berkeley) 4/29/85*&/etc/gettytabGettytab entry too long Bad gettytab entry Getty: infinite tc= loop Gettytab entry too long E^^\\::n r t bf  SunMonTuesWedThursFriSatJanFebMarAprMayJuneJulyAugSeptOctNovDecampmpm%d:%02d%s on %s, %d %s %dlongjmp botch longjmp botch /usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecbfmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %dR Z d ~  . @ L b n z  ! 0 H U k z  4 E d & = \ l /Pr&:Pr(=RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator '((8(V((()")P)z)))SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y,h  !% )TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/dev/ ((((( AAAAAABBBBBB ((J6d06o<6x6f7e5g6c6s 6l 6LR6uV6D46O@6Xh6U'0&#l U)+U)+0(# Device Configuration Table #Name Unit# Addr Vector Br Handler(s) # Comments # dr ? 172410 124 5 drintr # dr11-w (b-bus emulator) # dr ? 172430 130 5 drintr # dr11-w (gc-bus emulator) # dr ? 172450 134 5 drintr # dr11-w (em-2 interface) # du ? 160020 310 5 dhurint dhuxint # dhu11 terminal mux # dhv ? 160020 310 5 dhvrint dhvxint # dhv terminal mux # dm ? 170500 310 4 dmintr # dm11 dh modem control # dh ? 160020 320 5 dhrint dhxint # dh11 terminal mux # dz ? 160100 310 5 dzrint dzdma # dz11 terminal mux hk ? 177440 210 5 hkintr # rk611/711 rk06/07 # hp ? 176700 254 5 hpintr # rjp04/06, rwp04/06 ht ? 172440 224 5 htintr # tu 16 massbus tape # vp ? 177500 174 4 vpintr # Versatec; should be before lp # lp ? 177514 200 4 lpintr # lp-11 line printer ra ? 172150 154 5 raintr # uda50, rqdx1/2/3 # rk ? 177400 220 5 rkintr # rk05 rl ? 174400 160 5 rlintr # rl-01/02 # rm ? 176700 254 5 rmintr # rjm02/rwm03, rm02/03/05 # br ? 176710 254 5 brintr # Eaton br1537/br1711 # rx ? 177170 264 5 rxintr # rx01/02 # si ? 176700 170 5 siintr # si9500 tm ? 172520 224 5 tmintr # tm11 driver tms ? 174500 260 5 tmsintr # tmscp driver ts ? 172520 224 5 tsintr # ts11 driver xp ? 176700 254 5 xpintr # xp driver # If you have DL11s, you must give each line an explicit unit number instead # of using a '?' as above. If you use a '?', autoconfig(8) will start # assigning unit numbers starting at 0 which will effectively move your # console to that first line. Start your unit numbers with '1'. # # cn 1 176500 300 5 cnrint cnxint # kl/dl-11 (on mvx11-aa) # The following entries are provided for information only, actual # configuration is done elsewhere. # acc ? 167600 5 accin accout # lhdh driver # de ? 120 5 deintr # deuna # qe ? 174440 400 5 qeintr # deqna ethernet # il ? 163000 340 5 ilrint ilcint # interlan ethernet # kw ? 172540 100 6 hardclock # kw11-p clock # sr ? 500 5 srirint srixint # sri dr11-c arpanet imp # vv ? 161000 350 5 vvrint vvxint # pronet 0)%lV! $$0(0*&le!//̚0(0+'lb!//̚0(0,(le!//̚0'0-)ld!//̚0'0.*le!//̚0'0/+lf!//̚0'00,le!//̚0'01-lf!//̚0'02.l!0:0:0&03/l^a//̚0&040lꌴ  R0R00   e7cce7,  /   7%  w @%% N l% %@ % 5@ l%  8%  %    @ @55Ne t& e  @ `t& e  @  8  & %w Db !e w  w w D      + - ̥9 Wp @@`e̥0  w: w " D Lԋw w  De LN 4ee   4e Be v Nfe f%ww -@ wzNT %T w N BuNefef %=@@w" Jҋ~ @@owhyw`w D5"E@e44fef % U4 4  fef %5 wt wЋ w FD:5UE5Hw* _j5uNfe & % _jbNe & Z  uN )U5| m- 5 & %St%  f U   & % S U _( @_,w DE%%"5   & % U wv w ^D55@   H 3 4 4 4 4 4 ww~w  &$5+  &5e-e % &      ww  5f  7 f  7wX@ mp7nd% e w  N @     e-$ww D 5 e % w  5 e-w  `ww  N ww rDCDpC   wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w   U7 U7  Ae vB7   % 55 a  a!PE -^%  w$  `e vWt vw,@ `e @  %e U? `e 7 U? a7 ?U ew dDE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7~*'$!     v 7l& A\& BF7!>W-H7*w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_T @  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w@(#)slattach.c 4.1 (Berkeley) 2/17/86$Header: slattach.c,v 1.1 84/10/04 12:57:12 rick Exp $2Kn090lꐺ  R0R00,X  `  % Kusage: %s ttyname [baudrate] unknown speed %s/dev//dev/%sioctl(TIOCSETP)ioctl(TIOCSETD): Unknown error: %d2DVfr"3G[z(B`@^0Ic$7DXl(BUnRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorh df or x0 f> e0 g c s@ l@ L u Dj Ov X U0=1l}0e0e00>2l 0 R0R00 *\ e7cce7ֻ / @  7%  "w & He% @ȥfew   7 " "  " `  7 PS "  " i " "  "   "   " " @  2 %     H "w$w $H "  5 fe  @e E5JP E f  r b \!w$DE%@NWpR NWp N@*V "T * p e Ne  @ f % f %pw # Wpq-R  % N " w# Wp@V T f& e7 ̶7 ʶ` &e b &e YH  ee@ 5uN 5@&ef N%f  f  @@m ff e ew 7  >    v AP@ EBt@0ef& "ew f"DCF $# &ee r%e 3e E3w("w "X@e,P~ +fe f Ae,P~w!@a+Ne d W-   D-Ne   "5f f fe fe $# W-  f f fe e     f %w X% l t 0 % 7 ( % " O j > ` \!,> "   N%    7D%O "Ne b} "µfe N dft e& %ww L |#@e5u Nef  Ne eu-w5 `%DDmAE@  5m  w NDe E4zm@ W p e7 >7 <4e& %$n7mw ww Xp e w7ܱw&~  7pwnww x -6-17 7  > e7 |  " t  " wHe  20 7m$w  &e w  G raWpq-R  Wpq-R  ww hN dN wdw PD %k  ز "7Ʋ%l   "7  w ~ w }- ww  Doe~%I   " ww @p- w w N   f f wtw `DN de   wDw 0w<w (DC+ 5  a  r5 w: w U5ff %̥a &  e 3     U̥r 33w >D  5 & & e5u A@w5 5 5@ 5`u`u w DC AupB5 S  "̥ ;  & ӄ  %;  7  & %bb& ӄ  % ₎& %`@ @m A &@w  w DE5_"% _ _ 5`uu '& & e5u%%w` @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & e5u %%    N%%%_ 5 5 5 E4N ff & e W _ %_z %_z _ w DC AupB 4  & %b N5% 傎& %`@ @m A &@wV  w 8fef &%5 w$  ы ~ w D Lԋww N  ww D el&&&&WpeJf Wpe4f ve0C2l 0 R0R00wvw b5 5  AaAE f&A@vUU5u %w.w D w̥/ 55 &f z e %Nfe  fe  fe  ԥ.̋De & x &  %fe0 % \! %,@e05e wڪNe$ w̪Ne( w%r_V _V% _V%2_VWpfWpemze, _V@e\5 N f&t e -6 @ E3 - *teX5.N f&@.e@.A Ep@.A Ep - sõ -3 󭚩_V - t-~^_V -n77teX5  e7 -4 _Z@e7pw Z Nefe ~wJ7 AWp@7$ 7  f    77 w 7 7 7 7   77ww : ̋  @  @  2  ww   @55  w-w-  t \ -  t5, 5,  -ȧ ueX&&fe Xe3 epne3ww & f eww  Q@f& N e5uQ@f& T e5uumumu _ReeQu  %QQ eu % ff et ff e5u< ff pet< ff eL A@e@ f& `et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWperu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw!wbtw\w @ !,&    w 1& r%7_˕,Nf  w tD  !     +  w@e% - r<N r<&@& ve ~ ~w Nef  w w D 5  =& % `5ȥ=  = @wX e  w 8 Nef f@w, w   f f@w w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef ,5@ 'Ne  %ʕ/  f % %ء%ȡ w4 Nef ҕaʋʥzʕaw BuNefef &%=@@w Ћ Ћ  Jҋ~ @@&w W f r @  W f r@  @ w w D85U5_5P_ $ m@e4 ,5Ne & n#  uN #4USt%5 5 5& & % 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff %ށ̥a &  e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5b   6v&   6@Cw8w27D Ћ P ы A@PЋ w FD:5UE5Hw* _~ 5uNfe & %% _~ bNe & n#  uN #)U5| m- 5 & %%St%  z# U   & %% S U _< @_@w DE%%"5   & %% U wv w ^D55@   \! 3 $ 4 4 4 4 4 ww~w  Ң$5+ x &5e-Ze % &     " ww  5f " 7F f " 7wX@ m7%e w       " e-Сww D 5 e %w  5 e-~w  t"ww  N %ww rDCDpC # $# wZw FN $wJ ~5 & E        ~5>wlYwfw Net@f #e  w6w.w  BU7x@U7nBl@dAe vBP7 R  H%B 55 a  a!PE - %@ w$ % `e vWt vw؟@ `e @  %%e U? `e 7@U?| a7n fh?`\U ew dD<E wZw FD5 $ 5N #!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%߷m߇%w w7*'$!     b 7X& AH& BF7!*W-\*7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_h(@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w/dev/rmt8/tmp/rstXXXXXX wdumpdir: %s - cannot create directory temporary %s: cannot open tape Tape is not a dump tape Dump date: %sDumped from: %sTape is not volume 1 of the dump r/Can't find directory header! /PANIC - can't find directory %u .../%5u %s%-.14s Missing address (header) block Mount volume %d Cannot open tape! Not a dump tape.Try again Wrong tape. Try again error reading directory corrupted directory: bad reclen %d /Convert old direct format to new Was converting old direct format, not now Checksum error %o SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMTGKSW_c,gkhosw{ TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d. ((((( AAAAAABBBBBB (LL'dz'o'xD(fR(eD'g(c*(sT'lT'L'u'D~'O'X'U0M3lj  0000O4lUW  000RP^\G*xNingres390'JINGRES Owner/usr/ingringres390'JINGRES Owner/usr/ingres/bin/cshingres390'JINGRES Owner/usr/ingres/bin/csh0ingresingres390'JINGRES Owner/usr/ingres/bin/csh0ingressms1320 Steveingres390'JINGRES Owner/usr/ingres/bin/csh0ingresingres390'JINGRES Owner/usr/ingres/bin/csh0ingringres390'JINGRES Owner/usr/ingres/bin/csh0ingresuucp242BUNIX-to-UNIX Copy/usr/spool/uucppublic/usr/lib/uucp/uucico1Bnobody195Nobody/nonexistent/bin/sh1nobody195Nobody/nonexistent/bin/sh0nobodybin138Binaries Commands and Source//bin/csh1operator87System &/usr/guest/operator/bin/csh1operator87System &/usr/guest/operator/bin/csh0operatordaemon41The devil himself//bin/sh0daemonroot5The Man//bin/csh0root_[Jingres390'JINGRES Owner/usr/ingres/bin/csh1'sms1320 Steven M. Schultz/user/sms1/bin/csh1 sms1320 Steven M. Schultz/user/sms1/bin/csh0sms1uucp242BUNIX-to-UNIX Copy/usr/spool/uucppublic/usr/lib/uucp/uucico0uucpbin138Binaries Commands and Source//bin/csh0bindaemon41The devil himself//bin/sh1root5The Man//bin/csh10R5l 2p r t v x R0R0顚0 & l e7cce7x  / p  7%  rw E c9 m9 p' r7 s*   r  <7 $eCӥ- P  7       x7       r    r  x     b  ( X rww rD _vCe & ( 5 & ( & (  & ( ` 5 z: @: @   5 H <55&@pVp@ @A1`@ fe % w|w h > 0   5     e@ J f e 55 C !5m4&554wF&&4&&@ nee@  Z 5w&f5&v\ *ewpw \|$     <   &4&~ e  %a 65        ww N wN  t  N    4N&  44    0 w DN   N tw*  w C t@`ˋa  Ef& e@ww DCˋ!w w DC t4s4s & t  6 wfw ND fe h 5_  rNe t 7   r p 777X7J e  7~  rfd  V \ w  w jD x*  7dwR7P@ E< 7 4 - \(  T   #- te! , v% Ԑw   ww  5 w$5  D @ 5R v% N : N  jwDD N  @e!نԐB-fef F%5 @a % D-Ć\ w f` mV:-Hj v% c ̥t]cYefe  Ce˥:  % }Nefe h %Ce ˥: A@`5% v%@` &  wnww ^˥#%  ̋ ̋˥|˥:ˋ w˥:˥| ˋˋ˥: Dw `D̥: ̥̋: wPw < ʋRʋAA@ ʥ@wʥ#  ʥ0 CpDe` w l ̋T̋AA@ ̥̋:̥@ ww $ ̋T̋AA@ ̥@ w`̥= N& w 6DC=%::\  xEB @   0teP  Dww D      + - ̥9 Wp @@`e̥0  wRw : fef 0%5 w& w %Vww t7WpwAwpAmu% Nf @m^5uBmFB-"C-Dm05TD-um@5@- wb ӁNf mu-Bm B-т̒C-Lw  @@5@~ Z vwpnAmDu-d6B N@:5 , N C! 5ԒS DCUC-f m5D-/+D-!Cm@5&@5%3-f 5u0B55RN5R DD-N& &m-N& -_ wZw FD*\5% %-%+ 5 55 55  B5eA5  %.55  B5eA5   %E%e$%+%-  Wp B`e   @`5 @ 5AupAm%0W5l 2p r t v x R0R0顚055 @5A5u555555  55555AupN& e5 55w 6 m 7$"w T D LԋwL w 8 De LN 4ee F  4e Be v Nfe %w w -2@ w N %w Nef  wz w f D 5  =& ^% `5ȥ=  = @w e  w BuNefef 0%=@@w Ћ Ћ  Jҋ~ @@W f r @  W f r@  @ yw &  4  b '     ` TW ~  s`K6!  w D85U5_5P_  m@e4 ,5Ne &   uN P4USt% 5 65 65& & F% 45@e-4  % U5EU  wv E w T D L +   r= wB w6 5 a U5ff @%ށ̥a &  Le 3     U̥r 33w lD5"E@e44fef 0% 6U4 4  fef 0%5 w    6@Cw8w27H Ћ P ы A@PЋ w FD:5UE5Hw* _5uNfe & v% _bNe &   uN P)U5| m- 5 & v%St%   U   & v% S U _ @_w DE%%"5   & v% U wv w ^D55@ 6   3  4 4 4 4 4 ww~w  $ 5+ | &5e-^e %r & ~     ww  5f  7@ f  7wX@ m7  %r e w        e-ww D  5 e %r w  5 e-xw  ww  N |ww rDCDpC P  wZw FN wJ ~5 & E        ~5>wlYwfw Net@f Je  w6w.w  U7rU7hf^Ae vBJ7 L  B%< 55 a  a!PE -% w$ P `e vWt vw@ `e @  P%e U? `e 7U?v a7h `b?ZVU ew dD6E wZw FD5  5N P!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E% m%w w7*'$!      7& At& BF7!VW-%7B& & e Ӌ z ~ &7 & e ӕ-ӕ0B~ӕ.  ӕ0~ B~z ~ &7 & Le ӕ-0 ӕ. B~ӕet ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B V_ @  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w&w Nefef 5& $$e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& n$eww  fff 5& n$eww  5 %O N  = 555Ne5& %e5455'0Ne5 B& %e57 Be0" 5%455 5 B5@B e a=%7w %45 B5Ne& %e55e0%47`Jʕ0%ʕ1  %˕0 ʥ9 6@~ @(#) Copyright (c) 1983 Regents of the University of California. All rights reserved. @(#)pac.c 5.2 (Berkeley) 10/30/85= G@usage: pac [-Pprinter] [-pprice] [-s] [-c] [-r] [-m] [user ...] PRINTERlppac: unknown printer %s rr t .0123456789 Login pages/feet runs price %-24s %7.2f %4d $%6.2f %-24s %7.2f %4d $%6.2f totalw%7.2f %s %d wpac: can't open printer description file afaccounting not enabled for printer %s pcpac_sum@(#)printcap.c 5.1 (Berkeley) 6/6/85 /etc/printcaprTermcap entry too long /etc/printcapTermcap entry too long Bad termcap entry Infinite tc= loop Termcap entry too long E^^\\::n r t bf : Unknown error: %d .:L^p|#BQ`x (Gdu&Vm+G_ 4 G V j  6 X m RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB 44( d o x f eg c slL0 u4 D O XF U=(\0a6l j l n 000/unixZ$`#g#console43altty ttyp0 ttyp1 ttyp2 ttyp3 ttyp4 ttyp5 ttyp6 ttyp7 ttyp8 ttyp9 ttypa ttypb ttyS3ttyS4ttyS5ttyS6ttyS7ttypc ttypd ttype ttypf ttyS1ttyS2ingreslockttyS0ttyl1ndvecvavd lastivB_ovnobumpdicodefinitfla~szicodeboothowbootdevbootcsrfppubmapcputypekdj11sep_idka6ofaultbdevswnblkdev`cdevswbnchrdev6rootdevvswapdevxpipedevzdumpdev|dumplo~dumpardbootcnaddrBnkl11Ddhv_speFndhvVsysentnsysent< dk_ndri> ub_map inodeop partab tthiwat ttlowat ttydefa$ linesw nldisp cfree dirchkmaxslpcexpsocketoFopsmastertacctsusacctreschk reglocnpty pipeopsnetoffcmaskconf_in~_iosizewaittim_dlabelDmatrixXtmscper|tmscp_c~LocktabnLocksetpversionhztznprocntextninodenfilencallounbufnclistclstdesucb_clicoremap swapmapkdsa6&cnt(knetisrDrunrunFnoprocHseg5JnextinoNxitimesPxitdescRinodeTinodeNIRrootdirRpidhashRprocNPRSfreeproSzombproSallprocSqs Scfreeli"Scfreeco$Scons&Spt_ttySdhv_ttyVmpid*Yrunin,Yrunout.Ycurpri0Ymaxmem2Ynswap4Yupdlock6Yrablock8Yclstadd @E%? ff r%%   H ff % @E% ff #ew >@4 t @0- t-%w  w @ H@f& @%& H%@E@&@E& @E& AE vf AE? vf% He @E _J x0Ne d H @ H@& >@ &@& .@ &@& @ &t He@f& i%f&@f& i%f& ?e @f& i%f&@f& ji%f& ?e @&$f& Di%f&@" f& *i%f& Z?e @.,f& i%f&@*(f& h%f& ?e  @B@f& h%f&@><f& h%f&< >e   7@5 5ff L>%m_5 - ?%  ߂& v w(w  @@0 @0 0 @@0 @@V T@0 X0 Z@C&fe$ e @0 L0 N@00 Br:28Br624 BrB2@Br>2<@0 \5 @t@m0^@t@m0 %@0 0 @0 0 @0 0 ww ~%*# 6 @ @   6@H,}- 6@0 =(}-}@0 @p- Ap@8  @x@Ap@   @    ` Q 5@0 =N l@ w}w }D  @ 4@0 = |= @0tw}w }^w}w }2 T4 >%7 73 -  x H Q &5 L NeZt X4-TX 4-VZ 4 X4 Z e\%V7 P n ew %*%Q%%%QQ `De Q :e  w|w p|5 5 ~fe f ,l 5_@N( ΀%N Q% J_@Lfe L Uf PH%%_(_(Xfe L/Neaf PH%%Yy_(Nn7 _(Ne TG7_(dfe L/Nemf PH%%Yy_(Nn7 _(Ne TG7_(pfe L&Nezf PH%%_ Ne z  (7_(Ne h_&}fe L fe L%Nef PH%%_ fe L77_(Ne ^Ofe g% Nef PH%%_ wm2_(0j7lc      S0]~S0]~0fe L ( ΀ _ fe LNef PH%%_ @7_(fe Lfe L fe L_5 tfe Lt fe Ltfe Lt H 0Nef PH%%_ Nefe  Ne Q%_(5 AWp8@! 5 u _( -  5{ H5fe  5_ (5_  @@t j x>@@p~Z Xe~@U@eAeP~@N v-Nz %_(@E@&@& 5 &@ f& >5%&2 HeQ@@$ H /@e&B~ 4eL Q% D(@e&B~ 4ep#Ne Q% Ne H N A5% %NeIf PH%%_ N( ΀%N Q% J#~ ,l 5;Nev%f PH%%5v@5v5v7v5v&) =e T( ΀ | Q N rwuw u  & fefefe he  Q =w ^ 7%@N #%> %. %| %l  X  Qewtw tN ou5 W (@pp@%fe@& %@=wtN n5 w ^tDe 5 @E%>_R̕?4 r4 r  4e5_@   q Wp8@! f&@@ HA1  HA1P  l[%f&@  N[%f&@ 0[%f&@VT [%f&@@ p@ p@ p@@ p NE HA1"3zE & Z%f&@$&3zE & tZ%f&@(*3zE & PZ%f&@,.@*2(0., "Z%f&@4620 Z%f&@8:\ HA1<5 @t`0^zE & Y%f&@t@m@B@t`0zE & Y%f&@t@m`b %e %8t f& feAWp8f VQe @f& .% Q%?4e5 _,tf& feAWp8f VQe @f& &% Q%wpw zp   7 &7&fe0 Rge d 9fe0 4 )Ne0 z@E2 f& %&0&A@ae0& RgeNe0 QNe0 >F rT rWtw.qD> 8 rWtqDf"e rWtqDf e rWtqDfe rWtqDf rWtqDfTfe0 Rge, & Z $eNe0 zfe0< N%  Q twnw n%   H  U Q%wnw n   H  Q%  Uwlnw XnN Q% N H  Jw6nw "n@f& V%5uvEf& 5A55@55P5@f& U%5uvEf& 5A55@555wmw lmN H5&@@  H&& 5H5@@  H&& &55@ H&& 5H5N H&& &55wlw l545B 5Aff J%5P5B 2@f& `T%Br @:55B 5Aff .J%5P5B 2@@ A f& S%Br @@ A f& S%Br2wkw k5,5 &}5f& V5H5@ fN H=@255 &}5f& V5H5@ f@@  H=@@  HA1wjw j @ee~@ f& R%Br @ 075P 5A@vf& vR%Br2w~jw jj @e5 rw@E@E&@E&& N|\Wpe`$f Rge FWpe`$@wjw i % AAE@PU=@ ݿp@AAEp@@@ @z @e PPPP@eAe4PPPP@e Ae<PPPP fe e Nefe(  @eDAe(PPPP@5`_#fe& 0fA  AAWp8f VQe @ f& % Q%_#% H ffe %@ep @5NNLvEf@N0 L@ L N5 %*#z _# -@ L( N% f& Z% Q% @ f& .% H @ L  N v-@@ P ,R@eRp P&&f e  LB 4. AAEBE% BE AAAAE AAE%  %2AAEBE% BE AAAAEAAE%  t&@V0 T@0@E @E f 4. wfw f @E5$ !@p,N f  55,  Q we%*#N @eAP~@p @@0 L0 NN v- 7 (5 @eAP~@p @@0 L0 NN v- B@UNz @%p %% @f& :%f<  Qe%_&$ ^_&$@E% @E%@ f& %@E&W  Qe AWpBE`A@  x@5@@E ݹ@ @UNNfff &e_&$@5_&$%*#_&$z _$$@5@@E; -@ Nfff &e@Ef 4. N _&$w b4@B 2,(4 2,*62,,82,.: 5@B 2,D2,F2,H 2,J  D F 5@ ep @  AE?p@ AAEp@ AAEp@ AAp@B r"2 @ B r&2$@ B r*2(@ e,AePPPP@ e4Ae(PPPPNf e<  @ Ef 4.  @     @  "  @ ep %b_x*r H_x*Ne 5Ne 5Ne( 5N e< 555uu555uuA5  vf& >%&@7L&55@  %  B  vf& >>%&@&555@ ep W75575@ 0 P0 R5&5&f he 1@ NLf&@ 0&0&0&5&5&  @f& %&  e0N |*wh_w T_  bX 4. -N_$- @_$-@E7@E 7@77 e dA15& e Ne$ dA15& e  Ae<PPPP% H@070w:@ f& %@0&  Qe r_$-7n&@ f& %&@0& *e_$-7 7 @0& e `r7(&7B&@0&E&@ f& v%&G fe( ;e Ne( Q!@0&E&@ f& $%&t ne v- :%b5 H0 -7f&7&@0&E&@ f& %& fe( B:e Ne( Q w\w \77 77 777 7  w77~w|7 ~7 |wn\w Z\D% & & % H C4 ta0^ %4 \4 P4 R t:4844t6 tB4@4<t> tJ4H4DtF& 4. d  4. w[w [D %   %   @%@4-z          %          t5 4 Tt V)A 4 T t VtV T 7u5% N&V&T HewxZw dZD%\ \ta0VWta1^ta0Wta1~54^545 ^ %tapta0^A^WtAa1ta0A^Wt ^Aa1x -\ ^\ MFt@a0xWtAa1x8t@a0x5pt@a0xWtAa1xt@a5p0xt@a05pt@a0WtAa1t@a5p0 B-^ @^ 5x4545p@5` C-^t@a055h@5hC5hC5h5puhu`5p5`@5` %5p4%4&4&4& ewdXw PX5 l5 n2%@l1@EN (9 AlWpAaqtNe$ dA1AlWpAa1v@U lu %NlT H l6 ' f& z%w  Q%  f& N% H % H7 h_$95 r_3@r 5psArWpAaAtCppCat"ArWpAaAtCppCatMArWpAaqvCppCasv=ArWpAautArWpAaqvudArWpAaCppCattApWpAaqvCrpCasvApWpAaqtApWpAaudqv pu-lp r@l @-r_2%tNl H %ll%PNl H 5 nr ru-lr&ArWpAaAbCrpCat n%n%Nr H url%Nl" H 5 rc@r 5pWArWpAaAtCppCat&ArWpAaAtCppCat1ArWpAaAtqCppCatsArWpAautArWpAaCppCattApWpAaqt pu-lp r@l @-r%l_>75\75D5 :%NlE H 5 r_75T@5LArWpAaAtU5 p-ApWpAaAtqCrpCatsud@5d5TuduL5T5L@@5L pu-lpArWpAauTqv  vf& 1%&@755bWp8q,!Ne i f "e ^Ne z  (Wp81 u Q  JNeWp8f h Wp8e @AeP~Wp85,!(Nei f "e  Q  JWp8e !@AeP~Nei f "e  Q  J2Wp8e!@AeP~5 AWp8@p83, 3,!!_; - _;  T^%AWp81  Q  JfeAWp8f hQe  Q AWp8f ]%  Q  JAWp8 AWp8q AWp8e fAWp8f NG%  Q  JfeAWp8f hQe  Q AWp85,!fe AWp8f hQe 6 Q -X_L=LwKw J\wJw J $v r55 fe e 5 u5 uw@5 55 u7( 5%# 57 u uw B5&5& de fe nQ  Q  7l7 7 wI7\7t57p5_>57. N7 H2 >/ 8+7775Bu5@557u B77 7 7uwWD7_>w 0I p_Aew 7|D77p7~7h7vwxWE7h7\7` 5    4 . 727r & "@ef& B@e5u7 uwH7  %Nefe A Q %7&7&ff ^ew2Hw H '%  d  '% h%& 2F wGw^G  @ w( w8Gw Gw- @m7ȥ- > -ͷ 7%:f g (l d ^ (f C ( C ( HC ( HC ?w G ̥:7 *+ w- (f C ( @m73̷  9 E5 @@l w ?w PFDC E5<E@e33. @;E  5 , @;% & fE 5  U3 3  wEw E D f Le  f L N& L  6wfej g  NAej@f N%N ҄ T & fh 0j%%%wd5w P5D ww 57%<X& f%5̼,  T^%7%  ց 77%'t ]%%h&T U%%D ҄:w|4w h4& ҄7wb4w N4D 7 wH4bw3w .4N Y Uw,4w 4D el&&&&Wpef Wpeft& Rge&w3w 35 5  AaAE f&A@vUU5u %w3w ~3D wt3̥/ 55 z&f + e %Nfe h fe 4 fe 4 ԥ.̋De & ] & ց %fe0 ܁% ҄ %,@e05e VwNe$ VwNe( Vw%r_hV _hV% _hV%2_hVWpfWpeme, _hV@e\5 N Vf&t>&@&e -D @ E3, -( *tex-5.N Vf&@.e@.A Ep@.A Ep - s- -3- ,_hV - t-~-_hV -|-7v7ptex-5  e-7L -B _lV@e-7,w 0 Nefe ew07 AWp@72 ,7 . f f - h -7θ7ȸ w X07 7 7 7 - h -77w:0w &0H f̋  RV  RV  2  w/w /  @55 ( w-&w-  t |- -  t5,>& 5,@& - ,uex-&&fe Xe3 e-p<e-3w./w /& f ejw/w . -Q@f& H&e5uQ@f& v&e5uumumu _d[eeQu  %QQ eu % ff %et ff %e5u< ff j%et< ff %eL A@e@ f& %et e  =  r  rd > r 8 8 rd ( Ap 5 8u 4  Ap f&A@ 5u r  r   Ap @mAm@ 5u e4 tWpe@u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttwZ,!w+\w+w :,De LN z4eeT ^  z4e Be v Nfe Tj%w+w +-^@ w+N. Rg%.ew+aw*w v+w@7% ?@w^+N f ^w 8+DC_d̥%_c 5 r y _c 9% 5afe & %5@e5 5N d _d 5N d _d w*Q ^_df ^_dx ^_d  "d% _d0 "d% _d0 r  r f "d% _d0 "d% _d  "d% _d  r  r f "d% _L__d0 "d% _L__d d _L__d ^_L__d0 "d% _L__d ^_L__d d _L__d0e r& "d% _L__d0e  @ r& "d% _L__d0 "d% _d_L_ ^_d_L_ _L_ d _d_L_ _^ _^ _c _L_% _L_b_0_fe & %5@e5_<_ _c _R_ __ _c _v_ _` _c _` _(` _c0 el rdf "d% _d_L_ _` _c0 "d% _d_L_ _` _^ _c d _d_L_ __ _` h_a __ _d_ Y% _`_` _a G0 "d% H_L_ _` __ - ^2_L_ ! 0 el "d% _L_ _b` _a _`. * _L_? ʷ ʄ ̋_^ _N_w %8.A r e0@ A r 5   %.. @  L %..  dw\%w H%D wL% ?w %u@t58.5:.@ 5.Nefef i% (3A@u5Btr:.28.@ Aup. fef i% u-u-u-@wz$w f$ fe e@wX$ @pHA@tw#w $ f!,& g   w$ 1&. f%75˕,.Nf f w #D  !     +  w#e% - r<N r<&@&_. Rge. ~ ~w # Nef f w#w "D 5  =T& g% `5ȥ= . = @w"e  w ~" BuNefef %=@@wR"Ћ Ћ  Jҋ~ @@  E6P6 EPw !%Nf f fff *ie _&iֺg %]@ D  %0  Q% 80 -lf h % xc  = ?   @ ǃw w& w D% 5     |@wr 4- Swmnilw e& 7 F7>gw2TBJ$I I7<Iw  BuNeff %=@@ww  fff Njewwyw&  4  b '     ` TW ~  s`K6!  w D85U5_l5P_l  m@e4 ,5Ne &   uN (4USt%5 5( 5& & ܁% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff ց%ށ̥a &  $e 3     U̥r 33w   uff e55 D6/fe& %e60  600/& %e2/& %e^0v@A@ 7r`5%  ^0D& %m6m2  ,/ww D@et5r%=r D  q 7|; 8 0  w|e =r r̋=rNet L Net Le  @et5Net z5&f 4% tԭ s7 ̭ Zw DC . 6 q 7%. 8 N 2!f %    촀wpu5&f % ̴, s7 $ w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @ W-@D Ae Bḁ.@e@- @D@pHe _ő@pHeA Be vC ̂ xuuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ ( 6 w5 4@E%@EU5N&e h &e 4 Nf&e ց%4 IN&e h &e 4 Nf&e ց%  (Ne&  ff eee@ 4t@t"4 4t ҄ l_qw N ҄@ ҄N lww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  y ve@ 4tw"w D55ff %f&& "eff&e e &e ^| 55 w@w<r0w5 5 w D5#®5ff T %f&& eff&e *ew6&e B~'44  && ef&& $e&e & N%%U w D5_vo5ff %f&& eff&e Ze L&e B~8f f ff&e V e 744  && ef&& $e&e & N%%UUw @@m e%fe  &e ^| 55 3ff `%f&e@ &50c &e ^| 55 3( ΀ U44  && ef&& $e&e & N%%&_vfffffe e _v&e % _Fv_ve_Fv  mm@ e@ f& ef&& $efe& N%%_v {_@uw @0 0 @0 N w77v0ww D85_yNe& q fe Ve4-4-/44  &&  ef&& $e&e & ܁%%&e &e ^| 55 ewwz0w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  y ve@ 4t4-4-/44  && ef&& $e&e & ܁%%&e ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& $e&e$& ܁%%&e$ `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& $e&e$& ܁%%&e$ `Btp$t t"  ff Nef&& $e&e$& N%%Uw w r D5#5 5 ww~0wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& % w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm % a@ `` e w D a@@m e  w e  aAm HN@`@m &f %  aN f`f %  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef % U4 4  fef %5 w    6v&  @ppC`p   6@Cwzwtw D  & & $e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _5uNfe & N% _bNe &   uN ()U5| m- 5 & N%St%  U   & N% S U _ @_w DE%%"5   & N% U wv w ^D55@   ҄ 3 l 4 4 4 4 4 ww~w  $5+ 0 &5e-e % & h    ^ ww  5f ^ 7* f ^ 7|wX@ m7% e w  ު Ъ    ^ e-ww D 5 e % w|  5 e-bw r ww  N Tww rDCDpC ( wZw FN lwJ ~5 & E        ~5>wlYwfw Net@f "e  w6w.w  j0U7\0U7R0P0HAe vB47 6  ,%& 55 a  a!PE -%0 w$ ( `e vWt vw@ `e @  (%e U?~~ `e 7l0U?` a7R JL?D@U ew dD E wZw FD5 l 5N (!w5A vBB-  }ee@ !ۃ `!ւ ` `|mЖ& E%–m%w w7̙*'$!     D 7:& A*& BF7! W-^7& & "e Ӌ   &7•& \e ӕ-ӕ0B~ӕ.  ӕ0~ B~  &7j & e Pӕ-0 Dӕ.8 B~ӕe* ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & ze w5 5  W- W00~u5  .lu Bw* J@B V_Ԍ@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff e w5  @ 0   Wp `e0w  w] ww |  r7 TN s7 F7 ܖw`w L a  ,l 7 l0 Zj%5#c f  f f P ^N of&N@8 ̥ ̥ 7 V17i &  ̥̋ ̥ %|1l &   L1w`w LwƑwRw >D CKw4 ˋ 5 w DCB P  5 , :% & E& z   5 , @ :% & f E  (˥-%0     ,:% &  8 5E& z   5 , @ :% & f E  ww Nefef 5& e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @w^w Jfff 5& Бew8w $ fff 5& Бeww  5 %O N  = ~1555Ne5& Pe5155'0Ne5 B& Pe57  Be0" 5%155 5 B5@B e~1 a=%~17~1w %15 B5Ne& Pe55e0%17`Jʕ0%~1ʕ1  %~1˕0 ʥ9 6@~  n|zE[[/etc/ntp.conf/etc/ntp.drifta:c:dD:lstnany%s: tickadj not supported %s: not compiled for noswap ntpd: -%c: unknown option //dev/ttyntpd%s version $Revision: 3.4.1.9 $patchlevel %d%s version $Revision: 3.4.1.9 $ patchlevel %d ntpudpudp/ntp: service unknown, using default %dAddr %d: %s fd %d %s broadcast %s Addr %d: %s fd %d %s Highest fd in use is %d recvfrom: %mrecvfromRunt packet from %s Input Packet: [%s](%d) Leap %d, version %d, mode %d, poll %d, precision %d stratum %d (%.4s) [%s] Synch Dist is %04x.%04x Synch Dispersion is %04x.%04x Reference Timestamp is %08lx.%08lx Originate Timestamp is %08lx.%08lx Receive Timestamp is %08lx.%08lx Transmit Timestamp is %08lx.%08lx Input Timestamp is %08lx.%08lx List hosed (demobilize)Broken peer list Broken peer listlogical clock adjust timeout (%d seconds)logical clock adjust timeout (%d seconds) rProblem opening NTP initialization file %s Problem opening NTP initialization file %s%smaxpeers%dtrusting%slogclock%sdriftfile%swaytoobigsetthreshold%sanydebuglevel%dstratumObsolete command 'stratum' precision%dpeerpassiveserverpeerserverpassivecan't happen %s%s: unknown hostcan't happen Peer %s/%d af %d mode %d Duplicate peer %s in in config fileDuplicate peer %s in in config file config file: %s not recognizedunrecognized option in config file: %s init_ntp: %s: initialization error init_ntp: %s: initialization errorr%lfDrift compensation value initialized to %finit_ntp: bad drift compensation value init_ntp: bad drift compensation value sysctl() for kern.clockrate: %m sys.precision set to %d from sys clock of %d HZsendto: %s %msendto: %s %mstats: dc %f comp %f peersw %d inh %d UNSYNC off %f SYNC %s %d%12.10f %12.10f %12.10f %12.10f %12.10f %4d Error writing drift comp file: %mDEBUG LEVEL %d DEBUG LEVEL %dDEBUG LEVEL %d DEBUG LEVEL %dterminated: (sig %d)ntpd terminated (sig %d) tJ$$Source: /usr/users/louie/ntp/RCS/ntpsubs.c,v $ $Revision: 3.4.1.3 $ $Date: 89/05/18 18:33:50 $%d.%d.%d.%dF&%&n&#= p=ף= p=ף= p=ףOXc&z#= p=ףHsendto: %s %m Sent Lost reachability with %sLost reachability with %speer malloc: %mBogus peer_mode %d from %sBogus hmode %d for peer %sprocess_packet: dropped duplicate or bogus host: %s : %f : %f : %f : %f : %f : %lo refclockclock_update: synced to peer, adj clock Clock is too far off %f sec. [%s]Clock is too far off %f sec. [%s] (max %f) adjust: STEP %s st %d off %f drft %f cmpl %fClockset from %s stratum %d offset %f clock_updates: STEP ADJ adjust: SLEW %s st %d off %f drft %f cmpl %fclear: emptied filter for %s poll_update: timer %d, poll=%d clock_filter: estdelay %f, estoffset %f, estdisp %f select_clock: step1 %d candidates Lost NTP peer %sLost NTP peer %s select_clock: no candidates select_clock: step2 %d candidates select_clock: step3 %d candidates select_clock: truncated to %d peers select_clock: step4 %d candidates select_clock: step5 %d candidates peer %s => disp %f prec_th %f %d left valid peer %s => TOSS select_clock: step6 %d candidates clock: select peer %s stratum %d was %s stratum %dclock: select peer %s stratum %d was UNSYNCEDclock: select peer %s stratum %d of %d cand Checking peer %s stratum %d That one is certainly qualified %s $Source: /usr/users/louie/ntp/RCS/ntp_sock.c,v $ $Revision: 3.4.1.3 $ $Date: 89/05/18 18:28:20 $wildvs=socket(AF_INET, SOCK_DGRAM) %mget interface configuration: %mget interface flags: %mget interface addr: %mmalloc failedSIOCGIFBRDADDR failsSIOCGIFNETMASK failssocket() failed: %msetsockopt SO_REUSEADDR on fails: %mfcntl(FNDELAY) fails: %mbind() fails: %msetsockopt SO_REUSEADDR off fails: %msetsockopt(SO_BROADCAST): %m?nOnOtJ$tJ$tJ$tJ$tJ$tJ$adj_logical: %f %f Can't set time: %mCan't adjust time: %madj: %ld us %f %f : illegal option -- : option requires an argument -- /etc/servicesrr# ,/ %d.%d.%d.%dMMMrMrMrMrMrMrMrMrMrMrMrMrMrMbMbMzM/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d 0<N`r~%DSbz *Ifw (Xo-Ia"6IXl 8ZoRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator !&-7?Hab$bBb`bbbc,cZccccSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y ,#h'+/37;?CKOSW [TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/usr/bin:/bin:/usr/ucb:/usr/local:/usr/new:/etchhhhhhhhhhhhhhhhhhh q2q\qq ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 011doxfegcslLu DOXUH1V /etc/hostsr# =(\08l4C R0ҨR0Ҩ0 3 e7cce7 / *  7%  'w "+ 5 5 PX bf # :   hf #  e ߀ ef #   kf #   nf #  ;qf #3 e% tT b#  '% T b#  '@ ef %  u e  u e f "  NT b#% ' p& f #T b# N z '  & #%& #%%T b#  z ' z& #%,& #%%,T b#  z ' )5 AWpCe   , D-D-@  % f e M5 @ f % u-,  5  -  ? % H& ߸ H ($  '5 @   @   u- 'w'w 'D   A rC+WpBe 2! j%7z wx 2e e4 e -L 5 % (WpBe 2! %7 w 2e e4 e  r  X 5%5   & #%& #%%T b#  z 'w-v  & #%,& #%%,_T b#  z '_w%w %  P%@ @ & %@ _  x 0@  (@  f& %&& %@  (@ f& %&3 %@ 55555 5"%"ff (%5uff %5uN (5N (5% A @mAm@ f&ff> e ffG effJ e NN  @ !E5_ W@ ! ^fY %b@ ! ifd %m@ ! tfo %x@ ! fz %@ ! f %@ ! f % @      pD@ JHf&@ " f&@ f&@ &6@ :8f& (e@ 4@ .,f&@ *(f& e _    @m   @m  &f  e @   % % U /  L@t5E@ |  %%_ @   _ 5 - ?%  ~H& rH ($ w!w !A r  rN(  wp!w \!@@w`!w L!.f ! 5w6!N0fe 0e%_f %%%  %%%cNe J5uu5 Ne P5u fff < e ?0f ! 55D 55444  $5@-5e  %2T b# N &N &@_H CeXN 0e%  @ A@bl@ f&f < e Nffe* 0eDNe*& # 4 e   w 2DE5_ % _D _D 5`uu '& & #e5u%%w @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & #e5u %%    b %%%_ 5 %5 5 E4N ff & #e W _ %_6 %_6 _ w D J5u5mu A@ww D 5u5 A@ww De m@ e@ 5u%% du %e u 5mu A@whw TD 5u5 A@w8w $D%%055  m@ 5u%% e du %umumu 5umumu A@ww DeE08l?C R0ҨR0Ҩ0E&E&E&D 2e wZw >DC AupB 4  & "%b b 5% 傎& "%`@ @m A &@w  w Hfef ,%5 tw w %Vww t7WpwAwpAmu% Nf  @m5uBmzB-"C-Dmd5TD-umD@5@- w &ӁNf mu-Bm B-т̒C-Lw b @@5@ F  vwpAmDu-6B @n5 ` N DC! 65ԒS DCUC-f m5D-/+D-!Cm@5&@5%3-f  5u0B555R DD-N& ZmR-NN&  -6_ ww Nef< 4%ww Neff 4%ww D A555  ԋuNeffe 4%wNw :DC 5 5 _v%%_5 %*e5  AWp `eu;  0u%l5  %h%[ $; e  _Neffff e   * O  A@ EN b 5% % % %Nf  &    %_P A@ E%Nf  @wN b 5 w N%c%s%[Nf ff f& $ewV5 5 5 5 %e%f %o%xDe5 5 A @ EN b % % % %- Ԑ A @ EN b  _%+_  _%a%f %A_%F_ % A@vN b O% A@v@mAm@ vA@v5u; 0 %a%fW7 5`u`u C% S P Ԑ A @ E =; %%.%e%E- *% ' $ ! Ԑ A @ EN b %+%-%0%9 A@  5u% N   =   @e! @e! _(@t@]   xPNe A _(Ne A @H@pHw JDC = 5%c%0u5 %s    b %rP%c5 %[rP      b %%    =  D- %cwb w JD ̥^  PPP % %]%-+ P $%-̥]4  P ̠ P PP %]  ww D*\5% %-%+ 5 55 55  B5eA5 ; %.55  B5eA5 ;  %E%e$%+%-  Wp B`e;   @`5 @ 5AupAm%55 @5A5u555555  55555AupN& e5 55w6 m 7"w 4De _6 t4 t t4 4t Ne&&  % _6t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 P 55 Nefe  % & (%5u7  &&  %  fe  %ff % fe&  %wH A@E f& w  w$ w  D Lԋw w De LN $4e~e   $4e Be v Nfe \ %w w n -2@ wh N 2%w < BuNefef ,%=@@w W f r @  W f r@  @ w D% 5     |@w 4- Sw mow n0 lw e& 7 7gw yw w D85U5_!5P_!  m@e4 ,5Ne & (  uN (4USt%<58H %54T %5& & #% 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff #%ށ̥a &  #e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef ,% %U4 4  fef ,%5 w ww7  ы A@Ћ w FD:5UE5Hw* _%5uNfe & *% _%bNe & (  uN ()U5| m- 5 & *%St%H  ( U   & *% S U _P$ @_T$w DE%%"5   & *% U wv w ^D55@ %  p& 3 * 4 4 4 4 4 ww~w  $<5+ , &5e-`e %, & >    ' ww  5f ' 7 f ' 7 wX@ m7<%,e w       ' e-ww D v<5 e %,wR  5 e-8w & 'ww  N *ww rDCDpC ( 8( wZw FN *wJ ~5 & E        ~5>wlYwfw Net@f (e  w6w.w  @U72U7(&Ae vB 7   % 55 a  a!PE -% w$ * `e vWt vw@ `e @  *%jfe U?TT `e 7BU?6 a7(  "?U ew dDE wZw FD5 * 5N (!w5A vBB-  }ee@ !ۃ `!ւ ` `Rm^& E%PmJ%w w7*'$!      7& A& BF7!W-r37& & e Ӌ 48 &7P& e >ӕ-8ӕ0B~$ӕ.  ӕ0~ B~48&7 & Le ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .lu:Bw* J@B V_r.@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& ($ z   5 , @ :% & f E ($  (˥-%0     ,:% &  ($ 8 5E& z   5 , @ :% & f E ($  w&w Nefef 5& 1e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& 1eww  fff 5& 1eww  5 %O N  = 555Ne5& d3e5j55'0Ne5 B& d3e57 Be0" 5%j55 5 B5@B e a=%7Bw %j5 B5Ne& d3e55e0%j7G`Jʕ0%ʕ1  %˕0 ʥ9 6@~ @(#) Copyright (c) 1983 Regents of the University of California. All rights reserved. @(#)trpt.c 5.2 (Berkeley) 9/18/85 &/49?GMT\enw ").6;FP ATTACHDETACHBINDLISTENCONNECTACCEPTDISCONNECTSHUTDOWNRCVDSENDABORTCONTROLSENSERCVOOBSENDOOBSOCKADDRPEERADDRCONNECT2FASTTIMOSLOWTIMOPROTORCVPROTOSENDCLOSEDLISTENSYN_SENTSYN_RCVDESTABLISHEDCLOSE_WAITFIN_WAIT_1CLOSINGLAST_ACKFIN_WAIT_2TIME_WAITREXMTPERSISTKEEP2MSLinputoutputuserresponddrop_tcp_debug_tcp_debx/vmunix/dev/kmem-a-f-s-t-j-p-p: missing tcpcb address -p: too many pcb's specified %xtrpt: %s: no namelist trpt: trpt: tcp_debxtrpt: tcp_debug%s%x, %x: trpt: tcp_debxtrpt: tcp_debug%s:%s (src=%s,%d, dst=%s,%d)[%x..%x)%x@%x(win=%x)<%s%sSYN,%s%sACK,%s%sFIN,%s%sRST,%s%sPUSH,%s%sURG,>%s<%s> -> %s rcv_nxt %x rcv_wnd %x snd_una %x snd_nxt %x snd_max %x snd_wl1 %x snd_wl2 %x snd_wnd %x %s%s=%d (t_rxtshft=%d), %03d rrnlist: sym 2 big %d.%d.%d.%d  : Unknown error: %d<DNhx*6LXdv 2?Udp  / N o  ' F V m   : \ q   $ : \ n  ' RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB jj-d-o-xN.f\.eN-g(.c4.s^-l^-L-u-D-O-X-U=(\09l8 a c e R0ШR0Ш0  (( e7cce7 /  7%  w @ d w<w (D* R ?E G ߬  -?% <& ߂ F  r݀5r<EX -X ?J%  <<& 0 F w5&< w bD LԋwZw FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%<   U   & % S U _n @_rw DE%%"5   & % U wv w ^D55@    3 ( 4 4 4 4 4 ww~w  $05+ t &5e-xVe %  & V     ww  5f  7 f  7wX@ m70% e w        e-ww D 05 e % wj  5 e-Pw . ww  N ww rDCDpC  V wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  XFU7JDU7@F>D6Ae vB"7 $  % 55 a  a!PE -%D w$  `e vWt vw@ `e @  %~e U?ll `e 7ZDU?N a7@ 8:?2.U ew dDE wZw FD5 ( 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `jm4& E%&m %w w7*'$!      7& A& BF7!pW-7\kgmon hasn't been implemented under 2.11BSD.,PP0:lƤ Z1 3 5 7 9 50500# @(#)disktab 1.2 (2.11BSD) 1995/07/13 # # Disk geometry and partition layout tables. # Key: # dt controller type # ty type of disk (fixed, removeable, simulated) # d[0-4] drive-type-dependent parameters # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # sc #sectors/cylinder, nc*nt default # su #sectors/unit, sc*nc default # se sector size, 512 default (getdiskbyname always sets 512) # rm rpm, 3600 default # sf supports bad144-style bad sector forwarding # sk sector skew per track, default 0 # cs sector skew per cylinder, default 0 # hs headswitch time, default 0 # ts one-cylinder seek time, default 0 # il sector interleave (n:1), 1 default # bs boot block size, default BBSIZE (getdiskbyname returns BBSIZE) # sb superblock size, default SBSIZE (getdiskbyname returns SBSIZE) # b0 block zero dead start primary bootstrap # o[a-h] partition offsets in sectors # p[a-h] partition sizes in sectors # b[a-h] partition block sizes in bytes # f[a-h] partition fragment sizes in bytes # t[a-h] partition types (filesystem, swap, etc) # # On drives that contain bad-sector replacement areas the 'h' (and in some # cases 'c') partitions do NOT overlap the bad-sector track. # # Entries may also be used for other compatible drives # with the same geometry. # # Drives on xp # # These partition tables are a mess. Several of them overlap the bad # sector area, others do not overlap but end up with not cylinder sized # filesystems. Many of these aren't even in use any longer. A couple # did not even match the tables that were in the kernel. # # I've done my best to match these up with the old partition tables in # the 'xp' driver but a typo or arithmetic error could easily have crept in. # # RM02/03 - 'c' and 'h' partitions are whole drive except bad sector track. # rm02|RM02|rm03|RM03|DEC RM02/03:\ :ty=removable:ns#32:nt#5:nc#823:sf:\ :b0=/mdec/rm03uboot:\ :pa#9600:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#9600:ob#9600:bb#1024:fb#1024:tb=swap:\ :pc#131520:oc#0:bc#1024:fc#1024:\ :pf#121920:of#9600:bf#1024:ff#1024:tf=2.11BSD:\ :pg#112320:og#19200:bg#1024:fg#1024:tg=2.11BSD:\ :ph#131520:oh#0:bh#1024:fh#1024:th=2.11BSD # RM05: rm05|RM05|cdc9766|CDC9766|9766|DEC RM05, CDC 9766:\ :ty=removable:ns#32:nt#19:nc#823:sf:\ :b0=/mdec/rm05uboot:\ :pa#9120:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#9120:ob#9120:bb#1024:fb#1024:tb=swap:\ :pc#234080:oc#18240:bc#1024:fc#1024:tc=2.11BSD:\ :pd#247906:od#252320:bd#1024:fd#1024:td=2.11BSD:\ :pe#164160:oe#18240:be#1024:fe#1024:te=2.11BSD:\ :pf#152000:of#182400:bf#1024:ff#1024:tf=2.11BSD:\ :pg#165826:og#334400:bg#1024:fg#1024:tg=2.11BSD:\ :ph#500226:oh#0:bh#1024:fh#1024:th=2.11BSD 9775|CDC 9775:\ :ty=fixed:ns#32:nt#40:nc#842:sf:\ :pa#10240:oa#0:ba#1024:fa#1024:ty=2.11BSD:\ :pb#10240:ob#10240:bb#1024:fb#1024:tb=swap:\ :pc#510720:oc#20480:bc#1024:fc#1024:tc=2.11BSD:\ :pd#541440:od#531200:bd#1024:fd#1024:td=2.11BSD:\ :pe#363520:oe#20480:be#1024:fe#1024:te=2.11BSD:\ :pf#320000:of#384000:bf#1024:ff#1024:tf=2.11BSD:\ :pg#368640:og#704000:bg#1024:fg#1024:tg=2.11BSD:\ :ph#1072640:oh#0:bh#1024:fh#1024:th=2.11BSD # EATON BR1537 or 1711 controller. The CSR set looks like an RP03, # that's about all. # br1538d|BR1538D|EATON 1538D, 1711:\ :ty=removable:ns#32:nt#19:nc#815:so:\ :b0=/mdec/bruboot:\ :pa#18240:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#12160:ob#18240:bb#1024:fb#1024:tb=swap:\ :pc#232256:oc#30400:bc#1024:fc#1024:tc=2.11BSD:\ :pd#232256:od#262656:bd#4096:fd#1024:td=2.11BSD:\ :ph#494912:oh#0:bh#1024:fh#1024:th=2.11BSD rp04|RP04|rp05|RP05|DEC RP04/05:\ :ty=removable:ns#22:nt#19:nc#411:sf:\ :b0=/mdec/hpuboot:\ :pa#9614:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8778:ob#9614:bb#1024:fb#1024:tb=swap:\ :pc#152988:oc#18392:bc#1024:fc#1024:tc=2.11BSD:\ :pg#171650:og#0:bg#1024:fg#1024:tg=2.11BSD rp06|RP06|DEC RP06:\ :ty=removable:ns#22:nt#19:nc#815:sf:\ :b0=/mdec/hpuboot:\ :pa#9614:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8778:ob#9614:bb#1024:fb#1024:tb=swap:\ :pc#153406:oc#18392:bc#1024:fc#1024:tc=2.11BSD:\ :pd#168724:od#171798:bd#1024:fd#1024:td=2.11BSD:\ :pe#322130:oe#1830:l¤ Z1 3 5 7 9 5050092:be#1024:fe#1024:te=2.11BSD:\ :pg#171798:og#0:bg#1024:fg#1024:tg=2.11BSD:\ :ph#340522:oh#0:bh#1024:fh#1024:th=2.11BSD rp07|RP07|DEC RP07:\ :ty=fixed:ns#50:nt#32:nc#630:sf:\ :b0=/mdec/hpuboot:\ :pa#19200:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#51200:ob#19200:bb#1024:fb#1024:tb=swap:\ :pc#1006400:oc#0:bc#1024:fc#1024:\ :pd#320000:od#70400:bd#1024:fd#1024:td=2.11BSD:\ :pe#320000:oe#390400:be#1024:fe#1024:te=2.11BSD:\ :pf#296000:of#710400:bf#1024:ff#1024:tf=2.11BSD:\ :pg#936000:og#70400:bg#1024:fg#1024:tg=2.11BSD:\ :ph#1006400:oh#0:bh#1024:fh#1024:th=2.11BSD rm2x|160|fuji|fuji160|Fujitsu 160:\ :ty=fixed:ns#32:nt#10:nc#823:sf:\ :b0=/mdec/si94uboot:\ :pa#9600:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#9600:ob#9600:bb#1024:fb#1024:tb=swap:\ :pc#244160:oc#19200:bc#1024:fc#1024:tc=2.11BSD:\ :pd#164800:od#19200:bd#1024:fd#1024:td=unused:\ :pe#79360:oe#184000:be#1024:fe#1024:te=unused:\ :pf#39680:of#184000:bf#1024:ff#1024:tf=unused:\ :pg#39680:og#223680:bg#1024:fg#1024:tg=unused:\ :ph#263360:oh#0:bh#1024:fh#1024:th=unused diva|DIVA|9300|Diva Comp V, Ampex 9300 (in direct mode):\ :ty=fixed:ns#33:nt#19:nc#815:sf:\ :b0=/mdec/dvhpuboot:\ :pa#9405:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#9405:ob#9405:bb#1024:fb#1024:tb=swap:\ :pc#241395:oc#18810:bc#1024:fc#1024:tc=2.11BSD:\ :pd#250641:od#260205:bd#1024:fd#1024:td=2.11BSD:\ :pe#169290:oe#18810:be#1024:fe#1024:te=2.11BSD:\ :pf#156750:of#188100:bf#1024:ff#1024:tf=2.11BSD:\ :pg#165996:og#344850:bg#1024:fg#1024:tg=2.11BSD:\ :ph#510846:oh#0:bh#1024:fh#1024:th=2.11BSD 330|capricorn|Capricorn|Ampex Capricorn:\ :ty=fixed:ns#32:nt#16:nc#1024:sf:\ :pa#16384:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#33792:ob#16384:bb#1024:fb#1024:tb=swap:\ :pc#291840:oc#50176:bc#1024:fc#1024:tc=2.11BSD:\ :pd#16384:od#342016:bd#4096:fd#1024:td=2.11BSD:\ :pe#56320:oe#358400:be#1024:fe#1024:te=2.11BSD:\ :pf#107008:of#414720:bf#1024:ff#1024:tf=2.11BSD:\ :pg#179712:og#342016:bg#1024:fg#1024:tg=2.11BSD:\ :ph#521728:bh#1024:fh#1024:th=2.11BSD si_eagle|SI_Eagle|2351|2351A|Fujitsu Eagle 2351A (48 sectors):\ :ty=fixed:ns#48:nt#20:nc#842:rm#3961:sf:\ :b0=/mdec/si51uboot:\ :pa#11520:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#11520:ob#11520:bb#1024:fb#1024:tb=swap:\ :pc#474240:oc#23040:bc#1024:fc#1024:tc=2.11BSD:\ :pd#92160:od#497280:bd#1024:fd#1024:td=2.11BSD:\ :pe#218880:oe#589440:be#1024:fd#1024:te=2.11BSD:\ :ph#803520:oh#0:bh#1024:fh#1024:th=2.11BSD si9766|si9766|CDC 9766 on SI 9500 controller:\ :ty=removable:ns#32:nt#19:nc#823:sf:\ :b0=/mdec/si95uboot:\ :pa#9120:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#9120:ob#9120:bb#1024:fb#1024:tb=swap:\ :pc#234080:oc#18240:bc#1024:fc#1024:tc=2.11BSD:\ :pd#244866:od#252320:bd#4096:fd#1024:td=2.11BSD:\ :pe#164160:oe#18240:be#1024:fe#1024:te=2.11BSD:\ :pf#152000:of#182400:bf#1024:ff#1024:tf=2.11BSD:\ :pg#162786:og#334400:bg#1024:fg#1024:tg=2.11BSD:\ :ph#497344:oh#0:bh#1024:fh#1024:th=2.11BSD rk06|RK06|DEC RK06:\ :ty=removable:ns#22:nt#3:nc#411:sf:\ :b0=/mdec/hkuboot:\ :pa#8316:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8316:ob#8316:bb#1024:fb#1024:tb=swap:\ :pc#27126:oc#0:bc#1024:fc#1024:tc=unused:\ :pg#10428:og#16632:bg#1024:fg#1024:tg=2.11BSD:\ :ph#27060:oh#0:bh#1024:fh#1024:th=2.11BSD rk07|RK07|DEC RK07:\ :ty=removable:ns#22:nt#3:nc#815:sf:bt=hkuboot:\ :b0=/mdec/hkuboot:\ :pa#8316:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8316:ob#8316:bb#1024:fb#1024:tb=swap:\ :pc#53790:oc#0:bc#1024:fc#1024:tc=unused:\ :pg#37092:og#16632:bg#1024:fg#1024:tg=2.11BSD:\ :ph#53724:oh#0:bh#1024:fh#1024:th=2.11BSD # The RL02 and RL01 have 256 byte sectors, getdiskbyname ignores 'se' # (thankfully) but partitions are still in units of 512-byte sectors. rl01|RL01|DEC RL01:\ :ty=removable:se#256:ns#20:nt#2:nc#256:\ :b0=/mdec/rluboot:\ :ph#10240:oh#0:bh#1024:fh#1024:th=2.11BSD rl02|RL02|DEC RL02:\ :ty=removable:se#256:ns#20:nt#2:nc#512:\ :b0=/mdec/rluboot:\ :pa#15360:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#5120:ob#15360:bb#1024:fb#1024:tb=swap:\ :ph#20480:oh#0:bh#1024:fh#1024:th=2.11BSD rk05|RK05|DEC RK05:\ :ty=removable:ns#12:nt#2:nc#203:bt=rkuboot:\ :b0=/mdec/rkuboot:\ :ph#4872:oh#0:bh#1024:fh#1024:th=2.11BSD # # Disks on a UDA50 # ra60|RA60|DEC RA60 Removable|OLD STYLE PARTITIONS:\ :dt=MSCP:ty=removable:ns#42:nt#4:nc#2382:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0ba#1024:fa#1024:ta=2.11BSD:\ :pb#33440:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#193282:oc#49324:bc#1024:fc#1024:tc=2.11BSD:\ :pd#15884:od#242606:bd#1024:fd#1024:td=2.11BSD:\ :pe#140686:oe#258490:be#1024:fe#1024:te=2.11BSD:\ :pg#156570:og#242606:bg#1024:fg#1024:tg=2.11BSD:\ :ph#399176:oh#0:bh#1024:fh#1024:th=2.11BSD ra80|RA80|DEC RA80 Winchester|OLD STYLE PARTITIONS:\ :dt=MSCP:ty=fixed:ns#31:nt#14:nc#559:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#33440:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#186888:oc#49324:bc#1024:fc#1024:tc=2.11BSD:\ :ph#236212:oh#0:bh#1024:fh#1024:th=2.11BSD ra81|RA81|DEC RA81 Winchester|OLD STYLE PARTITIONS:\ :dt=MSCP:ty=fixed:ns#51:nt#14:nc#1248:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#33440:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#193282:oc#49324:bc#1024:fc#1024:tc=2.11BSD:\ :pd#15884:od#242606:bd#1024:fd#1024:td=2.11BSD:\ :pe#307200:oe#258490:be#1024:fe#1024:te=2.11BSD:\ :pf#324382:of#565690:bf#1024:ff#1024:tf=2.11BSD:\ :pg#647466:og#242606:bg#1024:fg#1024:tg=2.11BSD:\ :ph#890072:oh#0:bh#1024:fh#1024:th=2.11BSD ra81x|RA81X|Extended DEC RA81 Winchester|OLD STYLE PARTITIONS:\ :dt=MSCP:ty=fixed:ns#51:nt#14:nc#1815:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#33440:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#193282:oc#49324:bc#1024:fc#1024:tc=2.11BSD:\ :pd#15884:od#242606:bd#1024:fd#1024:td=2.11BSD:\ :pe#307200:oe#258490:be#1024:fe#1024:te=2.11BSD:\ :pf#728952:of#565690:bf#1024:ff#1024:tf=2.11BSD:\ :pg#1052036:og#242606:bg#1024:fg#1024:\ :ph#1294642:oh#0:bh#1024:fh#1024:th=2.11BSD rd52|RD52|DEC RD52|OLD STYLE PARTITIONS:\ :dt=MSCP:ty=fixed:ns#18:nt#7:nc#480:so:\ :b0=/mdec/rauboot:\ :pa#9700:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#17300:ob#9700:bb#1024:fb#1024:tb=2.11BSD:\ :pc#3100:oc#27000:bc#1024:fc#1024:tc=swap:\ :pd#30348:od#30100:bd#1024:fd#1024:td=2.11BSD:\ :pg#50748:og#9700:bg#1024:fg#1024:tg=2.11BSD:\ :ph#60448:oh#0:bh#1024:fh#1024:th=2.11BSD rd53|RD53||DEC RD53|OLD STYLE PARTITIONS:\ :dt=MSCP:ty=fixed:ns#18:nt#8:nc#963:so:\ :b0=/mdec/rauboot:\ :pa#9700:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#17300:ob#9700:bb#1024:fb#1024:tb=2.11BSD:\ :pc#3100:oc#27000:bc#1024:fc#1024:tc=swap:\ :pd#108540:od#30100:bd#1024:fd#1024:td=2.11BSD:\ :pg#128940:og#9700:bg#1024:fg#1024:tg=2.11BSD:\ :ph#138640:oh#0:bh#1024:fh#1024:th=2.11BSD rc25|RC25|rcf25|RCF25|DEC RC25 and RC25F:\ :dt=MSCP:ty=removable:ns#42:nt#4:nc#2382:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8360:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#50902:oc#0:bc#1024:fc#1024:tc=2.11BSD:\ :pg#26658:og#24244:bg#1024:fg#1024:tg=2.11BSD rd31|RD31|DEC RD31:\ :dt=MSCP:ty=fixed:ns#17:nt#4:nc#615:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8360:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#41560:oc#0:bc#1024:fc#1024:tc=2.11BSD:\ :pg#17316:og#24244:bg#1024:fg#1024:tg=2.11BSD rd32|RD32|DEC RD32:\ :dt=MSCP:ty=fixed:ns#17:nt#6:nc#820:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8360:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#83236:oc#0:bc#1024:fc#1024:tc=2.11BSD:\ :pg#58992:og#24244:bg#1024:fg#1024:tg=2.11BSD rd33|RD33|DEC RD33:\ :dt=MSCP:ty=fixed:ns#17:nt#7:nc#1170:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8360:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#138565:oc#0:bc#1024:fc#1024:tc=2.11BSD:\ :pg#114321:og#24244:bg#1024:fg#1024:tg=2.11BSD rd51|RD51|DEC RD51:\ :dt=MSCP:ty=fixed:ns#18:nt#4:nc#300:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#5716:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#21600:oc#0:bc#1024:fc#1024:tc=2.11BSD rd52new|RD52new|DEC RD52|NEW STYLE PARTITIONS:\ :dt=MSCP:ty=fixed:ns#18:nt#7:nc#480:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8360:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#60480:oc#0:bc#1024:fc#1024:tc=2.11BSD:\ :pg#36236:og#24244:bg#1024:fg#1024:tg=2.11BSD rd53new|RD53new|DEC RD53|NEW STYLE PARTITIONS:\ :dt=MSCP:ty=fixed:ns#17:nt#8:nc#1024:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8360:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#138672:oc#0:bc#1024:fc#1024:tc=2.11BSD:\ :pg#114428:og#24244:bg#1024:fg#1024:tg=2.11BSD\ rd54|RD54|DEC RD54:\ :dt=MSCP:ty=fixed:ns#17:nt#15:nc#1221:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#311200:oc#0:bc#1024:fc#1024:tc=unused:\ :pg#278596:og#32604:bg#1024:fg#1024:tg=2.11BSD rx23|RX23|DEC RX23:\ :dt=MSCP:ty=floppy:ns#18:nt#2:nc#80:\ :b0=/mdec/rauboot:\ :pa#2880:oa#0:ba#1024:fa#1024:ta=2.11BSD rx26|RX26|DEC RX26:\ :dt=MSCP:ty=floppy:ns#36:nt#2:nc#80:\ :b0=/mdec/rauboot:\ :pa#5760:oa#0:ba#1024:fa#1024:ta=2.11BSD rx33|RX33|DEC RX33:\ :dt=MSCP:ty=floppy:ns#15:nt#2:nc#80:\ :b0=/mdec/rauboot:\ :pa#2400:oa#0:ba#1024:fa#1024:ta=2.11BSD rx50|RX50|DEC RX50:\ :dt=MSCP:ty=removable:ns#10:nt#1:nc#80:\ :b0=/mdec/rauboot:\ :pa#800:oa#0:ba#1024:fa#1024:2.11BSD ra60new|RA60new|DEC RA60|NEW STYLE PARTITIONS:\ :dt=MSCP:ty=removable:ns#42:nt#4:nc#2382:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#400176:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#140436:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pg#367572:og#32604:bg#1024:fg#1024:tg=2.11BSD ra70|RA70|DEC RA70:\ :dt=MSCP:ty=fixed:ns#33:nt#11:nc#1507:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#547041:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#287301:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pg#514437:og#32604:bg#1024:fg#1024:tg=2.11BSD ra71|RA71|DEC RA71:\ :dt=MSCP:ty=fixed:ns#51:nt#14:nc#1915:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#1367310:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#182464:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#819200:og#32604:bg#1024:fg#1024:tg=2.11BSD:\ :ph#515506:oh#851804:bh#1024:fh#1024:th=2.11BSD ra72|RA72|DEC RA72:\ :dt=MSCP:ty=fixed:ns#51:nt#20:nc#1915:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#1953300:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#182464:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#819200:og#32604:bg#1024:fg#1024:tg=2.11BSD:\ :ph#1101496:oh#851804:bh#1024:fh#1024:th=2.11BSD ra73|RA73|DEC RA73:\ :dt=MSCP:ty=fixed:ns#70:nt#21:nc#2667:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#3920490:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#182464:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#819200:og#32604:bg#1024:fg#1024:tg=2.11BSD:\ :ph#3068686:oh#851804:bh#1024:fh#1024:th=2.11BSD ra80new|RA80new|DEC RA80|NEW STYLE PARTITIONS:\ :dt=MSCP:ty=fixed:ns#31:nt#14:nc#546:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#237212:oc#0:bc#1024:fc#1024:\ :pg#204608:og#32604:bg#1024:fg#1024:tg=2.11BSD ra81new|RA81new|DEC RA81|NEW STYLE PARTITIONS:\ :dt=MSCP:ty=fixed:ns#51:nt#14:nc#1248:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#891072:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#182464:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#819200:og#32604:bg#1024:fg#1024:tg=2.11BSD:\ :ph#39268:oh#851804:bh#1024:fh#1024:th=2.11BSD ra82|RA82|DEC RA82:\ :dt=MSCP:ty=fixed:ns#57:nt#15:nc#1423:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#1216665:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#182464:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#819200:og#32604:bg#1024:fg#1024:tg=2.11BSD:\ :ph#364861:oh#851804:bh#1024:fh#1024:th=2.11BSD ra90|RA90|DEC RA90:\ :dt=MSCP:ty=fixed:ns#69:nt#13:nc#2649:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#2376153:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#182464:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#819200:og#32604:bg#1024:fg#1024:tg=2.11BSD:\ :ph#1524349:oh#851804:bh#1024:fh#1024:th=2.11BSD ra92|RA92|DEC RA92:\ :dt=MSCP:ty=fixed:ns#69:nt#13:nc#3279:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#2940951:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#182464:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#819200:og#32604:bg#1024:fg#1024:tg=2.11BSD:\ :ph#2089147:oh#851804:bh#1024:fh#1024:th=2.11BSD rz22|RZ22|DEC RZ22:\ :dt=MSCP:ty=fixed:ns#33:nt#4:nc#776:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8360:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#102432:oc#0:bc#1024:fc#1024:\ :pg#78188:og#24244:bg#1024:fg#1024:tg=2.11BSD rz23|RZ23|DEC RZ23:\ :dt=MSCP:ty=fixed:ns#33:nt#8:nc#776:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8360:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#204864:oc#0:bc#1024:fc#1024:\ :pg#180620:og#24244:bg#1024:fg#1024:tg=2.11BSD rz23l|RZ23L|DEC RZ23L:\ :dt=MSCP:ty=fixed:ns#39:nt#4:nc#1524:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#8360:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#237588:oc#0:bc#1024:fc#1024:\ :pg#213344:og#24244:bg#1024:fg#1024:tg=2.11BSD rz24|RZ24|DEC RZ24:\ :dt=MSCP:ty=fixed:ns#38:nt#8:nc#1348:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#409792:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#150052:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pg#377188:og#32604:bg#1024:fg#1024:tg=2.11BSD rz24l|RZ24L|DEC RZ24L:\ :dt=MSCP:ty=fixed:ns#65:nt#4:nc#1818:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#479350:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#219610:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pg#446746:og#32604:bg#1024:fg#1024:tg=2.11BSD rz25|RZ25|DEC RZ25:\ :dt=MSCP:ty=fixed:ns#62:nt#9:nc#1476:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#832527:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#130590:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#799923:og#32604:bg#1024:fg#1024:tg=2.11BSD: rz26|RZ26|DEC RZ26:\ :dt=MSCP:ty=fixed:ns#57:nt#14:nc#2570:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#2050860:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#182464:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#819200:og#32604:bg#1024:fg#1024:tg=2.11BSD:\ :ph#1199056:oh#851804:bh#1024:fh#1024:th=2.11BSD rz55|RZ55|DEC RZ55:\ :dt=MSCP:ty=fixed:ns#36:nt#15:nc#1224:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#649040:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#389300:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pg#616436:og#32604:bg#1024:fg#1024:tg=2.11BSD rz56|RZ56|DEC RZ56:\ :dt=MSCP:ty=fixed:ns#54:nt#15:nc#1632:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#1299174:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#182464:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#819200:og#32604:bg#1024:fg#1024:tg=2.11BSD:\ :ph#447370:oh#851804:bh#1024:fh#1024:th=2.11BSD rz57|RZ57|DEC RZ57:\ :dt=MSCP:ty=fixed:ns#71:nt#15:nc#1854:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16720:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#1954050:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#182464:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#819200:og#32604:bg#1024:fg#1024:tg=2.11BSD:\ :ph#1102246:oh#851804:bh#1024:fh#1024:th=2.11BSD rz58|RZ58|DEC RZ58:\ :dt=MSCP:ty=fixed:ns#85:nt#15:nc#2112:so:\ :b0=/mdec/rauboot:\ :pa#15884:oa#0:ba#1024:fa#1024:ta=2.11BSD:\ :pb#16270:ob#15884:bb#1024:fb#1024:tb=swap:\ :pc#2698061:oc#0:bc#1024:fc#1024:\ :pd#227136:od#32604:bd#1024:fd#1024:td=2.11BSD:\ :pe#409600:oe#259740:be#1024:fe#1024:te=2.11BSD:\ :pf#182464:of#669340:bf#1024:ff#1024:tf=2.11BSD:\ :pg#819200:og#32604:bg#1024:fg#1024:tg=2.11BSD:\ :ph#1846257:oh#851804:bh#1024:fh#1024:th=2.11BSD # The RX driver uses partition 'a' to select single density and 'b' to # select double density. Partition sizes are in units of 512-byte sectors # even though the rx01 uses 128 byte hardware sectors and the rx02 256 byte # sectors. This really doesn't work too well for the RX01 due to the odd # number of sectors - are there any of them still running? rx01|RX01|DEC RX01:\ :ty=floppy:se#128:ns#13:nt#1:nc#77:\ :pa#500:ba#1024:fa#1024:\ rx02|RX02|DEC RX02:\ :ty=floppy:se#256:ns#13:nt#1:nc#77:\ :pb#1001:bb#1024:fb#1024: # # RAM disk # ram|RAM|Ram disk:\ :ty=simulated:ns#2:nt#1024:nc#4096: 0;lyU   R0̨R0̨0 E* e7cce7  / l  7%  ,8w f;%+2@& .4!5=%@5#@5Nf   ,8% @  ,8#F@& .4Nefe  ,8 ,8%I@& .4 @  ,8%L@& .4@   ,8 ,8   ,8wB:w .:nOf P 5 NQ 2% ,8@e5@e5@e5@e,5@e^55 4Ne^fe,fefefeffe e 5% Neu 2% Nef Ndfe ~% N T6@wD9w 09.u@5e"fe |8 @e5N !Br2@,%,!N 8 5 N 2%w8fe@& 82%@e5f .3f % Ef % Uf % Ue@  ̀  t%5  ,8Nei"f 9e N  ,8N 6 _w 7*"fe |8 @e5N !Br2@,%,!N 8 5 N 2% ,8fe@& 82%  t%5  ,8Nei"f 9e %. @f& p %f X%  ,8N 6@e5@f& & %f X%5N  X5 X5 X5* X4 Xw6w 5("fe |8 @e5N !Br2@,%,!N 8 5 N6 2% ,8fe@& 82%  t%5M  ,8Ne i"f 9e % @f& %fY X%n  ,8N 6@f& %fw X%w4w 45 f " ֝  2% ,8 N 2% ,8 f 3 5 N2 2% ,8 ~& f 4e,f 4% \ vm6@ f&f 4efef 4% % N 2% ,8AWpuN 95  2  ,8  vm@ f&f 4eNff 4%@-&  ,8N 6_ @  _ @ f f &!%55 u @%*@f& d%fB X%@ e N X@ [ X@ f X@ q X{ Xe@ w2w 2@E@E&@E&@E&@E&& N} Xe w1w 1Nefefefefefef e5% N 2%wZ15 @@mA AaH % w 1 X X X XO Xw1w 0hf P 5w0N0fe e%_ %%%  %%%cNe 5uu5 Ne 5u fff e ?jf P 55D 55444  \45@-5e  %l 2 N T6N T6@_ CeXN e%  @ A@bl@ f&f e Nffe* eDNe*& .4 4 e   w .DE5_% _ _ 5`uu '& & 4e5u%%wZ. @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & 4e5u %%    %%%_d 5 55 5 E4N ff & 4e W _d %_ %_ _d w ,D 5u5mu A@w,w ,D 5u5 A@wt,w `,De m@ e@ 5u%% du %e u 5mu A@w ,w +D R5u5 A@w+w +0;lxU   R0̨R0̨0D%%055  m@ 5u%% e du %umumu 5umumu A@wD+w 0+DeEE&E&E&~4 ze 4w*w *DC AupB 4  & 82%b 5% 傎& 82%`@ @m A &@wx*  w Z*fef <%5 `wF* w .*Nef %w&*w *Neff %w *w )D A555  ԋuNeffe %w)w )DC 5 5 _H%%_j5 %*e5  AWp `eu  0u%l5  %h%[  e  _Neffff e   * O  A@ EN 5% % % %Nf ( &    %_" A@ E%Nf ( @w$(N 5 w 'N%c%s%[Nf ff f& ew'5 5 5 5 %e%f %o%xDe5 5 A @ EN % % % %- Ԑ A @ EN  _%+_  _%a%f %A_%F_ % A@vN O% A@v@mAm@ vA@v5u 0 %a%fW7 5`u`u C% S P Ԑ A @ E = %%.%e%E- *% ' $ ! Ԑ A @ EN %+%-%0%9 A@  5u% N  ( =   @e! @e! _@t@]   xNe A _Ne A @H@pHw $DC = 5%c%0u5 %s    %r%c5 %[r      %%   ( =  D- %cw# w #D ̥^   % %]%-+  $%-̥]4   ̠   %]  w#w #D*\5% %-%+ 5 55 55  B5eA5  %.55  B5eA5   %E%e$%+%-  Wp B`e   @`5 @ 5AupAm%55 @5A5u555555  55555AupN& |e5 55wJ!6 m 7"w !D Lԋw !w De LN \44ee0 B  \44e Be v Nfe x%w w p -*@ wj NF z%Faww 8 BuNefef <%=@@w  Jҋ~ @@W f r @  W f r@  @ w D% 5     |@w\4- yw&  4  b '     ` TW ~  s`K6!  w D85U5_:5P_: | mr@e4 ,5Ne & 8  uN 94USt%5  55 55& & 4% 45@e-4  % U5EU  wE w bD Z +   r= wB wD5 a U5ff 3%ށ̥a &  4e 3     U̥r 33w z  uff e55 Ddfe& 82%ed  d^& 82%e`& 82%e@A@ 7rj5%  N& 82%m@m<  Zww zD@et5r%=r D  # 7 ; ?   w:e =r r̋ =rNet .4 Net .4e  @et5Net \45&f 4% $b (%7 Z  w DC :.  # 7(% ?  2!f 1%    w.u5&f % | (%7 w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @  W-@D Ae B ḁ.@e@- @D @pHe _!̋@pHeA Be vC ̂ xv uuff %5uwpA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ 9  w5 4@E%@EU5N&e J4 &e 4 Nf&e 3%4 IN&e J4 &e 4 Nf&e 3%  (Ne& 8  ff eee@ 4t@t"4 4t 6 N:_$w N 6@ 6N N:wzw fDff %5u4 4 @ A f&A@EE4tmm@ 4 t  , ve@ 4tww D55ff %f&& "eff&e e &e . 55 wJwFwb5 5 w DD5#5ff T %f&& eff&e *ew&e f0'44  && ef&& 4e&e & 0;%%U w vD5_:(o5ff %f&& eff&e Ze L&e f08f f ff&e V e 744  && ef&& 4e&e & 0;%%UUw @@m e%fe |8  &e . 55 3ff `%f&e@ &50c &e . 55 3 2 U44  && ef&& 4e&e & 0;%%&_&(fffffe e _&(&e % _j(_&(e_j(  mm@ e@ f& ef&& 4efe& 0;%%_&( $-_d'w @0 0 @0 N *77ww D85_*+Ne& 8q fe Ve4-4-/44  &&  ef&& 4e&e & 4%%&e |8 &e . 55 ewww4 et 5-5-5 5 w ~D4 4 @ A f&A@EE4tmm@ 4 t  , ve@ 4t4-4-/44  && ef&& 4e&e & 4%%&e |8 ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& 4e&e$& 4%%&e$ |8 `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& 4e&e$& 4%%&e$ |8 `Btp$t t"  ff Nef&& 4e&e$& 0;%%UwD w 0 D5#5 5 w ww  @ a@ a@m5A a@5w D 5# aB- f a@m& 1% w e aC-w ^ D@ A 5@u@e@ 5u   w, uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l 5l u te%w L D5u-5 w2 @e@- @ a@ a@ a5@ a@@@m`&fNm 82% a@ `` e w D a@@m e  wj e  aAm HN@`@m &f 82%  aN f`f 82%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef <% 5U4 4  fef <%5 wZ    6v&  @ppC`p   6@Cw8w27 Ћ P ы A@PЋ w FD:5UE5Hw* _55uNfe & 0;% _5bNe & 8  uN 9)U5| m- 5 & 0;%St% T 8 U   & 0;% S U _4 @_4w DE%%"5   & 0;% U wv w ^D55@ 5  6 3 N: 4 4 4 4 4 ww~w  $5+ P &5e-2e % &     @8 ww  5f @8 7v f @8 7LwX@ mL7J@%e w  *     @8 e-ww D 5 e %w  5 e-w T6 7ww  N 6;ww rDCDpC 9 |8 wZw FN N:wJ ~5 & E        ~5>wlYwfw Net@f 9e  w6w.w  U7U7Ae vB7   x%r 55 a  a!PE -:% w$ ; `e vWt vw@ `e @  ;%e U? `e 7U?ה a7 ט?U ew dDlE wZw FD5 N: 5N 9!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%Էmԇ%w w7*'$!      7 & A& BF7!W-E7& & de Ӌ  &7& e ӕ-zӕ0B~fӕ.  ӕ0~ B~&7: & e ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_>@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff e w5  @ 0   Wp `e0w  @w]ww |  T67 $ (%7 7 w`w L  P 7| lr ~%5#f t@  f t@ N !f&҈ ̥ ̥ 7l7f& t@  ̥̋ ̥ %& t@   zw`w LwwRw >D CKw4 ˋ 5 w D 5 & & 4e 4E05Eww DCB P  5 , :% & E& l4 z   5 , @ :% & f E l4  (˥-%0     ,:% &  l4 8 5E& z   5 , @ :% & f E l4  wZw FNefef 5& Ce C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& Ceww  fff 5& Ceww  5 %O N  = 555Ne5& tEe555'0Ne5 B& tEe57 Be0" 5%55 5 B5@B e a=%7w %5 B5Ne& tEe55e0%7`Jʕ0%ʕ1  %˕0 ʥ9 6@~ /vmunix-a/netnix/dev/mem-s-d-frarp: cannot open %s %s %s %s %s %sarp: bad line: %s arp: %s: unknown host temppubtrailarp: socketarp: %s: unknown host arp: socket%s (%s) -- no entry SIOCGARP%s (%s) at (incomplete) permanent published trailers arp: %s: unknown host arp: socket%s (%s) -- no entry SIOCDARP%s (%s) deleted _arptab_arptab_size_netdataarp: %s: bad namelist arp: %s: bad namelist arp: cannot open %s arp: %s: namelist wrong arp: can't get memory for arptab arp: error reading arptab?%s (%s) at (incomplete) permanent published trailers %x:%x:%x:%x:%x:%x%x:%x:%x:%x:%x:%xarp: invalid Ethernet address '%s' Usage: arp hostname arp -a [/vmunix] [/dev/kmem] arp -d hostname arp -s hostname ether_addr [temp] [pub] [trail] arp -f filename rrnlist: sym 2 big %d.%d.%d.%d: Unknown error: %dv~".@Rdp6ETly;Xi J a   ; S t  ( ; J ^ t  * L a RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator0#V### ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired =d=o=x>f>e=gl>cx>s=l=L=u=D=O=X>Uv/etc/hostsr# =(\0<l D9 R0R00~,N  e7,cce7= /,   7,%  ^%w (^5 5 5 5 %,@& `! e % ,8   ^%@&  @  ^% @-fe % fe %5-8  @  ^%@ 0  _\49efe Z @e5Ne !5&ff e5& p D5 5 B e ffe (%&e (%e&e (%e5 5f (%m e 49495 Nf& - efffff ,e  _45,Nfe Z @e5Ne !5fffff ,e Ne 5u5fffff ,e C-e  49@-495 _F N @Z-fe %@e-fe %Nefe l-  ^%@x-fe %@-fe %Nefe -  ^%Nf- % ^%@-fe %Ne @-fe %Ne  ^%wt$w `$ fff <e55  wD$N=f (%=7n8ԋfe& (%eF=ԋ  F=68@=& (%eB=& (%e=8@=@ 7r7%  =m7  <=w t# @55@e 5@e 5@C `!e  }ee= e  @!C @& % e  }ee= e  w"w "DC e 5Ԕˋwp"w!w V"8fef &)%5 d1wB" w *"D Lԋw""!w!w "De LN !4e-e6 b  !4e- Be v Nfe %w!w !-"'@ -w|!N-A %Aw P! BuNefef &)%=@@w$!< w yw w ! -- w]:5w w -~- #7 v- -- 7 -7 5w w R- 5N- @ 7>- l4-A n %5#5f >  5f > 59N f&999 ̥ ̥ 79dB7|95& >  ̥̋ ̥ %B5& >   ZBww wX,ww D CKw ˋ 5 &  4  b '     ` TW ~  s`K6!  w D85U5_* 5P_* . m.@e4 ,5Ne & %  uN <&4USt%75j-8 "#5f-8 "#5& & % 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff %ށ̥a &  8!e 3     U̥r 33w   uffh) e55 DB"6fe& (%eC  C5B& (%eB& (%eC5@A@ 7r55%  C5& (%m5m~5  Bww D@et5r%=r f(D B(  7T(;/   / w|e =r r̋5=rNet `! Net `!e  @et5Net !5&f 4% :/' 7 ' $/w DC '. `'  7r'%.   2!f %  . .wpu5&f % .' 7 & w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @5 W-@D5 Ae B5ḁ.@e@- @D5@pHe _̋@pH0<l D9 R0R00~eA Be vC ̂ x5uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ <& ., w5 4@E%@EU5N&e |! 7&e H! Nf&e %4 IN&e |! 7&e H! Nf&e %  (Ne& %  ff eee@ 4t@t"4 4t # '_w N #@ #N 'ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4tw"w D55ff %f&& "eff&e e &e r 55 w0w0Cw5 5 w D5#)5ff T %f&& eff&e *ew6&e V'44  && ef&& 8!e&e & b(%%U w D5_*(o5ff %f&& eff&e Ze L&e V8f f ff&e V e 744  && ef&& 8!e&e & b(%%UU (w @@m e%fe %  &e r 55 3ff `%f&e@ &50c &e r 55 378  U44  && ef&& 8!e&e & b(%%&_fffffe e _&e % _Z_e_Z  mm@ e@ f& ef&& 8!efe& b(%%_ _Tw @0 0 @0 N 7,7,Cww D85_Ne& %q fe Ve4-4-/44  &&  ef&& 8!e&e & %%&e % &e r 55 ew+w+Cw4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4t4-4-/44  && ef&& 8!e&e & %%&e % ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& 8!e&e$& %%&e$ % `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& 8!e&e$& %%&e$ % `Btp$t t"  ff Nef&& 8!e&e$& b(%%Uw w r D5#5 5 wL(wH(CwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& % w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l6@Et5l65l6u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm (% a@ `` e w D a@@m e  w e  aAm HN@`@m &f (%  aN f`f (%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef &)% "#U4 4  fef &)%5 w    6v&  @ppC`p   6@Cwzwtw D "# & & 8!e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _#5uNfe & b(% _#bNe & %  uN <&)U5| m- 5 & b(%St%8 \ & U   & b(% S U _! @_!w DE%%"5   & b(% U wv w ^D55@ "#  # 3 ' 4 4 4 4 4 ww~w   $75+ ( &5e- e %8 &     r% ww  5f r% 7v f r% 7TwX@ mL7J7@%8e w  *     r% e-ww D 75 e %8w  5 e-w # $ww  N h(ww rDCDpC <& % wZw FN 'wJ ~5 & E        ~5>wlYwfw Net@f 6&e  w6w.w  CU7CU7CCAe vB7   x%r 55 a  a!PE -:%C w$ <( `e vWt vw@ `e @  <(%e U? `e 7CU? a7 ?U ew dDlE wZw FD5 ' 5N <&!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7*'$!      7& A& BF7!W-,7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu8Bw* J@B |_*@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& ! z   5 , @ :% & f E !  (˥-%0     ,:% &  ! 8 5E& z   5 , @ :% & f E !  w-vusage: mkhosts [ -v ] file %s.newdbm_open failed: store %s, %d aliases %d addresses dbm_store host address%s.new.pag%s.pagrename .pag%s.new.dir%s.dirrename .dir%d host entries, maximum length %d %s.new.pag%s.new.dir: Unknown error: %d.......//*/:/F/X/j/|/////////00/0N0]0l000000000141S1p111111222b2y222223373S3k333333 44,4@4S4b4v44444445)5B5d5y5RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorVB5/etc/hostsr# Fp ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired CDD*d*o*x*f*e)g*c*s)l)L&*u**D*O*X<*U0=l 8 R0R00~  (( e7cce7 /  7%  w @ d w<w (D* R ?E G ߬  -?% <& ߂ F  r݀5r<EX -X ?J%  <<& 0 F w5&< w bD LԋwZw FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%<   U   & % S U _n @_rw DE%%"5   & % U wv w ^D55@    3 ( 4 4 4 4 4 ww~w  $05+ t &5e-xVe %  & V     ww  5f  7 f  7wX@ m70% e w        e-ww D 05 e % wj  5 e-Pw . ww  N ww rDCDpC  V wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  XFU7JDU7@F>D6Ae vB"7 $  % 55 a  a!PE -%D w$  `e vWt vw@ `e @  %~e U?ll `e 7ZDU?N a7@ 8:?2.U ew dDE wZw FD5 ( 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `jm4& E%&m %w w7*'$!      7& A& BF7!pW-7\tunefs hasn't been implemented under 2.11BSD.,PP0>lEɁ R0R0桚0} }F  e7cce7' / R?  7%  >rw xuw 0&  B% 76eN *% 8 >r  8 >r   ( , 8 >rNf   >r r7^r0 5& l)N;Na 8 wnw nf%z 8wn%6@& @n,@e74T! BeT!%| %:@    8 ewT! r!  8 w $n @5%t%c%d @fwn w mNe fe @n 5)@5@55 %c%d%c  @AA@wmw nmT%J ~$ 7 8 T!@ @/fe 9e5 8? <  @meʥc#  @me5dee @n  @- f \n T! X D-wlw llN W NN% 8 wTlw @lf%2 8w8l%6U@& @n,@e7T! BeT!%| %:@  H H 8 ew,(T! r! Y 8 w |k4T%J ~$ 7J ~$ 7T! Ue 8 NeT! JWNET! j% 8wjw jf% 8wj%6@& @n,@e7(T! BeT!%| %:@  H 0 8 ewT! r!   8 w j4T%JD ~$ 7GJV ~$ 7pYhd^^T! UeHd 8 NeT! JW@EUT! j%i%T! m% p 8wPiw rwfw ff% 8wf%:C@& @n0@e7T! BeT!%| %:@   r  m 8 ewT! r! G 8 r w ef%0>l7Ɂ R0R0桚0} 8we%8@& @n.@e7,T! BeT!%| %:@     8 ewT! r!  8 w e4T%J ~$ 7|J ~$ 7ld`ZT! UeD 8 $NeT! JW%AA @@T! j% 8  2J 8wTdw @df%C@e7T! ;BeT!%| %:@  L p 8 ewXTT! r! [ 8 wcw c6T%J ~$ 7J ~$ 7J ~$ 7 8 T! UeNeT! JW5 8 5@ 8  8 8N nV52 8_\ cf N VN JV S` 8 %x 8  T! m & 7 p p P J  B > 5< . -.  ? % &   ~n bXT! Ue T! m  & 7 T! |%eT!& m% pwxaw daf% 8w\a%6@& @n,@e7 T! BeT!%| %:@  H l  8 ewP L T! r!  8 w `4T%J ~$ 7 J ~$ 7! & T! Ue , 8 NeT! JW@EU@T! j%1 K %T! m%_  py  8w_w _8%   8_n ew  T! r! 5   8_lT%J ~$ 7 J ~$ 7"  ' 8  p% , \' 7T5 77C  @mA 8   @m    mB `t -80 `t ^ _ Ne JW @EU j% wf^w R^ u55u u55uNefe W w^w ]5 :f V 5 u= u5 @b Wp @A@`e @& m' %Nf @n Nf @n r ev 8 -@w8] e5@Wp @A@`e  m-xق &e TZ 5N  PFN fpP6U!f @n r e 8 w t\f% 8wl\%8 @& @n.@e7T! BeT!%| %:@    x 8 ew\XT! r!  8 w [  L%M%+ F  TZ 5^  wv[@eb5` ^ A^@ EN^ Y=`% ` `=`feb 4 & l)Y   fe \n Ne nnefe& D%   pNfe U%Ne nnfe& Bu% fe& m%%F p_^ l f ^ Z/5XJ -J@?<% & * @݊& ~n fe |%efe& m%老w YN4 8%-( " & N&   ߖ 5 - ?t% & b ~n w4Yw Y N N <\5Nk  { x' 5 fe r @fe@& l%@5@5"7 N pw %0  %= %N = Ne .5ց fef De ˁ@w Xw X T!% wX% ӕ 5  A@ EN Y% w W:0 nV5_R_N ff Neu@  s_h5 UcQfMNe&e JWCe nne s`Ksee \n u-&  ff XNef& xNef& |Ue/@ `N VN JV tf :e@wVNef r_:N JV_2w PVDCf&&%   wVf&&% w U%'`' 8 P 8F@ 8 N fff 8e  ߪ 5 - ?% & v ~n  >rw@Uw ,UD 4 TZ 7 wU7  @ E fp7 - \(  Y   #- e!  Bu% Ԑw hT vp fpwfTw RT 5 wN5    m 5 Bu% N D# N p jwTD N p @e!نԐB-fef m%5 @a % D-Ć\ w S nnm:-r0 Bu% c ̥t]cYefe \n Ce˥:  % CNefe r! %Ce ˥: nnA@`5%V Bu%@` & \n wwRw R˥#%  ̋ ̋˥|˥:ˋ wZR˥:˥| ˋˋ˥: Dw "RD̥: ̥̋: wRw Q #ʋRʋAA@ ʥ@wQʥ#  ʥ0 CpDe`w Q #̋T̋AA@ ̥̋:̥@ wZQw FQN #̋T̋AA@ ̥@ w"Q̥= N& $ w PDC=%::\  xEB n@  0teP DwnPwO wOwOw HPDC AupB5 S  "̥ ;  & ӄ ~n %;  7  & l%bb& ӄ ~n % ₎& l%`@ @m A 1&@wO  w vODC E5<E@e33. @;E  5 , @;% & fE ~n 5  pU3 3  wN  1     SW ~#r`J   w LNL ' f @ne  f @n N& @n  6wMw M  TZ 7 mw]wMw M zt fp7 l7 wMw M Z  TZ 7F r<' X%5#f 8)  wf 8) 5=  f 8) N 6 877(7& 8)  ̥̋ ̥ %(& 8)   z(wLw LD CKwL ˋ 5 %wKw RLR 6,5N <\5N 7w,L}& -%5u? l GNf L%@5fe@& l%u fef De _ +N p%0 Ne .5%  Lff :-%%= %N = @ <ff % l%w LA1`@fe@& l%ff % l%N Rf Bu%5 N nn ff Bu%N nn f f Bu%N nn f f Bu%fef m%%_-N L N pN p_f*Ne .5 f 8 Nfe U%Ne nn &fe NB &fef Ie% LNfe r  C r vf&A r t@aUU C r vf&A r t@aUU7  & & fe e%  C r vf&A r t@a&50 <0 l  fefef 8e5N p \ L5 _+}N 85%%%_@+c l _+fef m%%_+fe Bu% _+ff )%@_)w G5 5   L%5+N 85fef 1% %0 %N p @N pwHGw 4G|DCe%@5̥.e ̋   TZ 5 Nff fef /e N fp QN fp%G Z A5 N 15|8fe| \n fe| (n fe| TZ 5Ne~@ & r  @|p-5N fpwEw EBN@fe X% YDe̥ ̥ ̋e  ̥ ̥ ̥  ̥ ̥ 5̥ ̥ ̥ ̋ 5 N fef 0% NNf @n w(Ew E% Nf @n_1WNff "V% KNf @n@@mȋ= : +A( 8 %v)7.( V 7\ VR e ̋@@m ( @n wJDhwCw 0D D  @ L  w"D * 5 ff L% 50"  8 (w C  uN nn5&f %5(wC 5  f @n  0   w HC p  @e5ff l%5(wC $5  w-   4 w B  m  &  ]%7~wBp @nd5f TZ 7~ w VB |3w\Bw HB t  wJBwlw *B B< ^7 4  0* fp7 "wBw AwwBw A   @ E wA Y5% %) X%  ) V) ? 7& ? 7& ?  67t& ?  67\& ? 7R& ?  L774w2& ?  L77"w & ? 7& ? 7& ? 7_3w @ 7 w@  r7 l c c55 fft B*e55Z 7 D)JD(& l%e(& l%e(& l%e (& l%e7w ?  _6p @n_T6`_X6 5 & f m%5=v L75u fff ne5 #u 1*f m%50** :=*N pw>w >D      + - ̥9 Wp @@`e̥0  w>w x>D5 5      + -! ̥9 f& ff 5eee@ ee@ 5u̥0 A@  w=A@w\=w =De LN nn4ee-؜   nn4e Be v Nfe |X%wP=w <=DeEE&E&E&6* Ue 6*w=WwtN nV5Nef r ff 3eu@  swj<5 Y   Qe E s 33e5e5@ A H u-Nef r ff @3eu@  ~t @ `N VN JV  N f :e@w ^;Nefe @n wT;w @;%Vww t7WpwAwpAmu% Nf ; @mh5uBmPB-"C-Dm:5TD-um@5@- w: ӁNf mu-Bm B-т̒C-Lw : @@5@  vwpxAmDu-n6B X@D5 6 N C!  5ԒS DCUC-f m5D-/+D-!Cm@5&@5%3-f ; 5u0B55\X5R DD-N& 0m(-$N& ; - _;w8&& e& & 4%ReR$P @  1  $ "@! @#E B Ew 7 Bu%w7pwT7w 74De _^? t4 t t4 4t Ne&& W% _^?t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 x? 55 Nefe W% & %5u7 4 && W% $ fe W%ff `% fe& W%wv6A@E f& 0w L6wR6w >6D Lԋw66w "6DC  w65 7@  55@- 7 X5!w 5 @e5ff &@%w5w 5D5 N# @%EAEt =d_B5]JNe SNfej U%CaejNe ^HAej@ Le`5     U%`5   U%` ӕ:ӕ Bej%_.Bmo N L U%` 5 Nfej X%`Aej@55 0*@e`5^}^f@ej@A^1e^^@^fe` |X%^  U B%Nfej Bu%@-`R ffej Le O5vK 5h%D 4  m%5'fej (n e>fej V  NAej@f Bu%N p Hu & fh XX%%%lw2w 2D ww 57%<.*X* U%5,  L%7r%  m 7ZV7J%B'4 L%%(V* D%% p~w1w 1 p7dw1w 1D 7w1bw61w 1N ^H *Dw1w 1D el&&&&WpeJf Wpe4ff* Uef*w\1w H15 5  AaAE f&A@vUU5u %w1w 1D w0̥/ 55 nn&f `) e %Nfe \n fe (n fe (n ԥ.̋De & K & m %fe0 m% p %,@e05e |DwNe$ |DwNe( |Dw%r_D _D% _D%2_DpWpfdWpem^e, _D@e\5 N |Df&t**e - @ E3N0 - *te15.N |Df&@.e@.A Ep@.A Ep - s2 -32 ~N0_D -n t-b1_D -R27670te15  e27 ˃ - _D@e27w @. Nefe Tw0.7 AWp@7 7  f T 2 \n 277 w -7 7 7 7 2 \n 27\7Vw-w - 8Ű  D  D  2  wz-w f-  @55 w-w-  t 1 -  t5,* 5,* - M0ue1&&fe Xe3 e2pne23w,w ,& f e*w,w t, F2Q@f& #e5uQ@f& #e5uumumu _IeeQu  %QQ eu % ff $#et ff ^#e5u< ff "et< ff &#eL A@e@ f& #et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWperu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw)!wH)\wB)w )De LN nn4ee L  nn4e Be v Nfe |X%wJ)w 6)-@ w0)N^2 U%^2ew(aw~(w (w@7% ?@~w(N f Mw (DC_R̥%_jR 5 r y _jR 9% 5afe & l%5@e5 5N R _R 5N R _R w( M_R M_R M_R  R% _R0 R% _R0 r  r f R% _R0 R% _R  R% _R  r  r f R% _M_R0 R% _M_R R _M_R M_M_R0 R% _M_R M_M_R R _M_R0e r& R% _M_R0e  @ r& R% _M_R0 R% _R_M M_R_M _M R _R_M _@M _FM _jR _M% _Mb_Mfe & l%5@e5_M _jR _M _dN _jR _M _N _jR _O _N _jR0 el rdf R% _R_M _O _jR0 R% _R_M _8O _FM _jR R _R_M _N _bO h_>P _.N _M Y% _N_N _O G0 R% H_M _8O _M - M2_M ! 0 el R% _M _N _P _NO _M?߷ ߄ ̋_M_Mw 0#2A r e0@ A r 5   %v2 @  L %v2  Rw"w "D w" f ` \?Xw "u@t5252@ 53Nefef W% (3A@u5Btr222@ Aup3 fef W% u-u-u-@w!w ! fe T@w! @pHA@tw(!w !* 8U!,& V   w! 1&@3 U%7 ˕,@3Nf T w @!D  !     +  w !e% - r<N r<&@&@3 Ue@3 ~ ~w Nef RU w w r D 5  =V& "V% `5ȥ= 0 = @w$ e  w BuNefef v%=@@wЋ Ћ  Jҋ~ @@w zD p4 4  `twjw V f m %  pP s4 4 w*w D 4-&4-!4 4   &e & m%4    wme   s lt  &wW f r @  W f r@  @ wSwmownWlw e& 7 7gw\wTtBjI I7DIw  BuNeff v%=@@ww l fff vXewbwyw&  4  b '     ` TW ~  s`K6!  w D85U5_>Z5P_>Z  m@e4 ,5Ne & r  uN s4USt%5> p5: p5& & m% 45@e-4  % U5EU  wE w pD h +   r= wB wR5 a U5ff m%ށ̥a &  ne 3     U̥r 33w   uffD Xe55 D~3fe& l%e~4  ~4x3& l%ez3& l%e4@A@ 7r5%  4d& l%mVmR  t3ww D@et5r%=r BD  ] 70;\ @x  L wHe =r r̋=rNet @n Net @ne  @et5Net nn5&f 4%  ^7 ʰw DC `.  ] 7N%z @x . 2!f k%  J  8ʀw<u5&f %  ^7 ؾ w 4$ s r w5 4@E%@EU5N&e \n &e (n Nf&e m%4 IN&e \n &e (n Nf&e m%  (Ne& r  ff eee@ 4t@t"4 4t p `t_]w N p@ pN `tww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  e ve@ 4tw"w D55ff %f&& "eff&e e &e Rh 55 ww4w5 5 w D5#5ff T %f&& eff&e *ew6&e 6j'44  && ef&& ne&e & Bu%%U w D5_ b.o5ff %f&& eff&e Ze L&e 6j8f f ff&e V e 744  && ef&& ne&e & Bu%%UUNw @@m e%fe r  &e Rh 55 3ff `%f&e@ &50c &e Rh 55 3 l U44  && ef&& ne&e & Bu%%&_afffffe e _a&e % _:b_ae_:b  mm@ e@ f& ef&& nefe& Bu%%_a f_4aw @0 0 @0 N c774ww D85_dNe& rq fe Ve4-4-/44  &&  ef&& ne&e & m%%&e r &e Rh 55 eww4w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  e ve@ 4t4-4-/44  && ef&& ne&e & m%%&e r ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& ne&e$& m%%&e$ r `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& ne&e$& m%%&e$ r `Btp$t t"  ff Nef&& ne&e$& Bu%%Uw w r D5#5 5 wTwP4wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& k% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm l% a@ `` e w D a@@m e  w e  aAm HN@`@m &f l%  aN f`f l%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef v% pU4 4  fef v%5 w    6v&  @ppC`p   6@Cwzwtw D p & & ne 4E05Ew78 Ћ P ы A@PЋ w FD:5UE5Hw* _o5uNfe & Bu% _obNe & r  uN s)U5| m- 5 & Bu%St% d r U   & Bu% S U _n @_nw DE%%"5   & Bu% U wv w ^D55@ p  p 3 `t 4 4 4 4 4 ww~w  $5+ l &5e-Ne % &     Rr ww  5f Rr 7~ f Rr 7\wX@ mT7RH%e w  2 $    Rr e-ww D 5 e %w  5 e-w fp qww  N Huww rDCDpC s r wZw FN `twJ ~5 & E        ~5>wlYwfw Net@f se  w6w.w  4U74U744Ae vB7   %z 55 a  a!PE -B%4 w$ u `e vWt vw@ `e @  u%e U? `e 74U? a7 ?U ew dDtE wZw FD5 `t 5N s!w5A vBB-  }ee@ !ۃ `!ւ ` `пm& E%m%w w7*'$!     $ 7& A & BF7!W-}7ةw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_w@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w ԧΧ mw]xw|w h  fp7 (" ^7 7 HwLw 8 /  TZ 7r lh4 X%5#1 f y  4 f y  N yf&x ̥ ̥ 7`57Z7 & y  ̥̋ ̥ %5: & y   5wLw 8ww>w *D CKw ˋ 5 w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff .e A f&A@vee@ 5u 5 @ W-@D Ae Bḁ.@e@- @D@pHe _y̋@pHeA Be vC ̂ x> uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw DCB P  5 , :% & E& ~n z   5 , @ :% & f E ~n  (˥-%0     ,:% &  ~n 8 5E& z   5 , @ :% & f E ~n  wTlpd?Ambiguous command ?Invalid command ?Privileged command lpc> ?Ambiguous command ?Invalid command ?Privileged command Commands may be abbreviated. Commands are: %s ?Ambiguous help command %s ?Invalid help command %s %-*s %s directoryUsage: abort {all | printer ...} allcannot open printer description file unknown printer %s sd/usr/spool/lpdlolock%s/%s%s: cannot disable printing printing disabled cannot create lock file printing disabled no daemon to abort cannot stat lock file r cannot open lock file no daemon to abort Warning: daemon (pid %d) not killed daemon (pid %d) killed Usage: clean {all | printer ...} allcannot open printer description file unknown printer %s sd/usr/spool/lpd%s: cannot examine spool directory cannot remove %s removed %s Usage: enable {all | printer ...} allcannot open printer description file unknown printer %s sd/usr/spool/lpdlolock%s/%s%s: cannot enable queuing queuing enabled Usage: disable {all | printer ...} allcannot open printer description file unknown printer %s sd/usr/spool/lpdlolock%s/%s%s: cannot disable queuing queuing disabled cannot create lock file queuing disabled cannot stat lock file Usage: down {all | printer} [message ...] allcannot open printer description file unknown printer %s sd/usr/spool/lpdlolockststatus%s: %s/%s cannot disable queuing printer and queuing disabled cannot create lock file printer and queuing disabled cannot stat lock file %s/%s cannot create status file Usage: restart {all | printer ...} allcannot open printer description file unknown printer %s Usage: start {all | printer ...} allcannot open printer description file unknown printer %s sd/usr/spool/lpdlolock%s/%s%s: cannot enable printing printing enabled couldn't start daemon daemon started cannot open printer description file unknown printer %s sd/usr/spool/lpdlolockststatus%s: %s/%s queuing is %s disabledenabled printing is %s disabledenabled queuing is enabled printing is enabled cannot examine spool directory no entries 1 entry in spool area %d entries in spool area no daemon present %s/%sUsage: stop {all | printer ...} allcannot open printer description file unknown printer %s sd/usr/spool/lpdlolock%s/%s%s: cannot disable printing printing disabled cannot create lock file printing disabled cannot stat lock file Usage: topq printer [jobnum ...] [user ...] cannot open printer description file %s: unknown printer sd/usr/spool/lpdlolock%s: cannot chdir to %s job %s is not in the queue queue order unchanged moved %s r moved %s Usage: up {all | printer ...} allcannot open printer description file unknown printer %s terminate a spooling daemon immediately and disable printingremove cruft files from a queueturn a spooling queue onturn a spooling queue offdo a 'stop' followed by 'disable' and put a message in statusget help on commandsexit lpckill (if possible) and restart a spooling daemonenable printing and start a spooling daemonshow status of daemon and queuestop a spooling daemon after current job completes and disable printingput job at top of printer queueenable everything and restart spooling daemonr x * ~ J   d  ~       :  Z `  P abortcleanenableexitdisabledownhelpquitrestartstartstatusstoptopqup?/usr/spool/lpd.lockrfopenkillsocket/dev/printerconnect%s write%s: %s: Unknown error@(#)common.c 5.2 (Berkeley) 5/6/86T%'no remote host to connect tounknown host %sprintertcpprinter/tcp: unknown service%s: %s: %s: @(#)printcap.c 5.1 (Berkeley) 6/6/85 %%$/etc/printcaprTermcap entry too long /etc/printcapTermcap entry too long Bad termcap entry Infinite tc= loop Termcap entry too long E^^\\::n r t bf /etc/servicesrr# ,/ socket: All ports in use rcmd: socketconnect to address %s: Trying %s... %dwrite: setting up stderrselect: setting up stderrselect: protocol failure in circuit setup. acceptsocket: protocol failure in circuit setup. /etc/hosts.equivr/.rhostsr/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd(0=VkError 0Unknown hostHost name lookup failureUnknown server errorNo address associated with name: Unknown error %d.%d.%d.%dlongjmp botch longjmp botch /usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d .@Rbn/CWv$>\{<Z ,E_{ 3@Th{$>QjRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator $-5>DJNSX_iqz"PPPPPQNQQQQQ"RLRSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y15=AIM,QUhY]aeimqu} TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 455vdvovxwfwevgwcwsvlvLwu wDvOvXwU5$ /etc/hostsr# 2{X{{{0?li <^ R0R00| K* e7cce761 /   7%  @w :CI j,^   @  > %  8 ; &  &  > x.e7J ,e70 e 7B eC˥- d Ƀ nV A,  ., 8% +:+d X"f+d X"N+d X" B  X" 6 X" ~Wp< r  @ %zl.fe| D$%  R"%5Ne| 0 T) N <  X" ut @]A]@]A]5u7 - )Nffff Ne  & & fe ze5 ( fff @e  %4- u=u=(fef ;% @a0Ne  %,  5 5 ut 50u0/nNefe & fef e  @a0Ne,   %^, u=u=_Nefe& fef e @a0Nefe  & _ _%+__&w >b :  @w=w = 'Y ; 5 qt f @eN >w=w = D̥<"5 AWp @@`e5 ̥> % 5UCeӕ^@@x % @e E  ffef ew %UC % @e ̋ N,fef ew ;(Be %Nff fq Ne & %5uN 0<%@   : :  U 5 45  Z--fe < f - D$% _8 &N - < N1 < w (w(Ne #5 Ne de JeeJ 0<2ee5 J@e  0<2e@Et55 @E5  ; 5fef >&%N > (^@mE@-M@mE%C5 vWp< r f&A@ &%# "   N tt  xH " NeN%,ff %wP9 v"e" N Nfffe $eNe 0<%&ed& fe& e & > w& 5  ! !e" N %fe& >&% '& >% % &e" ; 4 _. e" w%5 _.  _. &! NNe& _. w 7D _>  ( 5 _: Ne #Ne d@&fe $eNe 0<5N,fe e%k%  Wpa"G%'fee % T %@e=@p@0   X"   ; 5 ff >&% @feWpae"f V%%  %N (>7 wX6w D6  fe &% w66w "6 V@f& %5 N %+ &C N[ @f& %_ N @f& z %w5Nfe *%5.f 8%  & < @w P5  r , e Wp< r  w5w 5 % - $%7 x"U1 -" e7>w4w 4d v" Nfe $%-NX"R"f D" ffe $e7 $" Ne N ,fe+ ew64w "4d  NN N N fe $%Ne V % @w3w 3 " N   xX 0!?lp <^ R0R00|> eN%,( (  * N :  M  _b!%,) # fe 8% 5=eNfe  fe D&%  (>z D aE%W N % ^ N   x`aEZ N e"c N n NeN%,,p. e l Nw42e"f Wp`e"Ni N %Wp`"w 1D NF N N& P@ 5 @m %C_D _Rʋʥ ҥ.@e5ʋR 8% =V 8%  jfe  5NeZfe( $%Ne( w1ˋ[u 8%S@e55 @mp %6 ˋy 8%=*fe  5Ne~fe& $%Ne&@tap˥,˥  ˋ˥ _˥ _ *_v /W @_~  &e" <  )5fe $%7 Ne_&ed P@ d6f@&eh@& 9%  R"%4 __&e" <   ; 4_ @  L <___5 9ʋʥ,AWpae"f D$%% AWpa10 AWp@@`a0" ʥ,ʥ  %ˋ_w |.(@N wp.Nfe < Ce e ˋD fe <e w . De t4 tt 4 4 Ne&& %% w-  eu @w- w -_w-w |-D p f <e  f < N& <  6w*-w - F  ( 72, ;w]w,w ,  (>7 7 w,w ,  ( 7 r^1 D&%5#f   wf  5=  f  N  7727&   ̥̋ ̥ %&2&    2w+w +D CKw+ ˋ 5 Zw +hw+w +D      + - ̥9 Wp @@`e̥0  w:+w "+DeEE&E&E&(2 $e (2w*}wZ*WwT*w *DC AupB 4  & 9%b &5% 傎& 9%`@ @m A F &@wV*  w 8*Vfef C%5 w$* ]w)w)w *D 3 "BEtU4 4t w)w )D  = & & % @5 f& %Uw)w t)DC 5 Ԕ B- B-@wR)w >)D Lԋw6)w ")N  zw )w )D el&&&&Wpef WpefR:2 $e:2w(w (5 5  AaAE f&A@vUU5u %w(w r(D zwh(̥/ 55 0<&f e %Nfe < fe ; fe ; ԥ.̋De & L" & ; %fe0 ;% > %,@e05e wBNe$ w4Ne( w&%r_* _*% _*%2_*WpfWpeme, _*@e\5 N f&tZ2\2e - @ E3"8 - *te95.N f&@.e@.A Ep@.A Ep -& s9 -39 "8_* - t-9_* -977te95  e97h - _.@e97Hw % Nefe P#w%7 XAWp@7 7  f # 9 < 977 w L%7 7 N7 L7 L9 < 977w.%w % l$̋      2  w$w $ ^ @55  w-w-x  t 9 -Z  t5,Z2 5,\2 -0 !8ue9&&fe Xe3 e9pe93w"$w $& f ew#w # :Q@f& <e5uQ@f& je5uumumu _& eeQu  %QQ eu % ff et ff e5u< ff ^et< ff eL A@e@ f& vet e  =  r  rd > r 8 8 rd ( AN 5 8u 4  AN f&A@ 5u r  r   AN @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttwN!!w aw w .!u@t52:54:@ 5:Nefef %% (3A@u5Btr4:22:@ Aup: fef %% u-u-u-@w w v  fe P#@wh @pHA@tww 0  l$!,& 8%   w 1&: D$%7˕,:Nf # w D H !     +  we% - r<N r<&@&: $e: ~ ~w  Nef $ ww D 5  = & V%% `5ȥ=  = @we  w  BuNefef C%=@@wbЋ Ћ  Jҋ~ @@W f r @  W f r@  @ wBSw<mn%lw$ e& 7 67.gww nNff 8&ewbwyw&  4  b '     ` TW ~  s`K6!  w D85U5_(5P_( > m4@e4 ,5Ne & @  uN @4USt%J5V =5b =5& & ;% 45@e-4  % U5EU  wE w pD h +   r= wB wR5 a U5ff ;%ށ̥a &  ;e 3     U̥r 33w   uff Xe55 D.;fe& 9%e.<  .<(;& 9%e*;& 9%eV<@A@ 7rn5%  V<R& 9%mDm@  $;ww D@et5r%=r D b + 7;$ F   wHe =r r̋=rNet < Net <e  @et5Net 0<5&f 4% , ,7 $ nw DC .  + 7%B F . 2!f n9%    w<u5&f %  ,7 | w 4$ @  w5 4@E%@EU5N&e < (&e ; Nf&e ;%4 IN&e < -&e ; Nf&e ;%  (Ne& @  ff eee@ 4t@t"4 4t > "B_+w N >@ >N "Bww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  3 ve@ 4tw"w D55ff %f&& "eff&e e &e 6 55 ww~jeC ff e5u4 t "-t t"  ff ef&& ;e&e$& ;%%&e$ P@ `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& ;e&e$& ;%%&e$ P@ `Btp$t t"  ff Nef&& ;e&e$& C%%Uw w r D5#5 5 wBw>v 3 "B 4 4 4 4 4 ww~w  $J5+ &5e-e %: &     @ ww  5f @ 7l f @ 7wX@ mB7@J6%:e w       @ e-ww D J5 e %:w  5 e-w (> ?ww  N Cww rDCDpC @ P@ wZw FN "BwJ ~5 & E        ~5>wlYwfw Net@f @e  w6w.w  7 N  ,7 7 wLw 8 * & ( 7 l < D&%5#f \G  f \G N Gf&|nf ̥ ̥ 7NN=7H& \G  ̥̋ ̥ %t=& \G   D=wLw 8w0w>w *D CKw ˋ 5 w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff .e A f&A@vee@ 5u 5 @ W-@D Ae Bḁ.@e@- @D@pHe _G̋@pHeA Be vC ̂ xuuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw DCB P  5 , :% & E& @< z   5 , @ :% & f E @<  (˥-%0     ,:% &  @< 8 5E& z   5 , @ :% & f E @<  wT/dev/console (-3 J fr  ( 0#*18?/dev/log/etc/syslog.conf/etc/syslog.pidUNUSEDFILETTYCONSOLEFORWUSERSWALL/cannot create %scannot create %s (%d) syslogudpsyslog/udp: unknown servicebind/dev/klogcan't open /dev/klog (%d) w%d off & running.... readfds = %#x got a message (%d, %#x) selectklogrecvfrom unixrecvfrom inetusage: syslogd [-d] [-mmarkinterval] [-ppath] [-fconffile] /dev/tty%.15s vmunix: logmsg: pri %o, flags %x, from %s, msg %s Logging to %s %s <%d>%.15s %ssendto (ignored) %s /etc/utmpr/etc/utmp Message from syslogd@%s at %.24s ... /dev/12345678cvthname(%s) Malformed from address ???Host name for your address (%s) unknown -- MARK --last message repeated %d timessyslogd: %ssyslogd: %s: error %dsyslogd: %s: %s%s syslogd: going down on signal %d going down on signal %dinit rcannot open %s *.ERR /dev/console*.PANIC *X %d %s: %s%s%s, syslogd: restartsyslogd: restarted panicemergalertcriterrerrorwarnwarningnoticeinfodebugnonekernusermaildaemonauthsecuritymarksysloglprlocal0local1local2local3local4local5local6local7cfline(%s) ,;, ;unknown priority name "%s" .; ,;.unknown facility name "%s"unknown host %ssocket/etc/servicesrr# ,/ %d.%d.%d.%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecrvmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMTJR\v&8DZfr  ( @ M c r ~  , = \ }  5 T d {  ' H j    2 H j | 5RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired zwlYwfw Net@f e  w6w.w  XFU7JDU7@F>D6Ae vB"7 $  % 55 a  a!PE -%D w$  `e vWt vw@ `e @  %~e U?ll `e 7ZDU?N a7@ 8:?2.U ew dDE wZw FD5 ( 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `jm4& E%&m %w w7*'$!      7& A& BF7!pW-7\swapon hasn't been implemented under 2.11BSD.,PP0:Al~ Q R0R00{ A  e7cce7 /   7%  *:w d= %@-dF e%%  4  *:@7%7 ( . *:  5        *:w& f $ ef %  d e`  7  v f b 5  4  *: & f eNP @#%N R8 % 5 . *:   mj@ f&f eNP @#%N R8 ,6 _ 4e_~ % 5 | v m@ f&f eN e > + 6 m6 m4 @ f&f el A@ EN # ̋ %N R8_>w 85 5 %  _ _ 5   m@ f&f $ ef % l  j d m@ f&f $ efef %N 8 &  "     @+     7 w   ee@ 7 w B- @- ; @]   ,  | z mn ml @ 7r wp 5u5 5  fe   @t  w.7w 7 Z6&f / ee ;& H6 & 6 N& 6 w6w 6Ne P" . *:`f   &  &  $ efe % 8   5 u  4 w>6w $6Pf & %   R8Pfe @#%  R8Ne vw5w 5@e5 5  Nf !%f \ & t f %fe % 8 8 6 Nf !%f & t    $ eN@ & ,ef& e %  tf %' . 8 8  Z & % 5N f 4%N R8wZ4f % r@7Bw *4 5ze % 5_ & f e@ el@&@ &P@ &B@&@&|f 4e  lf 4%? A@ ȕ 3@5&@ A@,@ % A@ EN@E&N j6 N R8w3w 2 Nf 5 5N . *:@w2w 2 Nff 5%5 . *:@w2w 2N fff 6eu5 W  . *:A@wP2w <2Nf N . *:w$2w 2Nff .=%@- . *:w1w`1w 1   & f %%7 N  w1& fe %uu@e5ffd e55 @&  @ppC`pLw 0 @e5ff %w0w 0  p  Nf "% nf  &    N *:w0w z0 @e5ff Z %wj0w V0  Nf "%  N *:w00w 0 @e5f w0w /   Nf "% f  &    w/w / @e5f ( w/w / *  Nf "%  wj/w V/  wP/w 87 : f r H6 r7*7$ w "7 7 7 7 r H6 r77w|"w h"T B!̋      2  w:"w &"  @55 4 w-2w-*  t & -   t5, 5, - ܯue"&&fe Xe3 erp6er3wp!w \!& f ewH!w 4! Q@f& e5uQ@f& e5uumumu _eeQu  %QQ eu % ff &et ff `e5u< ff et< ff (eL A@e@ f& et e  =  r  rd > r 8 8 rd ( Aj 5 8u 4  Aj f&A@ 5u r  r   Aj @mAm@ 5u e4 tWpe:u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw!ww De LN Z64eeT   Z64e Be v Nfe :#%ww -@ wN !%w  fe & @w @pHA@tw w  B!!,& "   wj 1& !%7˕,Nf w "D |  !     +  we% - r<N r<&@&+  !e ~ ~w n Nef \! whw TD 5  =<& ("% `5ȥ=  = @we  w  BuNefef =%=@@wЋ Ћ  Jҋ~ @@&wW f r @  W f r@  @ w @5-E@BepNff =%5N 7@U@0 @0 =  Nff =%5@5 w@yw&  4  b '     ` TW ~  s`K6!  w D85U5_$5P_$ r mh@e4 ,5Ne & :  uN ;4USt%z5 75 75& & 5% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff 5%ށ̥a &  6e 3     U̥r 33w 4$ ; w5 4@E%@EU5N&e H6 X&e 6 Nf&e 5%4 IN&e H6 ]&e 6 Nf&e 5%  (Ne& :  ff eee@ 4t@t"4 4t 8 L<_&w N 8@ 8N LeC ff e5u4 t "-t t"  ff ef&& 6e&e$& 5%%&e$ z: `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& 6e&e$& 5%%&e$ z: `Btp$t t"  ff Nef&& 6e&e$& .=%%UwD w 0 D5#5 5 wrwnw  @ a@ a@m5A a@5w D 5# aB- f a@m& 3% w e aC-w ^ D@ A 5@u@e@ 5u   w, uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l8 @Et5lX 5lZ u te%w L D5u-5 w2 @e@- @ a@ a@ a5@ a@@@m`&fNm 64% a@ `` e w D a@@m e  wj e  aAm HN@`@m &f 64%  aN f`f 64%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef =% 7U4 4  fef =%5 wZ    6v&  @ppC`p   6@Cw8w27 Ћ P ы A@PЋ w FD:5UE5Hw* _75uNfe & .=% _7bNe & :  uN ;)U5| m- 5 & .=%St%  : U   & .=% S U _6 @_6w DE%%"5   & .=% U wv w ^D55@ 7  8 3 L< 4 4 4 4 4 ww~w  j$z5+ &5e->e %j &     >: ww  5f >: 7 f >: 7wX@ m7z%je w       >: e-hww D Tz5 e %jw0  5 e-w R8 9ww  N 4=ww rDCDpC ; z: wZw FN LwlYwfw Net@f ;e  w6w.w  0U7.U70.Ae vB7   % 55 a  a!PE -%. w$ = `e vWt vwp@ `e @  =%HDe U?22 `e 7 .U?ݔ a7 ?U ew dDE wZw FD5 L< 5N ;!w5A vBB-  }ee@ !ۃ `!ւ ` `0mZ& E%LҷmF҇%w w7*'$!      7& A& BF7!W-A7w 8uDAB %u f& & e w5 5  W- W00~u5  .lurBw* J@B |_?@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& j6 z   5 , @ :% & f E j6  (˥-%0     ,:% &  j6 8 5E& z   5 , @ :% & f E j6  whqy!%)-159=AEIMQUY]a_dumpdev_dumplo_time_panicstr_physmem_boottime_versionusage: savecore [ -d ] dirname [ system ] Can't find device %d,%d /dev//dev/%s/unix/unix: dumpdev not in namelist /unix: dumplo not in namelist /unix: time not in namelist /unix: physmem not in namelist /unix: version not in namelist /unix: panicstr not in namelist /dev/kmemDumpdev is NODEV rCouldn't fdopen kmem runix version mismatch: %sand %srdump time is 0 System went down at %sDump time is unreasonable Time was lost: was %s -- resetting clock to %s /minfreeDump omitted, not enough space on device rbounds/unixunix.%dcore.%dSaving %D bytes of image in core.%d Readboundsw%d SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/usr/adm/shutdownloga%02d:%02d %s %s %2d, %4d. Reboot after panic: %s readlseekwrite/var/run/devwarning: %s????rrnlist: sym 2 big SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d~*6HZlx >M\t$C`q " R i ' C [ |   0 C R f |   2 T i RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator , h        # ' TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired ::>d>o>x?f?e>gt?c?s>l>L>u>D>O>X?U0QBl- L| ~ R0R00z Ex e7cce7 / v  7%  :w P= n  r7D< 7 B%_@-_e _ v_ LD T .%_d L_w< (_ :` f_ _ _ Hl <<f c *]  W  Q N K  FWp @AAmA@`e7|6 3 0 - *%@  4  : W@ 4% : @@mȋ?@@m0 Fނ x x% - 4  : ew% ? 4  : ew| e _@ȥ-_S @Q 4% :@  _Ne  0 2 j\eeee-LJSˋO˥L5 @mȥ?  % % : r v7 1` 3 &0 0 3&003&003$&0$0$3,&0,0, e4   R_ &! { $ 55 N 5(Nfe e -$} $ 5  :-Neee-ˋ˥ N4 ee4  N >8    &! F  :7&7&7z&7l&7^&7& @e0 5 0#eee-  r45 4f e  f *: 55 (eee- r45@t@m@t@mp   _5 @t@m@t@m& u u-AWtAm@e4@t@m ! u@t@mf&@t@m u-ˋ˥3 53,&3$&3&3&3 &5& e0  w 6 H  - ' $$e$  2pC&2&2 pC&  `e -ЂwJ6w 665& >e 57  C5@7& e 7&5 &5&  e N77&5uaF% 7t&5&5&  e7^&5 7F7J&55&5&  e 5 uu& @e  5,uuW@&5,& e f ^5$uuuuW@&5$pC& e w4w 4  N5 uWpC& N5 WpCA&# e 5 50,  C5 @5&1 4e w&4w 40  9  : wNf $ 5_ NP  _ % k̕? ̋@e!@e!ԕ? @e!Deԕ*@e! N |f&f * ee@ 5u@@ 55 N |5u "Ne ffff 5pC&f_ e_ DeN _ 5pC&2 2 ffff 4*ef& &222 u27b@7ZNe v5ffff )ef& &@0$0$ffff )ef& &77@ N |5u 5&@0 0 7 u7N |5u 5&@007\ u7NN |5u 5&@007* u7 5&@0,0,7 u7N fe (e%_ N >8w0w 0Nf v  w0 w 0@Ap, Nf  @ A@ wd0 @ Aw <0N @Aq 5N @Aq 555   tw/55 w /@0$A1$  > 2w/@0$A1$ w /@0$qrqrW@5@0$qrqrW@555   w /55 w .@0, A A5@0, A A555   w.55 w `.@0,A1,   wB.@0,A1, w .N 5N 555  r fw-55 w -w-@0VBl+ L| ~ R0R00z01w -l $ 5CVNe v7xu7nt 7:57254 7.57&547"575475754,7 5754$N4fe (e%N >84 $ 5,5  N  e Ae P~ Nfe (e%N >8wz,w f,    v54eee-"ˋ˥ˋ-t      e4 ܂ w+ l#5%y1  A1` 3 &@0 0 3&003&003$&0$0$3,&0,0,  %  N H D l#5w +@E55 A vu  A@v5u A@w*w *N "%w*w * 7 N 5w*w *-L N 4% wz*N  vw V* V $k &e$ !% L Jw&*w * 5 s-  @w)w )7 7 7 7 7 7 dw)w ) e *: 7rpe7f ^Z7T7NLHFB D B:e44wp)w \) *:  7 40w:)w &)7 F5 C5 _@t55` ˋ% t5`A rOueOw6 mee7 C5 8 e %O  %'7z7t p n> 7ZT mPe4# % ˋ% ( B  5 CҔ % ʋ@ `-O $ w'w.'w 'DC AupB5 S  "̥ ;  & ӄ V6 %;  7  & 3%bb& ӄ V6 % ₎& 3%`@ @m A &@w&  @w &   L  w& 5 ff L% 50  8 w n&  uN F65&f %5wB& Z5  Lf 6 N 0   w % p  @e5ff l%5w% 5  w-   4 w n%  5  &  %%7nwB%  6|5+f $ 70 w $ w$w $ t  w$ww $  &7   >87 w$w $ww$w $  @ E w|$ l#5% %~ "%   F"- 7L0& 7>3&  $7&6&  $79& 7<&  7w?&  7wB& 7E& 7H& 7_0w N#r  wH#  7 P +F +55 ff& e55  D& 3%e& 3%e& 3%e& 3%e7w B"  _ K 6_x_W5 & f 5%5=( 5u fff 5e5 #u 1f 5%50 :=N 8w!w x!D      + - ̥9 Wp @@`e̥0  w2!w !D5 5      + -! ̥9 f& ff heee@ ee@ 5u̥0 A@  w A@ww t DC AupB 4  & 3%b l#5% 傎& 3%`@ @m A &@w  w fef >%5 w w %Vw(w t7WpwAwpAmu% Nf  @m5uBmB-"C-Dm5TD-um@5@- w tӁNff ZmRu-Bm@ B-т̒(C-Lw  @@5@ @ vwpAmDu-6B @5  N C! 5ԒS DCfU`C-f NmD5D-/+D-!Cm@5&@5%3-f  5u0B555R DD-N& m-N&  -_ww D Lԋww DC H w5 74@  55@- 7 5!w vu@t5( 5* @ 5 Nefef "% (3A@u5Btr* 2( @ Aup  fef "% u-u-u-@w ~ ~w  BuNefef >%=@@wjЋ Ћ W f r @  W f r@  @ "lwh e& 7 7gw:&  4  b '     ` TW ~  s`K6!  w 0D85U5_$5P_$  m@e4 ,5Ne & :  uN :4USt%5 75 75& & 5% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff 5%ށ̥a &  5e 3     U̥r 33w 4$ : w5 4@E%@EU5N&e 46 &e 6 Nf&e 5%4 IN&e 46 &e 6 Nf&e 5%  (Ne& :  ff eee@ 4t@t"4 4t 8 8<_%w N 8@ 8N 8eC ff e5u4 t "-t t"  ff ef&& 5e&e$& 5%%&e$ f: `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& 5e&e$& 5%%&e$ f: `Btp$t t"  ff Nef&& 5e&e$& =%%Uw w r D5#5 5 ww wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& 3% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5ll@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm 3% a@ `` e w D a@@m e  w e  aAm HN@`@m &f 3%  aN f`f 3%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef >% 7U4 4  fef >%5 w    6v&  @ppC`p   6@Cwzwtw D 7 & & 5e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _75uNfe & =% _7bNe & :  uN :)U5| m- 5 & =%St% V : U   & =% S U _~6 @_6w DE%%"5   & =% U wv w ^D55@ 7  8 3 8< 4 4 4 4 4 ww~w  `$5+ &5e-4e % &     *: ww  5f *: 7 f *: 7NwX@ m7%e w   z    *: e-^ww D J5 e %w&  5 e- w >8 9ww  N =ww rDCDpC : f: wZw FN 8wlYwfw Net@f :e  w6w.w   U7 U7  Ae vB7   % 55 a  a!PE -%  w$ < `e vWt vwf@ `e @  <%>:e U?(( `e 7 U? Δ a7 ?U ew dDE wZw FD5 8< 5N :!w5A vBB-  }ee@ !ۃ `!ւ ` `&m& E%ɷmɇ%w w7*'$!      7 & A& BF7!W-E7& & e Ӌ  &7& e ӕ-|ӕ0B~hӕ.  ӕ0~ B~&7< & Le "ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_@@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& V6 z   5 , @ :% & f E V6  (˥-%0     ,:% &  V6 8 5E& z   5 , @ :% & f E V6  w&w Nefef 5& Ce C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& Deww  fff 5& Deww  5 %O N  =  555Ne5& Ee5l 55'0Ne5 B& Ee57D Be0" 5%l 55 5 B5@B e a=% 7 w %l 5 B5Ne& Ee55e0%l 7`Jʕ0% ʕ1  % ˕0 ʥ9 6@~ nnnnnnnnnn"@h.4LXd^Z*/usr/adm/usracct/usr/adm/savacct-U and -S options must be separate Invalid option %c Missing filename Missing filename Invalid option %c /usr/adm/acct***otherwwCan't save %.14s %-8s%-8u%7u %9.2fcpu %10.0ftio %12.0fk*sec %8.0f%9s%8.2f%%reu/suscp%8.1fre/cp%10.0favio%10.0ftio%10.0fk%10.0fk*sec%11.2f%s%11.2f%s%9s%8.2f%%Only 1 file with -s rCan't open %s %3u %6.2f cpu %8luk mem %6ld io %.*s rrCategorizing commands used %d times or fewer as **junk** **junk**%.14s--%04xPreposterous user id, %u: ignored /etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired  l l ?d?o?x|@f@e|?gV@cb@s?l?L?u?D?O?X?U=(\0gCln l n p r t R0R00y  > e7cce7  / f  7%  ^w % @7B :  5*  ^  8  n   z 55%  ߔ z 5% %y  ^ n r f e  r  ^w w    ^w w v fef & %5 wb w J D LԋwB w . De LN 4ee <  4e Be v Nfe %w w -6@ w N n% w v BuNefef & %=@@wJ yww 0 D85U5_5P_  mv@e4 ,5Ne &   uN < 4USt%z5$ "5  "5& & % 45@e-4  % U5EU  wE w D5"E@e44fef & % "U4 4  fef & %5 wz wwЋ w FD:5UE5Hw* _5uNfe & b % _bNe &   uN < )U5| m- 5 & b %St%   U   & b % S U _ @_w DE%%"5   & b % U wv w ^D55@ "   3 4 4 4 4 4 ww~w  $z5+  &5e-e %j &     r ww  5f r 7` f r 7wX@ m674z*%j e w       r e-ww D z5 e %j w  5 e-w  ww  N h ww rDCDpC <   wZw FN wJ ~5 & E        ~5>wlYwfw Net@f 6 e  w6w.w   U7 U7  ~Ae vBj7 l  b%\ 55 a  a!PE -$%  w$ <  `e vWt vw@ `e @  < %e U? `e 7 U? a7 ?zvU ew dDVE wZw FD5  5N < !w5A vBB-  }ee@ !ۃ `!ւ ` `m&& E%m%w w7D*'$!      7& A& BF7!bW-7Nw 8uDAB %u f& & e w5 5  W- W00~u5  .lur Bw* J@B |_ @  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w0lClq l n p r t R0R00y@(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)rxformat.c 5.3 (Berkeley) 8/18/87Format %s (y/n)? Formatting %s usage: rxformat /dev/rrx?? : Unknown error: %d|(4FXjv <KZr"A^o Pg %AYz.APdz0RgRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator  d o x f e g c s l L& u* D O X< U0pDl_@{, . 0 2 4 R0GR0G0x c e7cce7 / @&  7%  NZw ]4 )%7  l n= & @ ? a7 7 9ff N %5%" 5`Nefe& p% P &  X] ~fe& $e ` & <fe& $e ~ & Ne w\\w H\&  .:   .:   .: @ #A1%  &  NZU v555 Nefef& <e G D@e5@e5 Nf <% e Ne &%Ne& f& $e   &  NZ@%%@f& f%) &% NZ< 5 fe0& U%5% L & & 4$  NZ0 AWp B0`eu C0Ne0 5 U &  NZ% o &  NZN #A1ff *%  &  NZNfe C%5o tN * bffe2 <%5ERNe2 B5<Ne2 &% v  NZ)@ N@f& %& &e  v  NZA1`fe@& S% u @f& @%5!fe %)fe %1fe % Ne 59 v  NZ@ 8 K 8 @ "Nefe@ & f Ve M v  NZ@  a 2n v  NZ R]% _j Ne   v  NZ 5% v  NZu-uu _6  X X XN Xfe Z  C r vf&A r t@aUU C r vf&A r t@aUUNe~ff &[euu & & fef #e _0  C r vf&A r t@a&50-fef U%  C r vf&A r t@aEE@f   C r vf&A r t@a&5097 ~fef U%5f 4$  C r vf&A r t@aEE Nfef R]% C r vf&A r t@a&5_(0_( C r vf&A r t@a&5_(0_( NZ 3& $ N XN Xf  N X@@ #@f B @ $*:@& N&%9@& N&%f N&%/@& ,= 5 @5 L@ Neffe& &e fef@& :e@ 2 NZwrSw ^S@e5 &  N ffff  h-b\ X7 %:f = (: 2 , nf n n v n v ?wP ̥:7 *+  w-  nf n  @m7P / @  9 E5 @@l wHw &PDC E5<E@e33. @;E  5 , @;% & fE V 5  XU3 3  wxOwNw ^OD6  PV PVe  b  6w"Ow O r B0 0@ 7^X Uw]wNw N B< vX7 47 wNw N " D0 0@ 7 h ^>%5#Ff   wP If   ̥ ̥ L&  5=  7 7  D ̥̋ ̥ % O0uDlS@{, . 0 2 4 R0GR0G0x&    wMw MD CKwM ˋ 5 vwMw M"5  @ @ap t- 5N m& PV)%NRn T% rNef $x 2wM@ @a0  m  w L  0@ 7xr UwLw L b\ vX7 TwLw LDC  ̋̋wLw pL "  0@ 7 E ^>%7p:& > 7`:& >  7JF:& >  & >  %,& > ̋ wKw@KZw:K*J w$Kw KR z*5N B5N wvK}& +%5u?n T GNf 2%@5fe@& T%u fef *e _N X%0 Ne 5%  2ff V*%%=n %N :$ @ <Dff %n T%w 2A1`@fe@& T%ff %n T%N Rf R]%5 N ~V ff R]%N ~V f f R]%N ~V f f R]%fef U%%_rN 2 N XN X_,Ne 5 f # Nfe <%Ne ~V &fe A &fef XHe% 2Nfe Z  C r vf&A r t@aUU C r vf&A r t@aUU7 0 & & fe #e%  C r vf&A r t@a&50 n T  fefef #e5N X J 25 _}N #5%%%_Qn T _zfef U%%_zfe R]% _zff &%@_nw G5 5   3%5+N #5fef T% %0 %N X r@N XwFw ~F|DCe%@5̥.e ̋  } 0@ 5 Nff fef e N vX QN vX%G  A5 N 5|8fe| lV fe| 8V fe| 0@ 5Ne~@ & Z  @|p-5N vXwDEw 0EBN@fe ^>% YDe̥ ̥ ̋e  ̥ ̥ ̥  ̥ ̥ 5̥ ̥ ̥ ̋ 5 N fef |% NNf PV wrDw XD% Nf PV_NWNff V=% KNf PV@@mȋ= : +A # %)7. = 7 ~z e ̋@@m P PV wChwCw zC    L  wlC j 5 ff L% 50b  8 w C  uN ~V5&f %5wB 5  f PV  0   w B p  @e5ff l%5wfB d5  w-X `  4 w B " U  &  E%7wA PV5f 0@ 7 w A BwAw A t  wAww tA | G7 t  pj vX7 bwZAw FAwwLAw 8A  D >@ E w$A$ >5% %   ^>%    =  & 7& & 7& &  7& &  7& & 7& &   7twr& &   7bw`& & 7H& & 7:& & 7,_w ?  w?  7  K K55 ff )e55 D & T%e& T%e& T%eJD>8& T%e7$w >  _ PV__5 & f U%5=  5u fff (Ve5 #u 1 f U%50   := HN Xw4>w >D      + - ̥9 Wp @@`e̥0  w=w =D5 5      + -! ̥9 f& ff 5eee@ ee@ 5u̥0 A@  wD=A@w<w =De LN ~V4eye-  |  ~V4e Be v Nfe X>%w<5 7 7 5 #77 0@ _"_#fe V=% #Ce  ˥ ˥ ˋm <%7  = Z X fe V=% L%HCe  ˥ ˥ ˋ: Cf&@t@t  ,@t0 0 @t5 #AWt1 %fe ^>% _!%w vXfe #.fe =   lV % B< <%5 ˥. ˋ . =   %%U w:Ww9cw9jwv9]wp9w 9Nf $ w9PwT9RwN9wH9iwB9w 9Nf .$ w9~w&9w 9w 94De _% t4 t t4 4t Ne&& ~=% _%t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 % 55 Nefe =% & 2%5u7  && ~=%  fe =%ff % fe& ~=%wB8A@E f& w 8w8w 8DC2``Hԋ w7``A@w 7DCB 2 @mAmHԋ  @mAmA@w7 ы ~ w `7D LԋwX7w D7DC  w875 7@  55@- 7 h5!w 6 @e5ff '%w6w 6D5 NP # &%EAEt =_)J5]Ne :Nh fej <%CaejNe L/m Aej@ 3e`5 h `"X T Nw  <%`58  z  <%` ӕ:ӕ Bej%_)mo N |3  <%` 5 Nfej =%`Aej@55 *@e`5^}^f@ej@A^1e^ ^@^fe` X>%n  JUD )%6Nfej$ R]%@-`R ffej 3e O5K 5h%D 4  U%5 fej 8V e>fej =  NAej@f R]%N X X] & fh 4>%%%w4w 3D wDw< 572%$<> V <%5,  3%7% > U 77%' 2%%T *%% Xvw 3w 3b XX7tw3w 2DN 7Fw2bwX2w 2N L/ +w2w 2D el&&&&Wpe f Wpe f d  r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpe u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 a ttw*!wj*\wd*w *De LN ~V4eb e| |3  ~V4ee  Be v Nfe X>%wl*w X*-@ z wR*Ng \% <%\%ew)aw)w *w@7% ?@w*N f 3w )DC_r9̥%_X9 5 r yD _X9 9% 5afe & T%5@e5 5N 9 _p9 5,N 9 _p9 w6) 3_p9 3_p9 3_p9  9% _p90 9% _p90 r  r f 9% _p90 9% _p9  9% _p9  r  r f 9% _4_p90 9% _4_p9" 9 _4_p9% 3_4_p90 9% _4_p97 3_4_p9@ 9 _4_p90e r& 9% _4_p90e  @ r& 9% _4_p90 9% _p9_4B 3_p9_4 _4 9 _p9_4 _.4 _44 _X9 _4% _4b_4fe &, T%5@e5_4 _X9 _4 _R5 _X9 _4 _n5 _X9 _5 _5 _X90 el rdf 9% _p9_4 _ 6 _X90 9% _p9_4 _&6 _44 _X9 9 _p9_4 _5 _P6 h_,7 _5 _4 Y% _5_5 _~6 G0 9% H_4 _&6 _4 -+ 32_4 ! 0 el 9% _4 _5 _6 _<6  _4?  ̋_ 4_4w R$~%A r e0@ A r 5   %t% @  L %t%  9w$w #D w# v p l?h݀e& ;ew.#w #u@t5~%5%@ 5%Nefef =% (3A@u5Btr%2~%@ Aup% fef =% u-u-u-@w#w " fe &;@w" @pHA@tw."w " B<!,& =   w" 1&>& <%7˕,>&Nf ; w F"D L !     +  w"e% - r<N r<&@&>& & ~ ~w ! Nef \< w!w x!D 5  =8& V=% `5ȥ=  = @w*!e  w ! BuNefef ^%=@@w Ћ Ћ   Ћ Ћ  Jҋ~ @@Swmown=lw e& 7 7gwtٖBfI I7Iw  BuNeff ^%=@@ww  fff R>ewwyw&  4  b '     ` TW ~  s`K6!  w D85U5_@5P_@ 0 m&@e4 ,5Ne & Z  uN ,[4USt%V5b X5n X5& & U% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff U%ށ̥a &  (Ve 3     U̥r 33w   uff e55 D|&fe& T%e|'  |'v&& T%ex&& T%e'@A@ 7r5%  '& T%mxmt  r&ww D@et5r%=r D T E 7;l P` D \ w|e =r r̋=rNet PV Net PVe  @et5Net ~V5&f 4%  G7  ԰w DC . r E 7% P` b 2!f S%  Z  HԀwpu5&f % (n G7 f w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @ W-@D Ae Bḁ.@e@- @D@pHe _C̋@pHeA Be vC ̂ x uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ ,[ w5 4@E%@EU5N&e lV 4&e 8V Nf&e U%4 IN&e lV 9&e 8V Nf&e U%  (Ne& Z  ff eee@ 4t@t"4 4t X p\_Ew N X@ XN p\ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  M ve@ 4tw"w D55ff %f&& "eff&e e &e bP 55 ww~'w5 5 w D5#F5ff T %f&& eff&e *ew6&e FR'44  && ef&& (Ve&e & R]%%U w D5_Jvo5ff %f&& eff&e Ze L&e FR8f f ff&e V e 744  && ef&& (Ve&e & R]%%UUw @@m e%fe Z  &e bP 55 3ff `%f&e@ &50c &e bP 55 3>n T U44  && ef&& (Ve&e & R]%%&_Jfffffe e _J&e % _JJ_Je_JJ  mm@ e@ f& ef&& (Vefe& R]%%_J O_DIw @0 0 @0 N K77'ww D85_ MNe& Zq fe Ve4-4-/44  &&  ef&& (Ve&e & U%%&e Z &e bP 55 eww'w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  M ve@ 4t4-4-/44  && ef&& (Ve&e & U%%&e Z ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& (Ve&e$& U%%&e$ Z `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& (Ve&e$& U%%&e$ Z `Btp$t t"  ff Nef&& (Ve&e$& R]%%Uw w r D5#5 5 wBw>'wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& S% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l45l6u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm T% a@ `` e w D a@@m e  w e  aAm HN@`@m &f T%  aN f`f T%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef ^% XU4 4  fef ^%5 w    6v&  @ppC`p   6@Cwzwtw D X & & (Ve 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _W5uNfe & R]% _WbNe & Z  uN ,[)U5| m- 5 & R]%St%b ƾ Z U   & R]% S U _V @_Vw DE%%"5   & R]% U wv w ^D55@ X  X 3 p\ 4 4 4 4 4 ww~w  $V5+ &5e-e %F &     bZ ww  5f bZ 7l f bZ 7wX@ mB7@V6%Fe w       bZ e-ww D V5 e %Fw  5 e-w vX Yww  N X]ww rDCDpC ,[ Z wZw FN p\wJ ~5 & E        ~5>wlYwfw Net@f &[e  w6w.w  'U7'U7''Ae vBv7 x  n%h 55 a  a!PE -0%' w$ ,] `e vWt vw@ `e @  ,]%e U? `e 7'U?˔ a7 ˎ?U ew dDbE wZw FD5 p\ 5N ,[!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7P*'$!      7|& Al& BF7!NW-`c7:w 8uDAB %u f& & e w5 5  W- W00~u5  .luNBw* J@B |__@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w 60 Uw]Tw|w h  vX7 | G7 t7 $wLw 8  0@ 7Զ lʶ' ^>%5#f a  f a N Cf&|Ljnf ̥ ̥ 7N(7H& a  ̥̋ ̥ %(& a   (wLw 8ww>w *D CKw ˋ 5 w DCB P  5 , :% & E& V z   5 , @ :% & f E V  (˥-%0     ,:% &  V 8 5E& z   5 , @ :% & f E V  w@(#) Copyright (c) 1983, 1988, 1989 The Regents of the University of California. All rights reserved. @(#)rshd.c 5.17.1.3 (Berkeley) 9/11/89USER=HOME=SHELL=rshdalnusage: rshd [-aln]getpeername: %msetsockopt (SO_KEEPALIVE): %msetsockopt (SO_LINGER): %mPATH=/bin:/usr/ucb:/usr/bin:malformed from address ip %2.2xConnection received using IP options (ignored):%ssetsockopt IP_OPTIONS NULL: %mConnection from %s on illegal portread: %mcan't get stderr port: %m2nd port not reserved connect second port: %mCouldn't look up address for %sCouldn't look up address for your host Host addr %s not listed for host %sHost address mismatch remuserlocusercommandLogin incorrect. /Permission denied. /etc/nologinLogins currently disabled. Can't make pipe. Can't fork; try again. /bin/shROOT shell from %s@%s, comm: %s -c%s too long : illegal option -- : option requires an argument -- /etc/protocolsrr# initgroups: %s is in too many groups setgroups/etc/grouprrsocket: All ports in use rcmd: socketconnect to address %s: Trying %s... %dwrite: setting up stderrselect: setting up stderrselect: protocol failure in circuit setup. acceptsocket: protocol failure in circuit setup. /etc/hosts.equivr/.rhostsr/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd+DYError 0Unknown hostHost name lookup failureUnknown server errorNo address associated with name: Unknown error %d.%d.%d.%d/etc/resolv.confrdomaindomaindomainnameservernameservernameserverLOCALDOMAIN  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec0 4 mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d ( 2 L \ t ~   0 < H Z i y  # 9 H T g x 2Sj *:Qu@Uh@Rdx RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator^elt~7z77778<8n88889:9SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02dE6E`EE ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired '((_d^o_x_f_e^g_c_s^l^L_u_D^O_X,_U(/etc/hostsr# 0El~ zQ     R0R00w Bj  e7cce7 /   7%  8w <%p  8  %7 $ 8@ f- n- @ȋ e @ȥ-  v 6f 4 Nf &  f 4f 4 Nef N  w";w ;p2   8( 0  8 Y  8 t  8  \4 5n $ 8 J& fn 4efn b4%  vm @ f&fn 4efetfn b4%@t  95v F vm@ f&fn 4e@t fvfn b4% 5 r=@r @mv 4@r @mv ,  v`@ f&fn 4efexfn b4%DDmzex5"] p.e - ru-tr pO x vm@ f&fn 4e@t fvfn b4%5 pe   e    r, 9e    Cx_Nn X7Nv :w8w 8 b7 \@ @. "   4 7 @ _8 xD@55   $ @ !fe !%5.f "  & 4 D  4 w7ff %5u NA@  EfA@  EfA@ r Ef  e N B @e5 @& @&@&@&@&ff ew 65 5 @ _j xN@55ff %u55u  3_ _A@E 5  A@E?   A@B v5uA@@ A 50u0A@CBB C @@5u fe %fe %AE ff %5u BN  4 6 ?A@ h EN;  % A@ @ ENA@ ( Ef>  e w4A@EA@  A -A@  ENA@  EfA@  EfD  e NA@ p EfA@ X EfA@ @ EfM  e N B @e5 @& @&@&@&@&ffY  e_vw 35 uu@& 4  z@& 4  ead# N~   _ @ 5lLfefel@& e5 " 5 | fefe|@& e U U r%N  _ 7 ja r, 9e5(%3x%p  @ A1`@fe@& 2%*Nf f e%  <%  _,   6w  wr1w ^1 wb1w N1    7N $w<1"( T3 0>w 1 N 5  95V T3 8Nf 4 @w0w 0= lf 4& & eBr2t _>  ,N *"5u%%@pp} @f& %  _> N 5u%%& ff eBr2} N >5"=& @f& eBr2N J = _ N 5=@=@fe@& 2%N J = N|( T3% 8w(/w /@eAePPPPPPN F55 uu _ _ _ _ _ _ R %R R  Rwz.fe^ >2% 8feX >2% (Ce & & & & &  e ̥0%5 N F %7fff %f&R e w -Da  xd`L ̋wj-w V-D   3!,, r w,-w -DZ  4 4e  b " 6w,w , <   7(" h4w]w,w ,  67 7 w,w z, 0Elꬂ zQ     R0R00w  7 m %5#f   wpf   ̥ ̥ &  5=  7.w,"7 D ̥̋ ̥ %&    w+w x+D CKwn+ ˋ 5 w H+ff .%5uE A@EW A@ A@E?   A w*w * %W- A@vC BE%A@vC B PP%A@v B P5uff V%5uwwwR*w >*D @e55 5  ̥0 ̥x̥X. 'Ae f&ffff r!e A f&A@vee@ 5u 5 @  W-@D Ae B ḁ.@e@-3 -@pHe _.̋@pHeA Be v@5  @w(5 5  A@v5uWtAaAE 5PuP  5 u ߇A@w z(f  5wd(N0fe Ne%_ %%%  %%%cNe 5uu5 Ne 5u fff e ?f  55D 55444  55@-5e  %( T3 N 6N 6@_CeXN Ne%  @ A@bl@ f&f e Nffe* NeDNe*& 4 4 e   w `&DE5_% _ _5`uu '& & 4e5u%%w% @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & 4e5u %%    b%%%_|5 65 5 E4N ff & 4e W _|%_%__|w L$D 5u5mu A@w0$w $D 5u5 A@w$w #De m@ e@ 5u%% du %e u 5mu A@w#w #D j5u5 A@wf#w R#D%%055  m@ 5u%% e du %umumu 5umumu A@w"w "D      + - ̥9 Wp @@`e̥0  wv"w ^"DeEE&E&E& e w*"Ww!w "DC AupB 4  & 2%b b5% 傎& 2%`@ @m A z&@w!  w z!fef <%5 *wf! w N!D LԋwF!w 2!De LN 54ee@   54e  Be v Nfe %w w -@ w N  %aww t BuNefef <%=@@wH Ћ Ћ W f r @  W f r@  @   6v   6v   6vb"yw&  4  b '     ` TW ~  s`K6!  w D85U5_5P_ h m^@e4 ,5Ne & j9  uN 94USt%5  65( 65& & b4% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff \4%ށ̥a &  4e 3     U̥r 33w   uff e55 D.Hfe& 2%e.  .(& 2%e*& 2%eV@A@ 7r5%  V& 2%mm  $ww D@et5r%=r D  ^$ 7; > D  w|e =r r̋ =rNet 4 Net 4e  @et5Net 55&f 4% :N %7 F  w DC &.  ^$ 7% > b 2!f >2%    wpu5&f %  %7 w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @  W-@D Ae B ḁ.@e@- @D @pHe _@"̋@pHeA Be vC ̂ x uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ 9 * w5 4@E%@EU5N&e 4  &e 4 Nf&e \4%4 IN&e 4  &e 4 Nf&e \4%  (Ne& j9  ff eee@ 4t@t"4 4t X7 :_x$w N X7@ X7N :ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  |, ve@ 4tw"w D55ff %f&& "eff&e e &e . 55 wwjw5 5 w D5#5ff T %f&& eff&e *ew6&e 0'44  && ef&& 4e&e & ;%%U w D5_(o5ff %f&& eff&e Ze L&e 08f f ff&e V e 744  && ef&& 4e&e & ;%%UUw @@m e%fe 9  &e . 55 3ff `%f&e@ &50c &e . 55 3 ( T3 U44  && ef&& 4e&e & ;%%&_(fffffe e _(&e % _(_(e_(  mm@ e@ f& ef&& 4efe& ;%%_( -_'w @0 0 @0 N *77nww D85_+Ne& j9q fe Ve4-4-/44  &&  ef&& 4e&e & b4%%&e 9 &e . 55 ewwrw4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  |, ve@ 4t4-4-/44  && ef&& 4e&e & b4%%&e 9 ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& 4e&e$& b4%%&e$ 9 `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& 4e&e$& b4%%&e$ 9 `Btp$t t"  ff Nef&& 4e&e$& ;%%Uw w r D5#5 5 wrwnvwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& >2% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l 5l u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm 2% a@ `` e w D a@@m e  w e  aAm HN@`@m &f 2%  aN f`f 2%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef <% 6U4 4  fef <%5 w    6v&  @ppC`p   6@Cwzwtw D 6 & & 4e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _z65uNfe & ;% _z6bNe & j9  uN 9)U5| m- 5 & ;%St%  v9 U   & ;% S U _85 @_<5w DE%%"5   & ;% U wv w ^D55@ 6  X7 3 : 4 4 4 4 4 ww~w  ($5+ $ &5e-e % &     8 ww  5f 8 7 f 8 7wX@ mr7pf%e w  P B    8 e-&ww D 5 e %w  5 e-w 6 p8ww  N ;ww rDCDpC 9 9 wZw FN :wJ ~5 & E        ~5>wlYwfw Net@f 9e  w6w.w  U7U7Ae vB7   % 55 a  a!PE -`% w$ ; `e vWt vw.@ `e @  ;%e U? `e 7U?ؔ a7 ؾ?U ew dDE wZw FD5 : 5N 9!w5A vBB-  }ee@ !ۃ `!ւ ` `mJ& E%<ӷm6Ӈ%w w7*'$!      7& A& BF7!W-A7rw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_d>@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w nh h4w]w|w h RL 67 D  %7 7 wLw 8 [  7  l %5#]f ,@  `f ,@ JN *"f&Ԉ ̥ ̥ 7~N7xc& ,@  ̥̋ ̥ %tf& ,@   DwLw 8w&w>w *D CKw ˋ 5 w DCB P  5 , :% & E& 5 z   5 , @ :% & f E 5  (˥-%0     ,:% &  5 8 5E& z   5 , @ :% & f E 5  w4888.jjj`usage: route [ -n ] [ -f ] [ cmd [ net | host ] args ] route: socketadddeletechange%s: huh? _rthost_rtnet_rthashsize_netdata/unixroute: "netdata", symbol not in namelist /netnixroute: "rthost", symbol not in namelist route: "rtnet", symbol not in namelist route: "rthashsize", symbol not in namelist /dev/memroute: /dev/kmemFlushing routing tables: %-20.20s %-20.20s deletedone default%u.%u.%u.%uaf %d: %x %x %x %x %x %x %xdefault%u%u.%u%u.%u.%u%u.%u.%u.%uaf %d: %x %x %x %x %x %x %xhostnetusage: %s destination gateway metric (metric of 0 if gateway is this host) usage: %s destination gateway %s %s %s: gateway %shostnet (%s) : not supported not in table entry in use routing table overflow route: out of memory defaultdefault%s: bad value *.%xH*.*any*%02x%02x%02x%02x%02x%02xH.%xH%xH.%s%s/etc/networksrr# rrnlist: sym 2 big %d.%d.%d.%d: Unknown error: %d"<N`p| ,=Qe 2Lj(Jh : S m . A N b v   2 L _ x RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator###$ ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired zvv=dv=o=x@>fN>e@=g>c&>sP=lP=L=u=Dz=O=X=U@P/etc/hostsr# 0Fl|  R0R00v d l e7cce7 /   7%  w  e f  70     7 5 fe& %% @C _ x~  d f B B   f  re f  7\h  N:t r%NF J%   % >4 r f B d 2 B& B &   re&   f& eu _ B 5   r%N4  7*5 !NNNm& %5 B 8 r  umu-N %5_  B   r% 5  7Nz %5_ J%   %N6_Xf B B `  f N ref 5 5 Nem e _u_   r Nem@ e _N J%   %fe_X @ v r% _ w u5 fNm& %% @@mȥ  %@@@mw w -@w N N 5 K r  wfe& (e ̀%w B ~ @ fof re@ f Je   %w w D      + - ̥9 Wp @@`e̥0  w w D 3 EtU4 4 wN iww 4 D Lԋw, w  BuNefef %=@@ww D  +   r= wB w5 a U5ff %ށ̥a &  e 3     U̥r 33w D5"E@e44fef % U4 4  fef %5 w ww7 Ћ w FD:5UE5Hw* _ 5uNfe & % _ bNe & v   uN )U5| m- 5 & %St%8  U   & % S U _D @_Hw DE%%"5   & % U wv w ^D55@   d 3 4 4 4 4 4 ww~w  N$, 5+  &5e-"e % &     ww  5f 7 f 7wX@ m7, % e w  v h    e-Lww D 8, 5 e % w  5 e-w  | ww  N ww rDCDpC  , wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  U7U7Ae vB7   % 55 a  a!PE -% w$  `e vWt vwT@ `e @  %,(e U? `e 7U? a7 ?U ew dDE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `mZ& E%LmF%w w7*'$!      7& A& BF7!W-d7w 8uDAB %u f& & e w0Flꀼ  R0R00v5 5  W- W00~u5  .lu$ Bw* J@B |_p@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w@(#) Copyright (c) 1983 Regents of the University of California. All rights reserved. @(#)rmt.c 5.2 (Berkeley) 1/7/86d2wrmtd: O %s %s rmtd: C rmtd: L %s %s rmtd: W %s rmtd: premature eof rmtd: R %s A%d rmtd: I %s %s rmtd: S A%d rmtd: garbage command %c rmtd: A %d A%d rmtd: cannot allocate buffer space rmtd: E %d (%s) E%d %s .6@Zj (>JVhw $1GVbu!@ax8H_ ,Ncv,N`r  RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatordoxLfZeLg&c2s\l\LuDOXU0Glt@B ~IE G I K M R0R00v 9nf  e7cce7 / b  7%  ^1w 4 / /  n& % NN +%  h4  n  ^1w*4w 4< + ,B "/@fe * 3>N + _&5Ne 5tL@t& `-a@t 0-r ,B "/@fex *}@tfex D 5v@tfv `- Ne X%Nft  @t X@tft  @t @t z  % w2w 2DC  w2ŀ  T fe& ,% w b27>  , 5,N X% ,% ,% ,f b4%N /Ne 5w1w 1bfe %5  ffe ,%  @f& %&fe ,%  , 59 fe X%fe ,%f ,%fe ,% ,f b4%N / , 5INe  & AA f& Z(ef&f 8-eNefe |- fefe ,%fefe ,%fef b4%N /wT0w @0 De t4 tt 4 4 Ne&& % w0  eu @w /  @m4@m4  %   5  %w 5 !  %w   Wp0`@p<Wp0`@pT % % 4< %0w$/w / @m3l %@5 u H`3 %  AWp0`A<@<m A@x3 %0 WpDtWt@`Wt@`Wt@` @`@`Wt@`,utE4tE4 E4E4 % l,A@xp` %  l %  %_ Ĝl:`3l0` %  @`DHk %@w-w -  4 %B   tE4 % B%@  4 %B B ^%Z%9.  t5Wp`A<uWp`e<fWp`^TWp`qT % %    %   Wp`ABP %e.%9e%Ze` % 4`  ^wf, w+)w+ w+w+w 0,"5  @ @ap t- 5N m& `-)%NNN +% rNef nt w+@ @a0  m  w x+  ~ @ 7 ,wb+w N+  /7 wH+w 4+DC  ̋̋w"+w + ~ @ 7 En n%7^ :& 7N :&  78 x4 :&  & x %,& ̋ pwr*w ^* v  r  L  wP* \ 5 ff L% 50T   8  w )  uN -5&f %5 w) 5   f `-  0   w v) p  @e5ff l%5 wJ) V 5  w-J  R   4 w (   ,   &  %7 nw(` `-T5f @ 7  w ( n w(w v( t  wx(w w X( t n 7 f  b \ /7 T w>(w *(ww0(w (  6 0 @ E w( 5% % ( n%  ( (  7 &  7 &   7 &   7 &  7 &   >7f wd &   >7T wR &  7: &  7, &  7 _ w &  w&  b7 \ " #55 ff pe55  D(| v & (+%e& (+%e& (+%e< 6 0 *  & (+%e7 w %  _` `-_FP_J5 & f ,%5= >5u fff 8-e5 #u 1(f ,%50(( :=(:N /w%w %D   0Gln@B ~IE G I K M R0R00v   + - ̥9 Wp @@`e̥0  w$w $D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  w($A@w#w $DeEE&E&E&Z Xe Zw#w #Bfef &5%5 w# w #Nf t w#Pw"w"w j#Nf  wh#~w"w N#D LԋwF#w 2#DC  w 7@  55@- 7 b5!w "De LN -4e e   -4e  Be v Nfe %w`"w L"-&@ "wF"Nn X%n4e& ;ew!w ! fe &@w! @pHA@tw>! ~ ~w ! BuNefef &5%=@@w`!Ћ Ћ Sw w (! & f ew !w yw w !  ,w]w w  /7  7 7 w w   @ 7x ln n%5# f >   f >  N f&~ph ̥ ̥ 7P27J & >  ̥̋ ̥ %X & >   (ww www D CKw ˋ 5 &  4  b '     ` TW ~  s`K6!  w D85U5_*5P_*  m@e4 ,5Ne & 1  uN <24USt%65B "/5N "/5& & ,% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff ,%ށ̥a &  8-e 3     U̥r 33w   uff e55 Ddfe& (+%ed  d^& (+%e`& (+%e@A@ 7rz5%  ^& (+%mPmL  Zww D@et5r%=r D |  7;    w|e =r r̋ =rNet `- Net `-e  @et5Net -5&f 4%  7 w DC .   7%   2!f *%   ~wpu5&f % Z> 7 6 w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @  W-@D Ae B ḁ.@e@- @D @pHe _̋@pHeA Be vC ̂ x uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ <2 w5 4@E%@EU5N&e |- &e H- Nf&e ,%4 IN&e |- &e H- Nf&e ,%  (Ne& 1  ff eee@ 4t@t"4 4t / 3_w N /@ /N 3ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  % ve@ 4tw"w D55ff %f&& "eff&e e &e r' 55 wZwVw5 5 w D5#5ff T %f&& eff&e *ew6&e V)'44  && ef&& 8-e&e & b4%%U w D5_*!o5ff %f&& eff&e Ze L&e V)8f f ff&e V e 744  && ef&& 8-e&e & b4%%UUw @@m e%fe 1  &e r' 55 3ff `%f&e@ &50c &e r' 55 3N + U44  && ef&& 8-e&e & b4%%&_!fffffe e _!&e % _Z!_!e_Z!  mm@ e@ f& ef&& 8-efe& b4%%_! &_T w @0 0 @0 N #77ww D85_$Ne& 1q fe Ve4-4-/44  &&  ef&& 8-e&e & ,%%&e 1 &e r' 55 ewww4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  % ve@ 4t4-4-/44  && ef&& 8-e&e & ,%%&e 1 ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& 8-e&e$& ,%%&e$ 1 `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& 8-e&e$& ,%%&e$ 1 `Btp$t t"  ff Nef&& 8-e&e$& b4%%Uw w r D5#5 5 wwwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& *% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm (+% a@ `` e w D a@@m e  w e  aAm HN@`@m &f (+%  aN f`f (+%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef &5% "/U4 4  fef &5%5 w    6v&  @ppC`p   6@Cwzwtw D "/ & & 8-e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _/5uNfe & b4% _/bNe & 1  uN <2)U5| m- 5 & b4%St%B  2 U   & b4% S U _- @_-w DE%%"5   & b4% U wv w ^D55@ "/  / 3 3 4 4 4 4 4 ww~w  $65+ &5e-e %& &     r1 ww  5f r1 7D f r1 7wX@ m76%&e w       r1 e-ww D 65 e %&w  5 e-|w / 0ww  N h4ww rDCDpC <2 1 wZw FN 3wJ ~5 & E        ~5>wlYwfw Net@f 62e  w6w.w  U7vU7ljbAe vBN7 P  F%@ 55 a  a!PE -% w$ <4 `e vWt vw@ `e @  <4%e U? `e 7U?z a7l df?^ZU ew dD:E wZw FD5 3 5N <2!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%۷mۇ%w w7*'$!     V 7L& A<& BF7!W-87 w 8uDAB %u f& & e w5 5  W- W00~u5  .lu.Bw* J@B |_6@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& - z   5 , @ :% & f E -  (˥-%0     ,:% &  - 8 5E& z   5 , @ :% & f E -  w/usr/adm/lastlog%s: getpeernamelogin: user read user unknown /usr/lib/uucp/uucicoLogin incorrect.Password: passwd read Login incorrect.USER=%s/usr/lib/uucp/uucicouucicouucico server: execl/usr/adm/wtmpuucp%.4d/usr/adm/wtmpuucp%.4d:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     initgroups: %s is in too many groups setgroups/etc/grouprr/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd%d.%d.%d.%d: Unknown error: %d&@Rdt!0AUi 6Pn , N l  > W q  2 E R f z 6 P c | RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator$ /etc/hostsr# Fp ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 6d6o6x6f6e5g6c6s5l5L&6u*6D6O6X<6U0HlY}   R0ҧR0ҧ0u @fL e7cce7~ / :)  7%  (]w b`  ,%7 ^ l n  ) @ ? a,7 7 ff %5% 5`Nefe& % ( ) R  fe& N'e u ) Ne& V wl_w X_5 5 < fe\f X%\ (] @ 4'A1Nfe E%GDe^@f& "%  % @%%@f& "% )%f U 5654 t  &feh ?%5ENeh Dfe& V% e 5 Nefef& e G D@e5@e5 Nf ?%  e Ne )%Ne& f& N'e  )  (]#f ,`% n   !$f ,`%p\8hs XYmH\| XYmȕ0Ne( N@ 5 Ap  X 5 %\s\f gtf ^ew> XYm4ȕt( X 5f   f |f   (= <  (=  X 5f  N < 5f  MN [N [ f  f  f  N [  P& =e P& =e    X 5Z qt fZ ^eNZ [N [Ne~ff ^eNe~ff ^eNeptf ^e (= L  (=  & H' Nf   (= wJZw 6Z%  @ss w Zŀ4fefe V%N 4'5N 4'5N 4'5N 4'5Negtf ^e w YDC  5  (= & 6e  5j r f vf& r t@aUU_~ r f vf& r t@aUU r f vf& r t@aUU fefefef B'e5 % &  H Z'fe x] fe x]  r f vf& r t@aUU  r f vf& r t@aUU r f vf& r t@a&50<fe X%5%.2*fe& 6e  r f vf& r t@aEE r f vf& r t@a&50_ fe& X%5%# 5 a _H @e5,@0&@e@5f x%55 NffNm V%u@e5 @@me@- r f vf& r t@aUU r f vf& r t@a&50 Nf ,`%555` r f vf& r t@a&50Hfe X%@e5 %#: 2 r  r f vf& r t@aUU22fe& 6e  r f vf& r t@a&50_, _,f& ,`%5%#n _$ _,Bum_,wvTw bT @ e5  f V% p  &  v%p p  &  v% T'  (]wSw SNfe ?%Ne XYfef ,`% (]wSw S-n h  fT ffe ?eNef wTSw @S+p %<P %Y; %  P 7 Pp & f ewRw R fe& X%% (] N } wRw rR/ @ Net@f ^e 5/f @ N *Y# 55 Ne tf ^ev7 tLwQe%w QD5@fe (' Ne J5N J5  f (w|Q w dQ5 5 N XY@m̥.  %w@Q5 D-@w QD. X  w Q5 :7&fe &@% ,fe x] f0HlQ}   R0ҧR0ҧ0ue x] Ne = Ye,fe ,`%,fe X%%, [@w XPb   X%5GNef ]:ffe ?%ffe ?%ffe ?%Ne =,fef ,`%%, fff eN [wOw O De t4 tt 4 4 Ne&& T@% wnO  eu @wNwN|wN wNwNw O2w-(" @m7ȥ-  > - 7%:f @ (  f      f     ?wrN ̥:7 @r*+jd, Zw-TN F f   * @m7   9 E5 @@l wpFw MDC E5<E@e33. @;E  5 , @;% & fE hY 5  ZU3 3  wMwtLw LD  *Y *Ye  b  6wLw L    C 7 Xw]bwLw nL  P[7 7 DwdLw PL " C 7 h 8A%5#$f V  w'f V  ̥ ̥ *& V 5=  #77 D ̥̋ ̥ %-& V   wlKw XKD CKwNK ˋ 5 vwJZwJw KR *5N D5N $wJ}& z*%5u?6  W GNf 5%@5fe@& V%u fef -e _DN [%04 Ne *5% P 5ff )%%= %N Z' @ <ff %]  W%w 5A1`@fe@& V%ff %u  W%N Rf ,`%5 N XY ff ,`%N XY f f ,`%N XY f f ,`%fef X%%_N 5 N [N [_Ne *5 f <' Nfe ?%Ne XY &fe A &fef Ge% 5Nfe x]  C r vf&A r t@aUU C r vf&A r t@aUU7  & & fe B'e%  C r vf&A r t@a&50 X  W  fefef .'e5N [  55 _}N 4'5%%%_d  W _fef X%%_fe ,`% _ff D&%@_w F5 5   6%5+N 4'5fef % %0 %N [ @N [wFw E|DCe%@5̥.e ̋  * C 5 Nff fef e N P[ QN P[%G  A5 N 5|8fe| FY ,fe| Y 5fe| C 5Ne~@ & ]  @|p-5N P[wDw DBN@fe 8A% YDe̥ ̥ ̋e  ̥ ̥ ̥  ̥ ̥ 5̥ ̥ ̥ ̋ 5 N fef % NNf *Y wCw C% Nf *Y_WNff &@% KNf *Y@@mȋ= : +A (' %)7. @ 7  e ̋@@m  *Y wChw|Bw B r  n L  wB X 5 ff L% 50P  8 :w B  uN XY5&f %5:wfB 5  f *Y  0   w B p  @e5ff l%5:wA R5  w-F N  4 w A  X  &  H%7wfAH *YT5gf C 7 w A w"Aw A t  wAww @ pj I7 b  ^X P[7 Pw@w @wDw@w @  2 ,@ E w@ A5% %V 8A%  V @iV ) 7l& ) 7o& )  #7r& )  #7u& ) 7x& )  p#7bw`{& )  p#7PwN~& ) 76& ) 7(& ) 7_ w r? $ wl?  7  N N55 ff )e55 $ DVxr>& V%e@& V%eB& V%e82,&N& V%e7w f>  _# *Y_x"_|"5 & f X%5= p#5u fff Ye5 #u 1Vf X%50VV :=V6N [w=w =D      + - ̥9 Wp @@`e̥0  wV=w >=D5 5      + -! ̥9 f& ff 4eee@ ee@ 5u̥0 A@  w7 <05 4'7&7Lx C _L&_z&fe &@% #Ce  ˥ ˥ ˋmp ?%7 p @ Z X fe &@% L%HCe  ˥ ˥ ˋ: Ff&@tBD@t B ,D@t0 B0 D@t>5 4'AWt1@ %fe 8A% _>%%w P[fe ('.fe @  p FY  fej @  NAej@f ,`%N [ 2` & fh A%%%w3w 3D ww 57%<0  ?%5,  6%7%  X 7xt<7h%`'R 5%%F2 -%%" [w3w 2 [7w2w 2D 7w2bw82w 2N F2 .w2w 2D el&&&&WpeP f Wpe: f  ?ew^2w J25 5  AaAE f&A@vUU5u %w2w 2D  w1̥/ 55  XY&f b* e %Nfe FY  fe Y fe Y ԥ.̋De & 5 & X %fe0 X% [ %,@e05e d.w Ne$ d.wNe( d.w%r_. _.% _.%2_.WpfWpeme, _.@e\5 N d.f&te -| @ E3 -` *te "5.N d.f&@.e@.A Ep@.A Ep - sZ" -3Z"  _. - t-"_. -Z"7T7Nte "5  eZ"7*؃ -z _.@eZ"7 w B/ Nefe >w2/7 6AWp@7j d7 f f > Z" FY Z"77 w .7 7 ,7 *7 * Z" FY Z"7z7tw.w .  r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpex u4  AmA f&A@ 5u  AmA 5 u ܃@ 44  ttw*!wJ*\wD*w *De LN XY4e ej v6  XY4e  Be v Nfe 2A%wL*w 8*-<@  w2*N " ?%"ew)aw)w )w@7% ?@w)N f 6w )DC_l<̥%_R< 5 r y _R< 9% 5afe & V%5@e5 5N < _j< 5N < _j< w) 6_j< 6_j< 6_j<  |<% _j<0 |<% _j<0 r  r f |<% _j<0 |<% _j<  |<% _j<  r  r f |<% _7_j<0 |<% _7_j< < _7_j< 6_7_j<0 |<% _7_j< 6_7_j< < _7_j<0e r& |<% _7_j<0e  @ r& |<% _7_j<0 |<% _j<_7 6_j<_7 _7 < _j<_7 _(7 _.7 _R< _7% _7b_7fe & V%5@e5_7 _R< _7 _L8 _R< _7 _h8 _R< _8 _8 _R<0 el rdf |<% _j<_7 _9 _R<0 |<% _j<_7 _ 9 _.7 _R< < _j<_7 _7 _J9 h_&: _8 _7 Y% _8_8 _x9 G0 |<% H_7 _ 9 _7 - 62_7 ! 0 el |<% _7 _8 _9 _69f b _7?X T ̋_7D_7w 2$"A r e0@ A r 5   %" @  L %"  @w" @pHA@tw"w "0 w &"D  !     +  w!e% - r<N r<&@&# ?e# ~ ~w r! Nef V? wl!w X!D 5  =$& &@% `5ȥ=  = @w !e  w BuNefef `%=@@w Ћ Ћ  Jҋ~ @@&wSwmown|@lw e& 7 N7Fgw: B,I I7ILw  BuNeff `%=@@ww  fff ,Aewwyw&  4  b '     ` TW ~  s`K6!  w D85U5_B5P_B  m@e4 ,5Ne & ]  uN ^4USt%5 Z5  Z5& & X% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff X%ށ̥a &  Ye 3     U̥r 33w   uff e55 D#fe& V%e$  $R#& V%e#& V%e$*@A@ 7r5%  $& V%mm  #ww D@et5r%=r D  H 7;x *c D h w|e =r r̋=rNet *Y Net *Ye  @et5Net XY5&f 4%  I7 Ѱw DC . 4 H 7% *c b 2!f V%  f  Tрwpu5&f % 40 I7 ( w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @ W-@D Ae Bḁ.@e@- @D@pHe _F̋@pHeA Be vC ̂ xuuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ ^ w5 4@E%@EU5N&e FY &e Y Nf&e X%4 IN&e FY &e Y Nf&e X%  (Ne& ]  ff eee@ 4t@t"4 4t [ J__Hw N [@ [N J_ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  P ve@ 4tw"w D55ff %f&& "eff&e e &e 7:%ww D85_ONe& ]q fe Ve4-4-/44  &&  ef&& Ye&e & X%%&e x] &e eC ff e5u4 t "-t t"  ff ef&& Ye&e$& X%%&e$ x] `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& Ye&e$& X%%&e$ x] `Btp$t t"  ff Nef&& Ye&e$& ,`%%Uw w r D5#5 5 ww%wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& V% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm V% a@ `` e w D a@@m e  w e  aAm HN@`@m &f V%  aN f`f V%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef `% ZU4 4  fef `%5 w    6v&  @ppC`p   6@Cwzwtw D Z & & Ye 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _Z5uNfe & ,`% _ZbNe & ]  uN ^)U5| m- 5 & ,`%St%  ] U   & ,`% S U _Y @_Yw DE%%"5   & ,`% U wv w ^D55@ Z  [ 3 J_ 4 4 4 4 4 ww~w  j$5+ » &5e->e % &     <] ww  5f <] 7 f <] 7wX@ m7%e w       <] e-hww D T5 e %w0  5 e-w P[ \ww  N 2`ww rDCDpC ^ x] wZw FN J_wJ ~5 & E        ~5>wlYwfw Net@f ^e  w6w.w  .%U7,%U7.%,%Ae vB7   % 55 a  a!PE -%,% w$ ` `e vWt vwp@ `e @  `%HDe U?22 `e 7 ,%U?Ɣ a7 ?U ew dDE wZw FD5 J_ 5N ^!w5A vBB-  }ee@ !ۃ `!ւ ` `0mԶ& E%ƶm%w w7^*'$!     H 7>& A.& BF7!W-:f7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_b@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w  Xw]`w|w h ֳܳ P[7 γ D> I7 67 0wLw 8 = C 7 l8% 8A%5#?f d  Bf d ,N Ff& ̥ ̥ 7%7E& d  ̥̋ ̥ %&H& d   %wLw 8ww>w *D CKw ˋ 5 w DCB P  5 , :% & E& hY z   5 , @ :% & f E hY  (˥-%0     ,:% &  hY 8 5E& z   5 , @ :% & f E hY  w@(#) Copyright (c) 1983, 1988 The Regents of the University of California. All rights reserved. @(#)rlogind.c 5.22.1.7 (Berkeley) 9/11/89TERM=prux|rlogindalnusage: rlogind [-a] [-l] [-n]Couldn't get peer name of remote host: %mCan't get peer name of remote hostsetsockopt (SO_KEEPALIVE): %mConnection from %s on illegal portPermission deniedip %2.2xConnection received using IP options (ignored):%ssetsockopt IP_OPTIONS NULL: %mrlogind: Host address mismatch. rlogind: Host address mismatch. /dev/ptyXX/dev/pty/dev/ptyp/dev/ptyp0123456789abcdefOut of ptys/dev//bin/loginlogin-p-h-f/bin/loginlogin-p-h/bin/login/dev/ttyselect/dev/rlogind: %s. %s: %s%s: Error %dremuser too longlocuser too longTERM=TERM=Terminal type too long05075110134150200300600120018002400480096001920038400/etc/utmp/usr/adm/wtmp: illegal option -- : option requires an argument -- /etc/protocolsrr# socket: All ports in use rcmd: socketconnect to address %s: Trying %s... %dwrite: setting up stderrselect: setting up stderrselect: protocol failure in circuit setup. acceptsocket: protocol failure in circuit setup. /etc/hosts.equivr/.rhostsr</etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwdError 0Unknown hostHost name lookup failureUnknown server errorNo address associated with name: Unknown error %d.%d.%d.%d/etc/resolv.confrdomaindomaindomainnameservernameservernameserverLOCALDOMAIN  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d   4 F X h t   $ 5 I ] |   * D b  B`2Ke&9FZn*DWpRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator#*3;DJPTY^eow :t:~:::;6;h;;;; <4/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired %&&adaoaxbfbeagrbc~bsalaLauaDaOaXbU%2/etc/hostsr# 0Il r= R0R00t 0b l e7cce7 / R  7%  :(w t+5  f <$  f <$   e    b4#B "e :( x  e % p n H>   8N& <$0 Nf& Z% Nf& Z% &Qfe eNe&& %5`  5 "jd@ A f&ut EE  @ @mWB "% u-N :(w)w )L  Nfs6 "ef  5N _VN N b&Ne@ & ( f&  he %  z  z  n6 " 5 %N      N eAe P~ Nfe e@5 Z  Z5 _@N _<   _<ePNV Z  &&&&  && ef& && ef& & & ef& 4-+-   4- 4- +-\ Zee P~ - _2N b& wz'w f'D  @mf <$ Ct 7P~ wP| w@' ! w "'A rQ Db t-w'  w &N 5@w&( N( 5 B "  :(A rQ eb u}}@p- Άw w r&D̥: ̋̋wd&w P& C Wp De` ˋ ˋ =K ˋˋ w&w %0 %w%= N@0 N@0 N:&fe p% &fe p%w n% R $  7:7 4 wV%w <%  b&7 w2%w %   & 5%%&w$w $ p  N& <$w$ w $ B  N& <$w$ pw $   N& <$wv$ @w#w R$   L  wD$ 5 ff L% 50   8 6w #  uN j$5&f %56w#  5   f <$   0   w j# p  @e5ff l%56w># 5  w-   4 w " VP # F &  %70w" <$5f  7 w x" V w~"w j" t  wl"ww L"  7    b&7 w2"w "ww$"w "  x r@ E w!X 5% %@R %  R "R  7&  7&   7&   7&  7&   & 7w&   & 7w&  7|&  7n&  7`_ w 4  w  7   55 ff d e55 DR:& "%e<& "%e>& "%e~xrlJ& "%e7Xw   _   <$_. _2 5 & f #%5= & 5u fff $e5 #u 1Rf #%50RR :=R|N &w w D      + - ̥9 Wp @@`e̥0  ww D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  wA@w~w DC AupB 4  & "%b 5% 傎& "%`@ @m A &@w  w f6 fef ,%5 wR w :D Lԋw2w DC  w5 7@  55@- 7 5!w De LN j$4e*e   j$4e- Be v Nfe %wLw 8-V@ Bw2N/ % ~ ~w  B0Il r= R0R00tuNefef ,%=@@wЋ Ћ W f r @  W f r@  @ B \C& eJ  E6P6 EPyw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_5P_ T mJ@e4 ,5Ne & (  uN )4USt%* 56 %5B %5& & #% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff #%ށ̥a &  $e 3     U̥r 33w 4$ ) @ w5 4@E%@EU5N&e X$  &e $$ Nf&e #%4 IN&e X$  &e $$ Nf&e #%  (Ne& (  ff eee@ 4t@t"4 4t & \*_w N &@ &N \*ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4tw"w D55ff %f&& "eff&e e &e N 55 wxwtw5 5 w D5#5ff T %f&& eff&e *ew6&e 2 '44  && ef&& $e&e & >+%%U w D5_o5ff %f&& eff&e Ze L&e 2 8f f ff&e V e 744  && ef&& $e&e & >+%%UUw @@m e%fe (  &e N 55 3ff `%f&e@ &50c &e N 55 3 B " U44  && ef&& $e&e & >+%%&_fffffe e _&e % _6_e_6  mm@ e@ f& ef&& $efe& >+%%_ _0w @0 0 @0 N 77ww D85_Ne& (q fe Ve4-4-/44  &&  ef&& $e&e & #%%&e ( &e N 55 ewww4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4t4-4-/44  && ef&& $e&e & #%%&e ( ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& $e&e$& #%%&e$ ( `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& $e&e$& #%%&e$ ( `Btp$t t"  ff Nef&& $e&e$& >+%%Uw w r D5#5 5 w8w4wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& !% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l 5l u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm "% a@ `` e w D a@@m e  w e  aAm HN@`@m &f "%  aN f`f "%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef ,% %U4 4  fef ,%5 w    6v&  @ppC`p   6@Cwzwtw D % & & $e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _%5uNfe & >+% _%bNe & (  uN ))U5| m- 5 & >+%St%6  ( U   & >+% S U _$ @_$w DE%%"5   & >+% U wv w ^D55@ %  & 3 \* 4 4 4 4 4 ww~w  $* 5+ : &5e-e % &     N( ww  5f N( 7b f N( 7wX@ m876* ,% e w       N( e-ww D * 5 e % w  5 e-w b& 'ww  N D+ww rDCDpC ) ( wZw FN \*wJ ~5 & E        ~5>wlYwfw Net@f )e  w6w.w  U7U7Ae vBl7 n  d%^ 55 a  a!PE -&% w$ + `e vWt vw@ `e @  +%e U? `e 7U? a7 ?|xU ew dDXE wZw FD5 \* 5N )!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7*'$!     n 7d& AT& BF7!6W-/7"w 8uDAB %u f& & e w5 5  W- W00~u5  .lu" Bw* J@B |_-@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& z$ z   5 , @ :% & f E z$  (˥-%0     ,:% &  z$ 8 5E& z   5 , @ :% & f E z$  wquotas-v-aUsage: %s %s repquota [-v] -arepquota [-v] filesys ...rq%s/%s%s not found in /etc/fstab *** Quota report for %s (%s) r*** Warning: Quotas are not compiled into this kernel Block limits File limits User used soft hard warn used soft hard warn %-10s#%-9d%c%c%8ld%8ld%8ld %5u %5u %5u %5u %5u out of memory for fileusage structures /etc/fstabr/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd: Unknown error: %d$<F`r"1APau/@Vp2Ln=^w0Rer  , @ V p RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired ,d,o,x-f-e,g-c-s,l,L-u-D,O,X-U0Jl겢 P5 R0R00s @)  e7cce7  /   7%  !w $5 5 5 e%~     !N 5 e%%\Xf G Sf 9f 5 .%N N5Nff %5`N 5N % e   !w#w t# 7 d Nf & 5% H N % 8 $N %)Nff % Nff5 e w"dw`"w "   L  w" 5 ff L% 50   8  w v"  uN 5&f %5 wJ" 0 5  " f  $  0   w ! p  @e5ff l%5 w! 5  w-   4 w v! jd  Z &   %7DwJ!l zx5f & 7 w ! w!w t  w ww  :7    7 w w ww w   @ E w l 5% %T$ T %  $ 0 $  7"&  7&   7&   7&  7&   7w&   7w&  7&  7&  7t_w VH  wP  7 &  055 ff e55  D$  & J%e & J%e & J%e & J%e7lw J  _ _v_5 & f %5= 5u fff Ze5 #u 1$ f %50$ $  :=$ N  ww D      + - ̥9 Wp @@`e̥0  w:w "D5 5      + -! ̥9 f& ff peee@ ee@ 5u̥0 A@  wA@ww | fef H%%5 4wh `ww JD LԋwBw .DC f w"5 7R@  55@- 7 &5!w De LN 4ee  4e Be v Nfe N %w\w H-@ wBNX %X w  BuNefef H%%=@@wЋ Ћ yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_ 5P_  m@e4 ,5Ne & "  uN ^"4USt% 5P D5L D5& & % 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff %ށ̥a &  Ze 3     U̥r 33w 4$ ^" w5 4@E%@EU5N&e   &e j Nf&e %4 IN&e   &e j Nf&e %  (Ne& "  ff eee@ 4t@t"4 4t   #_( w N  @  N #ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  , ve@ 4tw"w D55ff %f&& "eff&e e &e  55 wwl w5 5 w D5#d5ff T %f&& eff&e *ew6&e x0 Jl갢 P5 R0R00s'44  && ef&& Ze&e & $%%U w D5_Lo5ff %f&& eff&e Ze L&e x8f f ff&e V e 744  && ef&& Ze&e & $%%UUw @@m e%fe !  &e  55 3ff `%f&e@ &50c &e  55 3   U44  && ef&& Ze&e & $%%&_8fffffe e _8&e % _|_8e_|  mm@ e@ f& ef&& Zefe& $%%_8 6_vw @0 0 @0 N 07N7Jp ww D85_<Ne& "q fe Ve4-4-/44  &&  ef&& Ze&e & %%&e ! &e  55 ewfwbt w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  , ve@ 4t4-4-/44  && ef&& Ze&e & %%&e ! ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& Ze&e$& %%&e$ ! `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& Ze&e$& %%&e$ ! `Btp$t t"  ff Nef&& Ze&e$& $%%Uw w r D5#5 5 wwx wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& % w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l 5l u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm J% a@ `` e w D a@@m e  w e  aAm HN@`@m &f J%  aN f`f J%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef H%% DU4 4  fef H%%5 w    6v&  @ppC`p   6@Cwzwtw D D & & Ze 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _*5uNfe & $% _*bNe & "  uN ^")U5| m- 5 & $%St%  &" U   & $% S U _ @_w DE%%"5   & $% U wv w ^D55@ D   3 # 4 4 4 4 4 ww~w  z$ 5+ &5e-Ne % & ,    ! ww  5f ! 7 f ! 7wX@ m7 % e w       ! e-xww D d 5 e % w@  5 e-&w  !ww  N $ww rDCDpC ^" ! wZw FN #wJ ~5 & E        ~5>wlYwfw Net@f X"e  w6w.w  . U7  U7  Ae vB7   % 55 a  a!PE -%  w$ ^$ `e vWt vw@ `e @  ^$%XTe U?BB `e 70 U?$ a7 ?U ew dDE wZw FD5 # 5N ^"!w5A vBB-  }ee@ !ۃ `!ւ ` `@mR& E%Dm>%w w7n*'$!      7& A& BF7!W-)7zw 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_'@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w@(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)renice.c 5.1 (Berkeley) 5/28/85usage: renice priority [ [ -p ] pids ] [ [ -g ] pgrps ] [ [ -u ] users ] -g-u-prenice: %s: unknown user renice: %s: bad value renice: %d: getpriorityrenice: %d: setpriority%d: old priority %d, new priority %d `/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd: Unknown error: %d$4@Rdv)HWf~.Mj{,\s1Me&:M\p # < ^ s RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired | @&d&&o2&x&f&e%g&c&s&l&LH&uL&D*&O6&X^&U0 Klꗎ B R0ĨR0Ĩ0r 4$ e7cce7 / l  7%  *w - u5  e 5%&  * + N Br2@,,1N & ]@ȥ- r v@ dUU e@ȋN 7#=tfed& $%Vl@f&  %5 Nf % *% @ 0 78% t <%  *%r%@ 0 7 2 7 j 5 t <%  *@ t %7r  *5XfeB e52fe e* N  h V R z l z nNefe& f e 5 % Nef % - w * p -*    >"ef& "eu R z N wl*w X*$,4̕44 N He5 6 2 R -N&  4& f$H  e 5@-  Nf4 eh |(w)w )D%w) jw d)@f& >%f&@fe 2 u@Et5e@- v _|@f& %f& *%f %_|uDDm̋G & _|@f& %f& %f% %  & 8 % et&K e %  \ _|-_|e5@f& %f& @%fj %} WNfe   ff &ef& ff 8eee@ 5uff ewmwmw w-v w-nwdw`w-\8w-T3wJwF, D > 6 250" -" ?% h & h  & w&w &DC5 5 du %%  5`u`u A@ f&A@vee@ 5uv5`u`u @@ wH&w 4&DC    ee@Bt  w&w %z   Wpd 7r     ef&| eh |( *wR%w >% De t4 tt 4 4 Ne&& |% w%  eu @w $D  & &e  b n 6w$w $ r 6$  7^X P&w]6wh$w T$ B< (7 47 wJ$w 6$ " 8$  7 h$/ %5#:f  w%=f  ̥ ̥ @& 5=  0 7|%,07r% D ̥̋ ̥ %p0C&   &0wR#w >#D CKw4# ˋ 5 w #D      + - ̥9 Wp @@`e̥0  w"w "DeEE&E&E&Fr0 <e r0w|"}w!w b"h fef .%5 vwN" w!w 0"D 3 ,EtU4 4t w!w !D  |( & &  % +5 f&  %Uw!iw$!w !D Lԋw!w !De LN &4eRe  B  &4eU Be v Nfe %w!w -@ jw NW0 <%0awJ w u@t5050@ 51Nefef % (3A@u5Btr020@ Aup1 fef % u-u-u-@w tww  BuNefef .%=@@wSwBlw2 e& 7 7gwyw&  4  b '     ` TW ~  s`K6!  w D85U5_5P_  m@e4 ,5Ne & R+  uN +4USt0 Klꒌ B R0ĨR0Ĩ0r%\ 5ph |(5lt |(5& & J&% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff D&%ށ̥a &  &e 3     U̥r 33w   uffn e55 Db1fe& $%eb2  b2\\1& $%e^1& $%e24@A@ 7r5%  2& $%mm  X1ww D@et5r%=r lD  F 7Z;f 0 D V  w|e =r r̋ =rNet & Net &e  @et5Net &5&f 4%  r7  w DC .  F 7x% 0 b 2!f &$%  T   B wpu5&f % "  r7  w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @  W-@D Ae B ḁ.@e@- @D @pHe _(̋@pHeA Be vC ̂ x uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ +  w5 4@E%@EU5N&e & : &e & Nf&e D&%4 IN&e & ? &e & Nf&e D&%  (Ne& R+  ff eee@ 4t@t"4 4t @) ,_`w N @)@ @)N ,ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  d ve@ 4tw"w D55ff %f&& "eff&e e &e 55 ww2w5 5 w D5#F5ff T %f&& eff&e *ew6&e "'44  && ef&& &e&e & -%%U w D5_vo5ff %f&& eff&e Ze L&e "8f f ff&e V e 744  && ef&& &e&e & -%%UUw @@m e%fe +  &e 55 3ff `%f&e@ &50c &e 55 3D t <% U44  && ef&& &e&e & -%%&_pfffffe e _p&e % __pe_  mm@ e@ f& ef&& &efe& -%%_p n_w @0 0 @0 N h7H7D2ww D85_tNe& R+q fe Ve4-4-/44  &&  ef&& &e&e & J&%%&e + &e 55 ew`w\2w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  d ve@ 4t4-4-/44  && ef&& &e&e & J&%%&e + ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& &e&e$& J&%%&e$ + `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& &e&e$& J&%%&e$ + `Btp$t t"  ff Nef&& &e&e$& -%%Uw w r D5#5 5 ww2wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& &$% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l: 5l< u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm $% a@ `` e w D a@@m e  w e  aAm HN@`@m &f $%  aN f`f $%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef .% |(U4 4  fef .%5 w    6v&  @ppC`p   6@Cwzwtw D |( & & &e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _b(5uNfe & -% _b(bNe & R+  uN +)U5| m- 5 & -%St%h b ^+ U   & -% S U _ ' @_$'w DE%%"5   & -% U wv w ^D55@ |(  @) 3 , 4 4 4 4 4 ww~w  t $\ 5+ &5e-H e %L & &    * ww  5f * 7 f * 7ZwX@ m7\ %Le w       * e-rww D ^\ 5 e %Lw:  5 e- w ( X*ww  N -ww rDCDpC + + wZw FN ,wJ ~5 & E        ~5>wlYwfw Net@f +e  w6w.w  (2U72U722Ae vB7   % 55 a  a!PE -%2 w$ - `e vWt vwz@ `e @  -%RNe U?<< `e 7*2U? a7  ?U ew dDE wZw FD5 , 5N +!w5A vBB-  }ee@ !ۃ `!ւ ` `:m& E%m%w w7P*'$!     " 7& A& BF7!W-37w 8uDAB %u f& & e w5 5  W- W00~u5  .luTBw* J@B |_L0@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w  P&w]Nw|w h  (7  r7 7 wLw 8   7p lf2 %5#f 2  f 2 N f& ̥ ̥ 737& 2  ̥̋ ̥ %3& 2   x3wLw 8ww>w *D CKw ˋ 5 w DCB P  5 , :% & E& & z   5 , @ :% & f E &  (˥-%0     ,:% &  & 8 5E& z   5 , @ :% & f E &  w@(#)ping.c 4.6 (Berkeley) 10/30/86Usage: ping [-drv] host [data size] [npackets] >IPWhv%s: unknown host %s ping: packet size too large icmpicmp: unknown protocol ping: socketPING %s (%s): %d data bytes ping: recvfromsendtoping: wrote %s %d chars, ret=%d Echo ReplyICMP 1ICMP 2Dest UnreachableSource QuenceRedirectICMP 6ICMP 7EchoICMP 9ICMP 10Time ExceededParameter ProblemTimestampTimestamp ReplyInfo RequestInfo ReplyOUT-OF-RANGEpacket too short (%d bytes) from %s %d bytes from %s: icmp_type=%d (%s) x%2.2x: x%8.8lx icmp_code=%d %d bytes from %s: icmp_seq=%d. time=%ld. ms ----%s PING Statistics---- %d packets transmitted, %d packets received, %d%% packet loss round-trip (ms) min/avg/max = %ld/%ld/%ld /etc/protocolsrr# %d.%d.%d.%d: Unknown error: %d"<Ldn  ,8JYix)8DWh~"CZt*Ae 0 E X z  0 B T h ~ RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorz ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 233x/d^/oj/x(0f60e(/g0c0s8/l8/L/u/Db/On/X/Ut3/etc/hostsr# 0 Llꐔ Dy { }  R0R00q @7x + e7cce7:5 /   7%  /w 25 #*f +" 3!f + 3 f + 3 e Հ ހ   b3B*X 8*e / p Z e d% h  f 3 Nf N 5V : LcX 8* o  /< 2  6z& +. 2Nf& "% Nf& "% L&}.4 e.4&& `%5`  5 %22,2@ A f&ut EE  @ @m&X 8*e u-N /w1w 05   X 8*   / BZ  1  & + r1Nf& "% Nf& "%   z ǂ x&.4 e.4&& `%A vEu`Ne `% @w/w /TN 5 0 NfL 8*e f @+ 7|0N _N ^0 <.f Z Ne & N0 N  -NuNef u-NfffX 8*e N  сN <.f @+ 5f p  f&  ~e %0 b  |/  VL 8* x & e7 ,t-:4 4 4 &  j e -. x-& v. & 4%ef& & e - -J. <. wp- F.G D.NI  e NNZ  5- fgL 8*et-t-&&ffx e L 8* 555fe ev4teff ~e4 4 4 _w `,D   E% E%`3m3m s w,,w ,D  @mf + Ct 7P,wP,w+ ! w + *e@)%x1)",e v@55  xff ej,Etex7)V, R,% wt+)w Z+A@v 5u ff, +e5 u   /N f+ F+%@-   /w*w *A rQ Dz1t-w*  w *N Z5@w* / 5 X 8*  /A rQ ez1u}}@p-+Άw+w 0*Nb5 + /b5  _L @_H T b5w* r̋5Tu wJ)w )D̥: ̋̋w)w ) C Wp De` ˋ ˋ =K ˋˋ wb)w N)l6 %w@)= x @0 x @0 x :&fe % &fe %w ( < $ Z 7$7  w(w (  -7 w(w n(   b6 5%%b6wJ(w 6( p  N& +w&( w ( B  N& +w' pw '   N& +w' @w('w 'DC AupB5 S  "̥ ;  & ӄ + %;  7  & ~)%bb& ӄ + % ₎& ~)%`@ @m A &@w&  w &DE5_ % _r _r 5`uu '& & +e5u%%wV& @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & +e5u %%    %%%_ 5 x-5 5 E4N ff & +e W _ %_d %_d _ w<$w $ (  ( L  w$ ( 5 ff L% 50(  8 r7w R$  uN +5&f %5r7w&$ B(5  4(f + 6( 0   w # p  @e5ff l%5r7w# '5  w-' '  4 w R# 0# Llꍒ Dy { }  R0R00q|'v' L+ l' &  B%7V'w&# +5f Z 7' w " lw"w " t  w"w'w " && n7 &  && -7 &w"w "ww"w t"  & &@ E w`"~& 5% %f&7 %  7 7 H 74&& H 7&&& H  7& & H  7% & H 7%& H  <7%w%& H  <7%w%& H 7%& H 7%& H 7%_w 2!Z%  w,!  7 8% 2!.% d!55 ff% e55$  D7$$v7& ~)%ex7& ~)%ez7& ~)%e$$$$7& ~)%e7~$w &  _ +_D_H+5 & f @+%5=$ <5u fff +e5 #u 18f F+%5088 :=8#N <.wpw \D      + - ̥9 Wp @@`e̥0  ww D5 5      + -! ̥9 f& ff Leee@ ee@ 5u̥0 A@  wA@ww XDC AupB 4  & ~)%b 5% 傎& ~)%`@ @m A &@w  w D  7 -  s 3  33 a r w w+& f +ew :L fef |3%5 6w& w D Lԋww DC `" w5 7L"@  55@- 7 "5!$w De LN +4e@et 2  +4eC Be v Nfe %ww -@ XwNE8 %8 ~ ~w  BuNefef |3%=@@wЋ Ћ   Ћ Ћ &wW f r @  W f r@  @ w  & f |eww>yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_D5P_D  m@e4 ,5Ne & N0  uN 04USt%@ 5L x-5X x-5& & F+% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff @+%ށ̥a &  +e 3     U̥r 33w 4$ 0  w5 4@E%@EU5N&e +  &e + Nf&e @+%4 IN&e + # &e + Nf&e @+%  (Ne& N0  ff eee@ 4t@t"4 4t <. 1_\w N <.@ <.N 1ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  `# ve@ 4tw"w D55ff %f&& "eff&e e &e % 55 w:w68w5 5 w D5#5ff T %f&& eff&e *ew6&e ''44  && ef&& +e&e & 2%%U w D5_o5ff %f&& eff&e Ze L&e '8f f ff&e V e 744  && ef&& +e&e & 2%%UUw @@m e%fe 0  &e % 55 3ff `%f&e@ &50c &e % 55 3( X 8* U44  && ef&& +e&e & 2%%&_lfffffe e _l&e % __le_  mm@ e@ f& ef&& +efe& 2%%_l j$_w @0 0 @0 N d!778ww D85_p"Ne& N0q fe Ve4-4-/44  &&  ef&& +e&e & F+%%&e 0 &e % 55 eww8w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  `# ve@ 4t4-4-/44  && ef&& +e&e & F+%%&e 0 ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& +e&e$& F+%%&e$ 0 `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& +e&e$& F+%%&e$ 0 `Btp$t t"  ff Nef&& +e&e$& 2%%Uw w r D5#5 5 ww8wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& ")% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l 5l u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm ~)% a@ `` e w D a@@m e  w e  aAm HN@`@m &f ~)%  aN f`f ~)%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef |3% x-U4 4  fef |3%5 w    6v&  @ppC`p   6@Cwzwtw D x- & & +e 4E05Ew7  Ћ P ы A@PЋ w FD:5UE5Hw* _^-5uNfe & 2% _^-bNe & N0  uN 0)U5| m- 5 & 2%St%L J Z0 U   & 2% S U _, @_ ,w DE%%"5   & 2% U wv w ^D55@ x-  <. 3 1 4 4 4 4 4 ww~w  $@ 5+  &5e- e %0 & b    / ww  5f / 7$  f / 7BwX@ m 7 @  %0 e w       / e- ww D @ 5 e %0 wv  5 e-\ w - T/ww  N 2ww rDCDpC 0 0 wZw FN 1wJ ~5 & E        ~5>wlYwfw Net@f 0e  w6w.w  d9U7V8U7L9J8BAe vB.7 0  &%  55 a  a!PE -%8 w$ 2 `e vWt vw@ `e @  2%e U?xx `e 7f8U?Z a7L DF?>:U ew dDE wZw FD5 1 5N 0!w5A vBB-  }ee@ !ۃ `!ւ ` `vm& E%ڷmڇ%w w7*'$!       7& A& BF7!W-<77w 8uDAB %u f& & e w5 5  W- W00~u5  .lu8 Bw* J@B |_H5@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& + z   5 , @ :% & f E +  (˥-%0     ,:% &  + 8 5E& z   5 , @ :% & f E +  w quotas-v-a-pUsage: %s %s quotacheck [-v] [-p] -aquotacheck [-v] [-p] filesys ...Can't open /etc/fstabrq%s/%s%s not found in %s /etc/fstabCan't open /etc/fstabrqfork%s/%s*** Checking quotas for %s (%s) r%s dev (0x%x) mismatch %s dev (0x%x) w*** Warning: Quotas are not compiled into this kernel %s: %-8s fixed:#%-7d fixed: inodes %d -> %d bytes %ld -> %ld lseekreadout of memory for fileusage structures /etc/fstabr/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd: Unknown error: %d*:R\v&8GWfw&2EVl1Hb/St3Fh{ 0 B V l RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 8 9 9t4dZ4of4x$5f25e$4g4c 5s44l44L|4u4D^4Oj4X4U02 MlnB R0ըR0ը0p =U e7cce72Y /   7%  >1w x4 Wp 1VG %,%,Wp XG Wp eXGf   %5  w(4  <@f X@c pX@n ZX e@ȥ-   w 3 f , 7(X N w3N  T%,et7W7 W W   J J  2J % %  z v@N& T%  bWteN  %-HWDWe-1w(0w 0DC #3- 3-w/ # & @- w / HTB FTA5 5   ^U A^UDp 5`u`u ff &^U&A |e %SS@mAm@ f&SL Je wL/ ,NG e Wp NG PGWp @PGNGf&W e pSWp @TGRGf&\ eWp XGWp NXGa %,Wp NVGew .  @`ȋ 2  `A`Hwh.w T. R  R L  wF. R 5 ff L% 50R  8 `Yw -  uN n-5&f %5`Yw- DR5  6Rf @- 8R 0   w l- p  @e5ff l%5`Yw@- Q5  w-Q Q  4 w , ~QxQ , nQ & r %7XQ^w,zP @-D5f  7Q w z, Xw,w l, t  wn,wQw N, PP 7 P  PP f/7 Pw4,w ,ww&,w ,  P P@ E w+P 5% %hP|Y %  |Y ^|Y  76P&  7(P&   7P&   7O&  7O&   ( 7OwO&   ( 7OwO&  7O&  7O&  7O_w *\O  w*  R7 L:O "0O "55 ffO fe55N D|YNNdY& +%efY& +%ehY& +%eNNNNtY& +%e7Nw )  _ P @-_0 @_4 5 & f ,%5=N ( 5u fff -e5 #u 1|Zf ,%50|Z|Z :=|ZMN /w)w (D      + - ̥9 Wp @@`e̥0  w(w (D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  w(A@w'w 'Vfef 5%5 rw' w '%VwMw MMt7MMWpwMAwpzMAmu% Nf  @mXM5uBm@MB-"C-Dm*M5TD-um M@5@- w' LӁNLf LmLu-BmL B-т̒LC-Lw & @@5@xL @  vwphLAmDu-^L6B HL@4L5 &L N LC! K5ԒS DCKUKC-f KmK5D-/+D-!CmK@5&@5%3-zKf  5u0B55LKHK5R DD-N& KmK-KN&  -J_0w%w %NefJ D%w$w $Neff07 MlkB R0ըR0ը0p D%w$w $D A555  ԋuNeffe D%w$w $DC 5 5 _%%_5 %*e5  AWp `eu 0u%l5  %h%[ 4e  _Neffff e   * O  A@ EN 5% % % %Nf  &    %_` A@ E%Nf  @w"N 5 w "N%c%s%[Nf ff f& 4ew"5 5 5 5 %e%f %o%xDe5 5 A @ EN % % % %- Ԑ A @ EN  _%+_  _%a%f %A_ %F_  % A@vN O% A@v@mAm@ vA@v5u0 %a%fW7 5`u`u C% S P Ԑ A @ E =%%.%e%E- *% ' $ ! Ԑ A @ EN %+%-%0%9 A@  5u% N   =   @e! @e! _8@t@]   xNe A _8Ne A @H@pHw DC = 5%c%0u5 %s    %r%c5 %[r      %%    =  D- %cw w D ̥^   % %]%-+  $%-̥]4   ̠   %]  ww D*\5% %-%+ 5 55 55  B5eA5 %.55  B5eA5  %E%e$%+%-  Wp B`e  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& e5 55w6 m 7,"z@w D Lԋww DC A w5 7A@  55@- 7 dA5!$Ћ Ћ W f r @  W f r@  @ w D% 5     |@w4- &  4  b '     ` TW ~  s`K6!  w 0D85U5_5P_ p mf@e4 ,5Ne & 1  uN 24USt%J5V /5b /5& & ,% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff ,%ށ̥a &  -e 3     U̥r 33w 4$ 2 p< w5 4@E%@EU5N&e \- (&e (- Nf&e ,%4 IN&e \- -&e (- Nf&e ,%  (Ne& 1  ff eee@ 4t@t"4 4t / `3_w N /@ /N `3ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  $ ve@ 4tw"w D55ff %f&& "eff&e e &e R' 55 w;w;Zw5 5 w D5#95ff T %f&& eff&e *ew6&e 6)'44  && ef&& -e&e & B4%%U w D5_ !,9o5ff %f&& eff&e Ze L&e 6)8f f ff&e V e 744  && ef&& -e&e & B4%%UUL8w @@m e%fe 1  &e R' 55 3ff `%f&e@ &50c &e R' 55 32b + U44  && ef&& -e&e & B4%%&_ fffffe e _ &e % _:!_ e_:!  mm@ e@ f& ef&& -efe& B4%%_  %_4 w @0 0 @0 N "7777Zww D85_#Ne& 1q fe Ve4-4-/44  &&  ef&& -e&e & ,%%&e 1 &e R' 55 ew6w6Zw4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  $ ve@ 4t4-4-/44  && ef&& -e&e & ,%%&e 1 ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& -e&e$& ,%%&e$ 1 `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& -e&e$& ,%%&e$ 1 `Btp$t t"  ff Nef&& -e&e$& B4%%Uw w r D5#5 5 wR3wN3ZwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& *% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l(5l*u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm +% a@ `` e w D a@@m e  w e  aAm HN@`@m &f +%  aN f`f +%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef 5% /U4 4  fef 5%5 w    6v&  @ppC`p   6@Cwzwtw D / & & -e 4E05Ew76, Ћ P ы A@PЋ w FD:5UE5Hw* _.5uNfe & B4% _.bNe & 1  uN 2)U5| m- 5 & B4%St%V  1 U   & B4% S U _- @_-w DE%%"5   & B4% U wv w ^D55@ /  / 3 `3 4 4 4 4 4 ww~w  +$J5+ j) &5e-*L)e %: & *    R1 ww  5f R1 7|* f R1 7wX@ mR*7P*JF*%:e w  0* "*    R1 e-*ww D )J5 e %:w)  5 e-)w f/ 0ww  N H4ww rDCDpC 2 1 wZw FN `3wJ ~5 & E        ~5>wlYwfw Net@f 2e  w6w.w  (ZU7(ZU7(Z(Z(Ae vB(7 (  ~(%x( 55 a  a!PE -@(%Z w$ 4 `e vWt vw(@ `e @  4%''e U?'' `e 7'ZU?' a7' ''?''U ew dDr'E wZw FD5 `3 5N 2!w5A vBB-  }ee@ !ۃ `!ւ ` `&m& E%ѷmч%w w7%*'$!      7& Ap& BF7!RW-<7>& & e Ӌ BF &7& e ӕ-ӕ0B~ӕ.  ӕ0~ B~BF&7 & Le ӕ-0 ӕ.~ B~ӕep ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luHBw* J@B V_7@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& ~- z   5 , @ :% & f E ~-  (˥-%0     ,:% &  ~- 8 5E& z   5 , @ :% & f E ~-  w&w Nefef 5& :e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& :;eww  fff 5& :;eww  5 %O N  = Z555Ne5& / 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired Z<[<[6d6o6x7f7e6g~7c7s6l6L6u7D6O6X7U=(\0E NlQ f R0R00p @TH e7cce7J /   7%  w W i) mL sL@ % IN ;e@ȥ- a I+7 I@ 5u  bItp#TI\Ie  DI%d>I 8I .I 2Iww   f 7I N % I_7 HN/  & e7 Het5 & e w-H Hte  %ew-lH݂jHt0 #7 ZH & e w-8H 2Hte  %ew-H݂7 H & e w-G Gte ^ %ew-G݂G   Wp &WpN& Wp1 &Wp1 & %tGt0 # %d\GdGwBw .D LG t-@G#t0#t0#t0# -GE%@4 F8%dF4E%` E% 5 FtF#Ft0#Ft0#Ft F0#F  wr w ^ DE%@J5 5 57 e@& Ne h0    5  @Fe  dA1@ e4 %w w DE%@_d5 5 57Je E  ] E E55 @t"#  @t #@t #= VE@t#@t&#@t&#K el   E 2 er    v y Ne hw w D ,:E $v5uff %5u  !&eff eEaelL 4,  w w D..w w %$ f  { %  N& 2   w w A rWpDe&  %L-!e%0J&   rC%lC  % Lw* w  D   ff Nef&C efC %!ff ef w w  "W-@tmN W-B % wl   fef& e@t@aw  D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  wA@w vfef N%5 >wb w JD LԋwB$w *D5"E@e44fef N% J U4 4  fef N%5 w   @ppC`pww7@ PЋ w FD:5UE5Hw* _0 5uNfe & % _0 bNe &   uN d)U5| m- 5 & %St%  , U   & % S U _ @_ w DE%%"5   & % U wv w ^D55@ J    3  4 4 4 4 4 ww~w  >>$5+ > &5e->=e % & =    ww  5f 7= f 7wX@ m=7=|=%e w  f= X=    e-<=ww D (=5 e %w=  5 e-<w  & ww  N ww rDCDpC d wZw FN wJ ~5 & E        ~5>wlYwfw Net@f ^e  w6w.w  ;`JU7;^JU7;`J;^J;Ae vB;7 ;  ;%; 55 a  a!PE -v;%^J w$ d `e vWt vwD;@ `e @  d%;;e U?;; `e 7:^JU?: a7: ::?::U ew dD:E wZw FD5  5N0J NlT f R0R00p d!w5A vBB-  }ee@ !ۃ `!ւ ` `:mb& E%TmN%w w79*'$!      7& A& BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& z   5 , @ :% & f E  (˥-%0     ,:% &  8 5E& z   5 , @ :% & f E  wncheck: bad flag %c ncheck: cannot open %s %s: no memory for name %s mode %-6o uid %-5d gid %-5d ino %-5u /%s/. ???.../%sncheck: HSIZE of %d is too small ncheck: read error %d ncheck: %u - huge directory FJjJjJFd,o8xfegcslLNuRD0O<XdU0M Olȴ ^' R0R00o  H e7cce7v /  7%  w B % n d  @&  7  @&  7  @ .    & %@&  7   & N % ww Z 5 5 @ `d & e 5 & & E & e 5P & & & & e 5P@5%0%7 f % 5 @eCpt5P % *u "u5 5 fe X fe X fe X Ne >@e5Nef %@e5555 5 5uuNeff %@E  U @f `ONefefe F%w    5  vfef %5 5`u`u Nefefefe eN  Eu Eu@t@P5%c@ 6 Nefefefeffe e Nefefefe@& fe e , |;Neff N %_Nefefefe* fe e Ne  ,$   _%Nefefefe e_w  5 @@mH@ @aw @@mȋ@& % w  5 5 5 5 .%0%9  H  wL ff z eCe `@ `5u @5A@w   @ E r 5 "    :5 @p '@ E!   h b@ EN r % > r 5% % %  @0w"w @>E5D m@ @-! e E55 @5DmLN 84e E55 stIl@ %5@%  ` 7 Z N @f& N %f X Nff f eD eD LN 84N&e & @ @m&@> < ww  5uNff N %f X @ t@mpH%  \ = = w\w HD tL4JtH4F4BtD4E i  @c ` 4%   e v@55  eENeff %t@ae(eBPPPPPPt@ae&&e %t@aee4PPPPPPNeff N %wR %t@mf&ta % `4$t& t@mf&t@mt@m0 0  %N&&&$ N %_w   t  u5  2n d    L#Neff %w0 t@af&t  %2A@ww D   w w D  ff ef& e ffA eR .  &z %%ffW eh .  wT w @ D  ff xef& e ffm Te~ .  & %%ff e .  w w b fef %5 fw w | D Lԋwt w ` De LN 84ee.  84e Be v Nfe l %w w -@ w N , %w  fe & @w @pHA@tw w b BuNefef %=@@w6 yw w  D85U5_5P_  m@e4 ,5Ne &   uN 4USt%V 5Bb 5>n 5& & % 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff %ށ̥a &  e 3     U̥r 33 ( R~55R 5& E 0R OlIJ ^' R0R00oR RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw *D5"E@e44fef % U4 4  fef %5 w   @ppC`pww7| PЋ w FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%b    U   & % S U _p @_tw DE%%"5   & % U wv w ^D55@    3 * 4 4 4 4 4 ww~w  ($V 5+ &5e-e %F &      ww  5f  7 f  7wX@ mr7pV f%F e w  P B     e-&ww D V 5 e %F w  5 e-w 0 ww  N ww rDCDpC  X wZw FN *wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  U7U7Ae vB7   % 55 a  a!PE -`% w$  `e vWt vw.@ `e @  %e U? `e 7U? a7 ?U ew dDE wZw FD5 * 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `mX& E%JmD%w w7*'$!      7& A& BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .luN Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& H z   5 , @ :% & f E H  (˥-%0     ,:% &  H 8 5E& z   5 , @ :% & f E H  w@(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)mkproto.c 5.1 (Berkeley) 5/28/85 usage: mkproto filsys proto r-bcd-u-g%c/%s: bad octal mode digit %s: cannot open ...%c/%s: bad mode %s: bad number Unexpected EOF indirect block full bad mode %o Out of space. seek error: %ld rdfsread error: %ld rdfsseek error: %ld wtfswrite error: %D wtfs: Unknown error: %dX`j"4FRht'6N[q:Kj,Cbr5Vx ,@Vx . C RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatordoxxfexgRc^slLuDOXU0Y Pl, K R0R00o :  e7cce7 /   7%  n2w 5F5 _: 5`%% u/f L* 5+Nc\fe )eNefe * % Nnhfe )e@e5 f L. 5  fs H%Nef 3 %  fz H%@E% N H  f .* 5ah @uN H @7Nf  @uMexQ m s v=% N T H5 5u  C H :ff &%5%_\ ? AWp Cae   @f H%  K-s-@&f re %&N H & '5& fe N)e %.A r'ffff7fe )e NeN B N 0 @ n2Ne 0&5t n2 n2wj2w V2 ed@f F3e "   5 Y H @w2o "N H w 1~ D-%     n2w1w 1 @e58 &  %Nf 2% TNf   n2wZ1w F1Nfe   w41 2 e5@e5}|:  e@-=lNe H 4@e5Ne H 5 f p.UB f p.UB UB& f t* f t( f t,Ne H 5f 4 &  e@4&*& &(& 'ef& et.&,& &.& 'ef& e40t2&  het4&  Tet6&  @et8  *et:  e@4<&  e@4=&  e@4>&  e@4?&  et@t  etvfe . fe . fe . fe . fe . `exa&@55555Ne f s%&%" 3 e i@e4rfe . eD50iNe f 3s& fe es & fe  f& V%e@3 & fe Re@3 Nefe H 5 f 4 3 uu& fe ef&@e5VWEVlWEn_w , 5 w>   L. 5p z w,D#Z z N 0 @e!O z N N 0ԐB-fef R.%5́ @a % D-Ԇ\ w , ˥#%  ̋ ̋˥|˥:ˋ w+˥:˥| ˋˋ˥: Dw +D̥: ̋ ̥:w+w +  @ ˋSˋAA@ ˥@@wb+˥#  ˥05 5 & fe >ee 5`u`u uA@w *d  @ ̋T̋AA@ ̥̋:̥@ w*w *  @ ̋T̋AA@ ̥@ w*̥= N& w ^*DC=%::\  xEB @  u0teP uDw)w )Df n @ N Hw)e @u w z)% / N 5 .5Ife& V,%w2)w )N f 5u% %uuA@w(&  @ppC`pLw ( @e5ff h %w(w ( B p  Nf V+% nf  &   N N n2wD(w 0( @e5ff %w (w (  Nf V+% N N n2w'w ' @e5f B w'w ' h  Nf V+% f  &   N wr'w ^' @e5f  wR'w >' *  Nf V+% N w 'w '  w'w &: N  N w&w &"w- @m7ȥ- > - 7@%:f .* ( f  S   N  N ?w*& ̥:7 b*0^ Pl$ K R0R00o+ZT Jw-Dh> 6f  i @m7x l 9 E5 @@l w(w n%DC E5<E@e33. @;E  5 , @;% & fE . 5  20U3 3  w$w $D      + - ̥9 Wp @@`e̥0  wf$w N$D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  w#A@w #fef 66%5 *w# w #DC``Hԋ wt#``A@w P#DCB  @mAmHԋ  @mAmA@w#w #D Lԋw"w " @e5ff 2%w"w "D5 N# %EAEt =_05]Ne (Nfej )%CaejNe jAej@ e`5    )%`5t   )%` \ӕ:ӕ Bej%_:mo N  )%` 5 Nfej +%`Aej@55 *@e`5^}^f@ej@A^1e^^@^fe` V,%l  U %rNfej` r5%@-`R ffej< e O5.K 5h%D 4  L.%5fej X. e>fej .*  NAej@f r5%N 0 x5 & fh 2,%%%w w D wwx 57n%`<<r :)%5D,  %7*%  L. 77%' %%p %% 0w"w  07rww D 7wbwZw N j 6ww D el&&&&Wpef Wpefj )eww l5 5  AaAE f&A@vUU5u %w8w $D w̥/ 55 .&f  e %Nfe . fe X. fe X. ԥ.̋De &  & L. %fe0 R.% 0 %,@e05e wNe$ wNe( w%r_ _% _%2_~WpfrWpemle, _@e\5 N f&te -( @ E3h -  *te5.N f&@.e@.A Ep@.A Ep - s* -3* h_ -| t-p_ -`*77te5  e*7 -& _@e*7w d Nefe F(wT7 AWp@7 7  f ( * . *7F7@ w 7 7 7 7 * . *77ww , b)̋      2  ww   @55 w- w-  t  -  t5, 5, - gue&&fe Xe3 e*p2e*3ww & f eww  `Q@f& @e5uQ@f& ne5uumumu _eeQu  %QQ eu % ff et ff e5u< ff bet< ff eL A@e@ f& zet e  =  r  rd > r 8 8 rd ( Af 5 8u 4  Af f&A@ 5u r  r   Af @mAm@ 5u e4 tWpe6u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw!wl\wfw De LN .4eeb   .4e Be v Nfe V,%wnw Z-@ wTNx )%xewaww w@7% ?@wN f  w DC_%̥%_v% 5 r y _v% 9% 5afe &x ,%5@e5 5x N & _% 5 N & _% w8G  _%\  _%n  _%  %% _%0 %% _%0 r  r f %% _%0 %% _%  %% _%  r  r f %% _ _%0 %% _ _%| & _ _%  _ _%0 %% _ _%  _ _% & _ _%0e r& %% _ _%0e  @ r& %% _ _%0 %% _%_   _%_ _  & _%_ _L  _R  _v% _ % _ b_ fe & ,%5@e5_  _v% _  _p! _v% _  _! _v% _" _! _v%0 el rdf %% _%_  _(" _v%0 %% _%_  _D" _R  _v%w & _%_  _ ! _n" h_J# _:! _  Y% _!y_" _" G0 %% H_  _D" _! -  2_  ! 0 el %% _  _! _# _Z"  _ ? ̋_* _ w TA r e0@ A r 5   % @  L %  &ww D w t n j?fw  w&  %5u  - xff p%5 EU@ff L% f 2'e x5 N' 5 N' 5 fe& 2,%ff %N N' N N' %e& ;ew.w u@t55@ 5Nefef *% (3A@u5Btr2@ Aup fef *% u-u-u-@ww  fe F(@w @pHA@tw. w  b)!,& .*   w 1&Z :)%7˕,ZNf ( w F D  !     +  w e% - r<N r<&@&gZ )eZ ~ ~w Nef |) w w x D 5  =& v*% `5ȥ=  = @w* e  w  BuNefef 66%=@@w Ћ Ћ   Ћ Ћ  Jҋ~ @@&w W f r @  W f r@  @ mn+lwx e& 7 H7@gwJ 4RBH&I I7dIw @5-E@BepNff 66%5N 20@U@0 @0 =  Nff 66%5@5 w @w BuNeff 66%=@@w w  fff P,ew w$ yw  @A  v @A ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef 66% 20U4 4  fef 66%5 wJ    6v&  @ppC`p   6@Cw(w"Ћ P ы A@PЋ w FD:5UE5Hw* _05uNfe & r5% _0bNe & 3  uN L3)U5| m- 5 & r5%St%  3 U   & r5% S U _. @_.w DE%%"5   & r5% U wv w ^D55@ 20  0 3 4 4 4 4 4 4 ww~w  $v5+ &5e-rze %f & P    2 ww  5f 2 7 f 2 7wX@ m7v%fe w       2 e-ww D v5 e %fwd  5 e-Jw 0 2ww  N x5ww rDCDpC L3 2 wZw FN 4wJ ~5 & E        ~5>wlYwfw Net@f F3e  w6w.w  RU7DU7:80Ae vB7   % 55 a  a!PE -% w$ L5 `e vWt vw@ `e @  L5%|xe U?ff `e 7TU?H a7: 24?,(U ew dDE wZw FD5 4 5N L3!w5A vBB-  }ee@ !ۃ `!ւ ` `dm& E%ܷmۇ%w w74*'$!      7|& Al& BF7!NW-97:w 8uDAB %u f& & e w5 5  W- W00~u5  .lunBw* J@B |_8@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& . z   5 , @ :% & f E .  (˥-%0     ,:% &  . 8 5E& z   5 , @ :% & f E .  w%s: can't read disk label; disk type must be specifiedT:Nvm:s:%s: bad file system size%s/r%s/dev%s/%s/dev%s: %s%s: %s%s: not a character device%s: can't figure out file system partition%s: '%c' partition is unavailable%s: maximum file system size on '%c' partition is %ld%s: sector size not 512/etc/mkfs %s %ld %d %dnewfs: %s %s: unknown disk typeioctl (GDINFO)usage: %s [-N] [-m freelist-gap] [-s filesystem size] [-T disk-type] special-device #(-3:AFPZckz unknownSMDMSCPold DECSCSIESDIST506floppyunusedswapVersion 6Version 7System V2.11BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660b0tyremovablesimulatedsfntnsncdtdtscsurtrcacrmilskcshstssbpxbxfxoxtxdx/etc/disktabE^^\\::n r t bf disktab: /etc/disktab/etc/disktab R: illegal option -- : option requires an argument --   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %dz&2DVht:IXp} ? \ m  N e # ? W x   , ? N b x   . P e RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator #-5>.#####&$Z$$$$%.%X%SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%yr&&/bin/shsh-c #,'+h/37;?CGKSW[_ cTZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB .7d7o 7x7f7e6g7c7s6l6L67u:7D7O$7XL7U0n Ql1l lN P R T V R0R00m @Zz6 e7cce7( / #  7%  Rw UTw0  ue @ NA@l7 e _ w   R5 N 4Q %   8N & d & d  8N 5 qt f SeN 4Q '%fe R  n  fe :%  fe :%T fe :%_@Z 0M%_@ȥ-_ 5 @ dU _& p8%_r_ r f vf& r t@a&50_  Z 0M% *%& & & ""%5 dZ 0M% %_. $ _5  7%5   5. . & &e0 7 P5 _2 %N 4Q& .7% "_%(. fe 7 A@02 W <e0AePPPP.&9 $e r f vf& r tE~E 4Q4 . n& n6% j_^X _  t r f vf& r tE~E & 6% _  N5f  _u-N 4Q %  f d N 4Q& d & d   m $%%  2fe& "e U  B" ~  j"  (4&Z 0Mee& ` %  2fe& "e $% U %N 4Q8  _ _~ z  & & fed 6"e5_ %T  $  "w OQ\ NZ 0M% ?t-9 N& $e Z &Z 0Me r f vf& r tU~U 8  fe (;%5w*Ow O D B $_h D 4 8 _. & N& N8  [  2%5u  5  s  5s5 @ a5@ aA `p@ `p %ff ^2%      &  7 & $e 0- 4 % 4Q% _V   1%5u9e85  8% r f vf& r tE~E H  4Q     Tff 1%wLw L7   % 8 wLw LD  & V1%4 & $e_ & N5fe& d"e  $ fe& d"e 2 $ &e& j% &P $e 4Q 3X +% & 0"  r f vf& r tU~U -7wLKw 8K: S ` $  RAP~  4/%5u6870ff /%wJw J  &  Pe wJo D= 7w J  P7 wJw nJ 5#  wTJNe   Ne 5qf N2xf N'~f Nf Nf NNe  4Ne 5f N 4Ne  4 Ne  4& N# 3- Ne   $%_  4 5 % N A a1Ne 5 @ a0 %_ w HD  T  T  T  T5 @ a @ a T %w.Hw HD ̥ ̥ ̋. 8 2@ E ;5@& ":   =  wG5̥ ̥  ̋̋=@w vG N r;%  whG  9 5=w 6G N N  S5  $  RNf N @wFw Fb.Nefef % ff F%ffe 9e Nfe 9%fe& 8% N`ԕ -wbFw NFN0s Ql*f lN P R T V R0R00m P fef >N%5 fef U%  RwFw ENefe& fef "e 5fe& ffef <"e wEw EN P fef >N% % RwnEw ZEfef >N%wNEw :EH ?: 6 %w&Ew ELN P H -@e5%Hf vL%5aa-%HHf vL%5aa- f@ef@efef Ce% Rw:Dw &D\ 2 Nefe& Jfef "e N& -%FFfe vL%a-%Ffe vL%a- fe& Jfef <"e wZCw FC fe 7 Z 0M  w,CA@ee~@ f& *%w B 5ufef U%wBw BNefe& fef "e  N5ufe& fef <"e wzBw fB 75uNe (fe 9%Ne Nfef U%w(Bw B 75uNefe& fef "e $Ne ( fe 9%fe& fe H: &fef <"e wAw A@@& @& @&@&ffZ 0MewPAw @ Z XH D= 7F@ DNw],w"@w @ *$ P7 7 w@w ? ZH D= 7 rP r;%5#\f N  wR_f N 5=  bf N N  ("777e& N  ̥̋ ̥ %h& N   w>w >D CKw> ˋ 5 w >"5  @ @ap t- 5N m& N)%NlZ 0M% rNef X" 0w6>@ @a0  m  w = j  D= 7VP DNw=w = @: P7 2w=w =DC  ̋̋w=w =  D= 7 E r;%7@:& z 70:& z  7$:& z  & z $ %,& z ̋ w%7w29 N5f D= 7r w 8 Xw8w 8 t  w8w`w 8 60 f?7 (  $ P7 w8w 8ww8w 8  @ E wl8 ;5% % r;%   9 2$ 7& 2$ 7& 2$  7h& 2$  7P& 2$ 7F& 2$  (!7(w&& 2$  (!7w& 2$ 7& 2$ 7& 2$ 7_w >7 ! w87  7  *D \D55 ffh e55N ! D>8& vL%e& vL%e& vL%e& vL%e7w 26  _  N_0 _4  5 & f 8N%5=j (!5u fff Ne5 #u 1f >N%50 :=N 4Qw|5w h5D      + - ̥9 Wp @@`e̥0  w"5w 5D5 5      + -! ̥9 f& ff X,eee@ ee@ 5u̥0 A@  w4A@w3w d4DeEE&E&E& 9e w04}w3fw3cw3jw3]w|3wv3w 3Nf ^" w3PwZ3wT3iwN3w 3Nf " w3~w23w 34De _# t4 t t4 4t Ne&& r:% _#t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 $ 55 Nefe :% & %5u7 l && r:% \ fe :%ff % fe& r:%wT2A@E f& vw *2w02w 2D Lԋw2w 2DC  w15 7@  55@- 7 5!w 1 @e5ff $%w1w |1D5 NF# $%EAEt =4_~'5]Ne 7N^fej 9%CaejNe ,cAej@ \1e`5  ڬ m 9%`5  p 9%` tӕ:ӕ Bej%_&mo N 1u 9%` 5 Nfej :%`Aej@55 *@e`5^}^f@ej@A^1e^x^@^fe` l;%  U '%Nfejx U%@-`R ffejT P1e O5FK 5h%D 4 z 8N%5fej N e>fej 9  NAej@f U%N 4Q U & fh H;%%%w.w .D ww 57%x<f  8%5\,  V1%7B% 4 8N 7*&7%' 0%% (%% 4Qw-w - 4Q7w-w -D 7w-bw-w -N , (w-w x-D el&&&&Wpef Wpef. 9e.w:-w &-5 5  AaAE f&A@vUU5u %w,w ,D .w,̥/ 558 N&f >% e %Nfe N Ffe N fe N ԥ.̋De & 0 & 8N %fe0 >N% 4Q %,@e05e )wNe$ )wNe( )w%r_j) _j)% _j)%2_j)WpfWpeme, _j)@e\5 N )f&tNPe -R @ E3 -6 *te 5.N )f&@.e@.A Ep@.A Ep - s -3  _j) - t- _j) - 77te 5  e 7؃ -P _n)@e 7w * Nefe 7w*7 AWp@7@ :7 < f \8  N  7^7X w )7 7 7 7 H N  7,7&w)w )VL 9̋  T)  T)  2  wX)w D)  @55 6 w-4w-,  t  -  t5,N 5,P - ue &&fe Xe3 e pe 3w(w z(& f eOSwf(w R( !Q@f& e5uQ@f& e5uumumu _f.eeQu  %QQ eu % ff et ff <e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 Wttw%!w&%\w %w %De LN N4eXe 1  N4e[ Be v Nfe l;%w(%w %-@ pw%N]&! 9%&!ewb$aw\$w $w@7% ?@w$N f 1w $DC_7̥%_6 5 r y: _6 9% 5afe & vL%5@e5 5 N 7 _7 5" N 7 _7 w# 1_7 1_7  1_7  $7% _70 $7% _70 r  r f $7% _70 $7% _7  $7% _7  r  r f $7% _N2_70 $7% _N2_7 7 _N2_7 1_N2_70 $7% _N2_7- 1_N2_76 7 _N2_70e r& $7% _N2_70e  @ r& $7% _N2_70 $7% _7_N28 1_7_N2 _N2 7 _7_N2 _1 _1 _6 _N2% _N2b_22fe &" vL%5@e5_>2 _6 _T2 _2 _6 _x2 _3 _6 _3 _*3 _60 el rdf $7% _7_N2 _3 _60 $7% _7_N2 _3 _1 _6 7 _7_N2 _2 _3 h_4 _2 _f2 Y% _3_3 _ 4 G0 $7% H_N2 _3 _2 -! 12_N2 ! 0 el $7% _N2 _d3 _4 _3< 8 _N2?. * ̋_1_P2w H!A r e0@ A r 5   %>! @  L %>!  7ww D w ?w ~ fe 7@wp @pHA@tww 8 9!,& 9   w 1&H! 8%7;˕,H!Nf \8 w D B !     +  we% - r<N r<&@&H! 9eH! ~ ~w " Nef *9 ww D 5  =& 9% `5ȥ=  = @we  w  BuNefef tV%=@@wjЋ Ћ  Jҋ~ @@w D% 5     |@w4- Sw@mow8n:lw" e& 7 7xgwl׬B^I I7Iw H BuNeff tV%=@@ww Nff f;eww  fff f;ewwLywF&  4  b '     ` TW ~  s`K6!  w >D85U5_.=5P_.=  m@e4 ,5Ne & FS  uN S4USt%B5N pP5Z pP5& & >N% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff 8N%ށ̥a &  Ne 3     U̥r 33w 4$ S : w5 4@E%@EU5N&e N  &e N Nf&e 8N%4 IN&e N %&e N Nf&e 8N%  (Ne& FS  ff eee@ 4t@t"4 4t 4Q T_T>w N 4Q@ 4QN Tww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  XF ve@ 4tw"w D55ff %f&& "eff&e e &e H 55 ww|!w5 5 w D5#5ff T %f&& eff&e *ew6&e J'44  && ef&& Ne&e & U%%U w D5_xBo5ff %f&& eff&e Ze L&e J8f f ff&e V e 744  && ef&& Ne&e & U%%UUw @@m e%fe R  &e H 55 3ff `%f&e@ &50c &e H 55 3*Z 0M U44  && ef&& Ne&e & U%%&_dBfffffe e _dB&e % _B_dBe_B  mm@ e@ f& ef&& Nefe& U%%_dB bG_Aw @0 0 @0 N \D727.!ww D85_hENe& FSq fe Ve4-4-/44  &&  ef&& Ne&e & >N%%&e R &e H 55 ewJwF!w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  XF ve@ 4t4-4-/44  && ef&& Ne&e & >N%%&e R ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& Ne&e$& >N%%&e$ R `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& Ne&e$& >N%%&e$ R `Btp$t t"  ff Nef&& Ne&e$& U%%Uw w r D5#5 5 ww!wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& L% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l 5l"u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm vL% a@ `` e w D a@@m e  w e  aAm HN@`@m &f vL%  aN f`f vL%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef tV% pPU4 4  fef tV%5 w    6v&  @ppC`p   6@Cwzwtw D pP & & Ne 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _VP5uNfe & U% _VPbNe & FS  uN S)U5| m- 5 & U%St%N T RS U   & U% S U _O @_Ow DE%%"5   & U% U wv w ^D55@ pP  4Q 3 T 4 4 4 4 4 ww~w  ^$B5+ 4 &5e-2e %2 &     R ww  5f R 7 f R 7LwX@ m7B%2e w   x    R e-\ww D HB5 e %2w$  5 e- w P LRww  N Uww rDCDpC S R wZw FN TwJ ~5 & E        ~5>wlYwfw Net@f Se  w6w.w  !U7!U7!!Ae vB7   % 55 a  a!PE -%! w$ U `e vWt vwd@ `e @  U%<8e U?&& `e 7!U?͔ a7 ?U ew dDE wZw FD5 T 5N S!w5A vBB-  }ee@ !ۃ `!ւ ` `$m& E%m%w w7м*'$!      7 & A& BF7!ܻW-4Z7Ȼw 8uDAB %u f& & e w5 5  W- W00~u5  .lu:Bw* J@B |_@X@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& N z   5 , @ :% & f E N  (˥-%0     ,:% &  N 8 5E& z   5 , @ :% & f E N  wx}88d  echoechodiscarddiscardtimetimedaytimedaytimechargenchargen/etc/inetd.confinetd: Unknown flag -%c ignored. //dev/ttyinetdselect: %m someone wants %s accept, ctrl %d accept: %m%s/%s server failing (looping), service terminated getpwnam: %s: No such user%d execl %s execv %s: %m%d reaped %s: exit status 0x%xrestored %s, fd %d %s: %mREDOADD%s/%s: unknown serviceFREE%s/%s: socket: %mtcpsetsockopt (SO_DEBUG): %msetsockopt (SO_REUSEADDR): %m%s/%s: bind: %mOut of memory.rstreamdgramrdmseqpacketrawwaitinternalinternal service %s unknown Out of memory.-%s [%s]-%sechodiscarddiscardUnable to get time of day %s %s %s: %s proto=%s, wait=%d, user=%s builtin=%x server=%s /etc/servicesrr# ,/ initgroups: %s is in too many groups setgroups/etc/grouprr/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd%d.%d.%d.%d/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec&*mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d(BRjt&2>P_o~ />J]n ( I ` z  0 G k  6 K ^  6 H Z n  RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorT [ b j t } 45&5D5b5556.6\6666SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired !!!lWdRWo^WxXf*XeWgWcXs,Wl,WLtWuxWDVWObWXWU0 Rl' < > @ B D R0R00l B@" e7cce76% /  7%  w $$R m s ( N C d $= $: $7e@ȥ- b @ 5u  tp%p%e  % t%% H$w w  $ f D 7# N ( U $_bN ( 7 #7 #7 #7 #7 #7 #7 #7 #7 #7 #7 #7 #7 #7 #7 #7 # B& eet57 d# nhb ee@ f& e5u ::4! ( eN x7#@ ( "7 " "N" (  & e w-" "te f %ew-"݂7 " B& e n" j" ` Z"_bP" _b7 l"7 j"gff % eL"w F" \u5v" ` "! !m!m!m!m!!!!!!!&l ( e!!m!m!@ m!m!@ m!m!@ 5u!!!!!!!!ff ^ e!z! J e H!=5 5 N5 ff %  ! ff  eeu eu w-w-ׇff eww D E< j7 4 1     ta  %4e~ w x ta f& % %wB% %`%%@%%  ( e w  ta f& % feta f& e t@a  %ew t@af& % %ۂe~w x t@af& % fet@af& e5 @t@a  %ew @t@af& % %ׂew &@t@af& % fe@t@af& e5 @t@a  e\w V3@t@af& % %ڂw  w- w-w- Nff? ( ew ff ~% Nff[ ( eew  t5,%5,%Nvffw ( e t,%,% w 4  6 w4 A@6 5u ff ef vD ff peC``w n h   * ( %2 t5J5Lt0 J0 L  A@wR bfeff ew>%260ff ( e7 5 @t@aBtrL2J %2w erw l%2-fe (  tLJf&t@a %2Neff r %7 njtpLpJ Vw> w *   ff ef& PeN f J%@- ff e  ( 7 f ( ww   ff \ef& Pef %% ff bewfw R%w-wNfe (   @a 5rD @a p@aAm 5rD C-7 7 7d7a7^7[ t 7 T7 R7 P& %ee@ 5u, ff @evGeu  3 AaA f&A@ 5u7 2w , w-ff % ff % - 5u   B r % ww D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  wA@w fef b%5 w w D Lԋw$w  fe @w @pHA@tw   6v&  @ppC`p   6@Cw\wV7 w@w  $ 5+  &5e-e % &      wZw F 5f  7x f  7w@ mN7L B%e w  ,      e-ww D  5 e %w  5 e-w X  xw\w H N wHw 40 Rl. < > @ B D R0R00lDCDpC x ( ww N w  ~5 & E        ~5Yw.w  x%U7v%U7x%v%Ae vB7   % 55 a  a!PE -z%v% w$ x `e vWt vwH@ `e @  x% e U?   `e 7v%U? a7 ?U ew dDE wZw FD5  5N x!w5A vBB-  }ee@ !ۃ `!ւ ` `mz& E%lmf%w w7*'$!      7& A& BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_.@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& " z   5 , @ :% & f E "  (˥-%0     ,:% &  " 8 5E& z   5 , @ :% & f E "  ww D:5UE5Hw _5uNfe & % _bNe & j  uN x)U5| m- 5 & %St%  p U   & % S U _J @_Nw zDE%%"5   & % U w. w D55@   ` 3  4 4 4 4 4 w>w6w Net@f e  w6wBad flag cannot open %s %s: Check fsize and isize: %D, %u Not enough core; duplicates unchecked freefiles %u (r=%u,d=%u,b=%u,c=%u,l=%u,s=%u) used %D (i=%D,ii=%D,iii=%D,d=%D) free %D %D missing missing %D bad mode %u data (small)1st indirectdata (large)2nd indirectdata (huge)3rd indirectdata (garg)%D bad; inode=%u, class=%s %D dup; inode=%u, class=%s %D arg; inode=%u, class=%s Bad free list, s.b. count = %d Bad free list, entry count of block %D = %d read error %D No update write error %D ^%%%Zd@oLx fe gcslLbufDDOPXxU0 Slǀ p^    R0R00k @L  e7cce7` / 0!  7%  ?w DB&%zkW' 9e  ? efP >"%P  >"% e %75e Nf ;w er75 f 8"%7P ! ? i . ?e   ?P  >"% i  ?e  ! ; , ?572 f ;e   e % @  ef  e Ȁ B :%0P~ i  ?e  /%+"@eP~@e"P~Nfe&  ^!e  7  0P~  i z ?e  ^0@P~ i @ ?e #  ?wL?w 8? f  w.?w ?f  w?w ?@f  w>w >"f  w>w >0f   i  ?e : w>w > i ` ?e Q  ?P  >"%  @ 57@ w]  i  ?e N w >w =P  >"%N h7v  i  ?e f !w=w =  @ Py  f ~ % Z T    ߌ 5 x -x  ?j % & X  J;   w=7  e w < P  >"%  i  ?e %1 %/  _0 Z?  !0@f& %  P  >"% i  ?e %1  !0 Z?   5 ; i  ?e %1 0 Z?  !P  >"%0@f& %   l#%f&& e58 C i 2 ?e %1$ 0 Z? 2 !P  >"%0@  @f& %F     5 - ?% &  J; w:w v: V =  8"%7> %+: _ S ! ?  i  ?e %1 %/  _ 0 Z? d !P  >"%0@e&B~ R e x  5 < i ~ ?e %1p 0 Z?  P  >"%0@e&B~ e   \ V N J5H: -: ?,% &  J; w8w 8 9   xN 9% ?w8NN !w x8DN d(5u%%ttBN &5 @&e@& 8%*N 5 & @f& e44 N 9% ?w7w 7DC5 ˥ff % _  < ߖ _b 5 -<?r% & `< J; _b  t1j , 2 ,, $ 5 -,?% & , J;    -#@?% & ߦ J; 5%  5 @& ˥ ” Z >T L H5F8 -8>?*% & > J; w5w 5 uN 0&@ePPPPPPw5w 5D| H  ; ;e  b D 6w\5w H5  $ 7 :w] w,5w 5 | 2=7 t7 w5w 4 b  $ 7N mD #%5#f   w f   ̥ ̥ &  5=  l7TwRH7> D ̥̋ ̥ %&    w 4w 3D CKw3 ˋ 5 w 3 %W- A@vC BE%A@vC B PP%A@v B P5uff <%5uw|wxw83w $3D @e55 5  ̥0 ̥x̥X. 'Ae f&ffff X*e A f0 Slw p^    R0R00k&A@vee@ 5u 5 @u W-@Du Ae Buḁ.@e@-3u-@pHe _̋@pHeA Be v@5  @w15 5  A@v5uWtAaAE 5PuP  5 u ߇A@w `1@.PPPPPP1ffe >"%#fe " 5#$.fe " 5:fe " 5 @- u: = fe T% PPPPPPw0@f " 5 = f T%f T%w <0D5 5 5 -+Nefefefefef ze 5%Nfffe_Nefefefefefef ze5%Nfffe_Nefefefefefef ze5%Nefefef ze5%DN 5N 5N 5Nfffe&  e _,- K x0$̋  0Dԋ9  %A r 5@@m@ @ae5@e@-Nf& z%  Nff z%Nfffef e w-w -[] Z5 5 5 5 Bffff $eC Cm  `@ `5u   5`f ff $eB Bm Jf fe Beu-  @@mH 5 @@m u-w,  @A  @C@Aw j, N 5Cee5uuff (%f&` e  5C- ˋC-  d& f" e g& f"%C-N  Np& f"% w+ ̋ kw +5 5 D1 5 x`L ̋  ԕH w<+w (+D      + - ̥9 Wp @@`e̥0  w*w *DeEE&E&E&t* f"e *w*w z*fef C%5 wf* w N*Nef %wF*w 2*Neff %w**w *D A555  ԋuNeffe %w)w )DC 5 5 _%%_(5 %*e5  AWp `euu 0u%l5  %h%[ ue  _\Neffff re   * O  A@ EN #5% % % %Nf " &    %_ A@ E%Nf " @wD(N #5 w (N%c%s%[Nf ff f& ew'5 5 5 5 %e%f %o%xDe5 5 A @ EN #% % % %- Ԑ A @ EN # _v%+_v  _b%a%f %A_%F_ % A@vN #O% A@v@mAm@ vA@v5uu0 %a%fW7 5`u`u C% S P Ԑ A @ E =u%%.%e%E- *% ' $ ! Ԑ A @ EN #%+%-%0%9 A@  5u% N  " =   @e! @e! _@t@]   xNe lA _Ne lA @H@pHw $DC = 5%c%0u5 %s    #%r%c5 %[r      #%%   " =  D- %cw# w #D ̥^   % %]%-+  $%-̥]4   ̠   %]  w8#w $#D*\5% %-%+ 5 55 55  B5eA5 u%.55  B5eA5 u %E%e$%+%-  Wp B`eu  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& :!e5 55wj!6 m 7T""iw w ,!D Lԋw$!w !De LN :;4ee "  :;4e Be v Nfe #%w w -\@ w N< f"%<aw ~ ~w * BuNefef C%=@@wЋ Ћ w D% 5     |@w4- yw&  4  b '     ` TW ~  s`K6!  w D85U5_$5P_$  m@e4 ,5Ne & ?  uN ?4USt%5z <5v <5& & :% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff :%ށ̥a &  :e 3     U̥r 33w   uffx e55 DZ:fe& 8%eZ  ZT& 8%eV& 8%e@A@ 7r5%  & 8%mm  Pww D@et5r%=r vD  * 7d;x E 0 h w|e =r r̋u=rNet ; Net ;e  @et5Net :;5&f 4%  +7 w DC .  * 7% E N 2!f x8%  f  Twpu5&f % 4 +7 w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @u W-@Du Ae Buḁ.@e@- @Du@pHe _z(̋@pHeA Be vC ̂ xluuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ ? w5 4@E%@EU5N&e (; &e : Nf&e :%4 IN&e (; &e : Nf&e :%  (Ne& ?  ff eee@ 4t@t"4 4t = ,A_*w N =@ =N ,Aww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  2 ve@ 4tw"w D55ff %f&& "eff&e e &e 5 55 www5 5 w D5#X5ff T %f&& eff&e *ew6&e 7'44  && ef&& :e&e & B%%U w D5_.o5ff %f&& eff&e Ze L&e 78f f ff&e V e 744  && ef&& :e&e & B%%UUw @@m e%fe Z?  &e 5 55 3ff `%f&e@ &50c &e 5 55 3 9 U44  && ef&& :e&e & B%%&_.fffffe e _.&e % _/_.e_/  mm@ e@ f& ef&& :efe& B%%_. 3_.w @0 0 @0 N 077ww D85_1Ne& ?q fe Ve4-4-/44  &&  ef&& :e&e & :%%&e Z? &e 5 55 ewww4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  2 ve@ 4t4-4-/44  && ef&& :e&e & :%%&e Z? ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& :e&e$& :%%&e$ Z? `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& :e&e$& :%%&e$ Z? `Btp$t t"  ff Nef&& :e&e$& B%%Uw w r D5#5 5 wdw`wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& x8% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5lv@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm 8% a@ `` e w D a@@m e  w e  aAm HN@`@m &f 8%  aN f`f 8%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef C% ww  N Bww rDCDpC ? Z? wZw FN ,AwJ ~5 & E        ~5>wlYwfw Net@f ?e  w6w.w  U7U7Ae vB7   % 55 a  a!PE -R% w$ A `e vWt vw @ `e @  A%e U? `e 7U?Ԕ a7 ԰?U ew dDE wZw FD5 ,A 5N ?!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%Ϸmχ%w w7b*'$!     , 7"& A& BF7!W-L7& & "e Ӌ  &7& \e ӕ-ӕ0B~~ӕ.  ӕ0~ B~&7R & e 8ӕ-0 ,ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & ze w5 5  W- W00~u5  .luBw* J@B V_E@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff e w5  @ 0   Wp `e0w  :w]tww |  2=7 <6 +7 .7 Dw`w L   $ 7 l #%5# f RG  f RG N d(f&ψ ̥ ̥ 7z7~& RG  ̥̋ ̥ %& RG   pw`w LwwRw >D CKw4 ˋ 5 w DCB P  5 , :% & E& J; z   5 , @ :% & f E J;  (˥-%0     ,:% &  J; 8 5E& z   5 , @ :% & f E J;  ww Nefef 5& FJe C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @w^w Jfff 5& Jew8w $ fff 5& Jeww  5 %O N  = 555Ne5& Le555'0Ne5 B& Le57 Be0" 5%55 5 B5@B e a=%7w %5 B5Ne& Le55e0%7#`Jʕ0%ʕ1  %˕0 ʥ9 6@~  vX       updowntrailers-trailersarp-arpdebug-debugnetmaskmetricbroadcastipdstinetnsusage: ifconfig interface %s%s%s%s%s [ af [ address [ dest_addr ] ] [ up ] [ down ][ netmask mask ] ] [ metric n ] [ trailers | -trailers ] [ arp | -arp ] ifconfig: socketioctl (SIOCGIFFLAGS)ioctl (SIOCGIFMETRIC)ioctl (SIOCSIFNETMASK)Encapsulation Routingioctl (SIOCSIFADDR)ioctl (SIOCSIFBRDADDR)ioctl (SIOCSIFDSTADDR)ioctl (SIOCGIFFLAGS)ioctl (set metric)%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP metric %dioctl (SIOCGIFADDR) inet %s ioctl (SIOCGIFNETMASK)ioctl (SIOCGIFDSTADDR)--> %s netmask %X ioctl (SIOCGIFADDR)broadcast %sifconfig: socketioctl (SIOCGIFADDR) ns %s ioctl (SIOCGIFDSTADDR)--> %s ifconfig: %s: no such interface %s: permission denied %s: bad value %s=%o%s=%x/etc/networksrr# %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dDDDDDDDDDJJJJJJJ>>>>>>JJJJJJJJJJJJJJJJJJJJJJJJJJ444444%lx.0.%x%02x.%x%d.%d.%d.%dpp: Unknown error: %dlt~$6HZf| , ; J b o  1 N _ ~  @ W v  1 I j  1 @ T j  BWRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator))*L* ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired DdDoDxpEf~EepDgJEcVEsDlDLDuDDDODXDUl/etc/hostsr# =(\0 Tl" ;i R0R00j @- J e7cce7 /   7%  !w &%5 5 5 e @ȥ-v 4~ p% Oe %% Y~ p  !}  5 ~ p  !ue N 5 N~ p% !u w@7  @& %5  ! f %   !@ @& %@7  f %   !N~ p%f R f R   ! N t  !2  54~ p  N t  ! ?I p  lO %   U~ p Z ! M 4  u %   y~ p [ ! ! %  ~ p%\ ! f p% 0% N   ~ p ] ! ~ p ^ ! ~ p N t N$~ p% !w!w |! \ f e  f  N&   6w*!w ! N>  7 w]P w w   7 7 2 w w P>  7 rz 0%5#Rf   w| Uf  5=  Xf  N  J7. 7, 7 [&   ̥̋ ̥ %^&    ww D CKw ˋ 5 hw w D      + - ̥9 Wp @@`e̥0  w@w D  (7 -  s 3  33 a r w w+& f ew D Lԋwbww nDe LN 4ede   4eg Be v Nfe *%ww -@ |wNi %aw6w  BuNefef %%=@@w Jҋ~ @@yw&  4  b '     ` TW ~  s`K6!  w D85U5_ 5P_ n md@e4 ,5Ne & "  uN "4USt%f 5r 5~ 5& & ~% 45@e-4  % U5EU  wE w pD h +   r= wB wR5 a U5ff x%ށ̥a &  e 3     U̥r 33w   uff Xe55 Dfe& %e  \& %e& %e4@A@ 7r5%  & %mm  ww D@et5r%=r D  z 7; '   wHe =r r̋# =rNet  Net e  @et5Net 5&f 4% \ 7 T w DC 4.  z 7"% ' . 2!f Z%    w<u5&f % x 7 w 4$ " F w5 4@E%@EU5N&e  D &e  Nf&e x%4 IN&e  I &e  Nf&e x%  (Ne& "  ff eee@ 4t@t"4 4t t  $_ w N t @ t N $ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4tw"w D55ff %f&& "eff&e e &e  55 w2w.w5 5 w 0 Tl# ;i R0R00jD5#5ff T %f&& eff&e *ew6&e '44  && ef&& e&e & $%%U w D5_o5ff %f&& eff&e Ze L&e 8f f ff&e V e 744  && ef&& e&e & $%%UU"w @@m e%fe <"  &e  55 3ff `%f&e@ &50c &e  55 3N ~ p U44  && ef&& e&e & $%%&_fffffe e _&e % __e_  mm@ e@ f& ef&& efe& $%%_ _w @0 0 @0 N 7|7x ww D85_Ne& "q fe Ve4-4-/44  &&  ef&& e&e & ~%%&e <" &e  55 ewww4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4t4-4-/44  && ef&& e&e & ~%%&e <" ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& e&e$& ~%%&e$ <" `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& e&e$& ~%%&e$ <" `Btp$t t"  ff Nef&& e&e$& $%%Uw w r D5#5 5 wwwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& Z% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l$ @Et5lD 5lF u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm % a@ `` e w D a@@m e  w e  aAm HN@`@m &f %  aN f`f %  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef %% U4 4  fef %%5 w    6v&  @ppC`p   6@Cwzwtw D  & & e 4E05Ew7  Ћ P ы A@PЋ w FD:5UE5Hw* _5uNfe & $% _bNe & "  uN ")U5| m- 5 & $%St%r 8 " U   & $% S U _T @_Xw DE%%"5   & $% U wv w ^D55@   t 3 $ 4 4 4 4 4 ww~w  $f 5+ @ &5e-|"e %V & Z    " ww  5f " 7 f " 70wX@ m7f %V e w       " e-ww D f 5 e %V wn  5 e-Tw  !ww  N $ww rDCDpC " <" wZw FN $wJ ~5 & E        ~5>wlYwfw Net@f "e  w6w.w  \0U7N.U7D0B.:Ae vB&7 (  % 55 a  a!PE -%. w$ $ `e vWt vw@ `e @  $%e U?pp `e 7^.U?R a7D <>?62U ew dDE wZw FD5 $ 5N "!w5A vBB-  }ee@ !ۃ `!ւ ` `nm& E%vmp%w w7*'$!      7& A& BF7!W-2-7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu^ Bw* J@B |_'@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w  w]w|w h   7 ~  7 7 wLw 8 Z  V  7F l<: 0%5# f H)   f H)  w *D CKw ˋ 5 w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff .e A f&A@vee@ 5u 5 @#  W-@D# Ae B# ḁ.@e@- @D# @pHe _)̋@pHeA Be vC ̂ x uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw DCB P  5 , :% & E& , z   5 , @ :% & f E ,  (˥-%0     ,:% &  , 8 5E& z   5 , @ :% & f E ,  wT@(#)gettable.c 5.2 (Berkeley) 4/30/86*hosts.txtunknown option %s ignored hosts.verusage: gettable [-v] host [ file ] hostnamestcpgettable: hostnames/tcp: unknown service gettable: %s: host unknown gettable: socketgettable: bindgettable: connectConnection to %s opened. rwgettable: fdopenwgettable: VERSION ALL BEGINgettable: BEGIN sequence error ENDgettable: END sequence error ERRgettable: hostname service error: %s%s gettable: no BEGIN seen gettable: no END seen Host table received. Version number received. Connection to %s closed /etc/servicesrr# ,/ : Unknown error: %d"*4N^v2>J\k{%;JViz4Ul ,<Sw BWj B T f z RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired &d&o&x\'fj'e\&g6'cB'sl&ll&L&u&D&O&X&U /etc/hostsr# *+0+`+0 Ul 8 c e g R0R00i  (( e7cce7 /  7%  w @ d w<w (D* R ?E G ߬  -?% <& ߂ F  r݀5r<EX -X ?J%  <<& 0 F w5&< w bD LԋwZw FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%<   U   & % S U _n @_rw DE%%"5   & % U wv w ^D55@    3 ( 4 4 4 4 4 ww~w  $05+ t &5e-xVe %  & V     ww  5f  7 f  7wX@ m70% e w        e-ww D 05 e % wj  5 e-Pw . ww  N ww rDCDpC  V wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  XFU7JDU7@F>D6Ae vB"7 $  % 55 a  a!PE -%D w$  `e vWt vw@ `e @  %~e U?ll `e 7ZDU?N a7@ 8:?2.U ew dDE wZw FD5 ( 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `jm4& E%&m %w w7*'$!      7& A& BF7!pW-7\flcopy hasn't been implemented under 2.11BSD.,PP0 VlS7 9 ; = ? R0äR0ä0i D  e7cce7n /   7%  ~7w :p 55 %7 D p s#   ? lpff 4%% 9Nefe& V%  \8  fe "%5Bff %H %(fer %  ~7@ev5rBer@ex5( @ex@-[ z ~7/fp 4 A r@e@e@- V P =  @f s z ~7@ȥ/Wwv@et5r}prNe b 6 \   7 xN 6% f \ N 6Nrfp   \fp % : \  N 6f  _ \ _  _% ,   5  -  ? % 4& 4 3  ߦ 5  - ? % 4& t 4E 3  n% ~7w(7w 7 @e5f % ~7w6t  ;ewX6w 6w-|v @m7lȥ- b^> P-JD @7 %:f  ("   @f  @  @ \ @ \ ?w,6 ̥:7 *+~  w- @f  @~ @m7> p j4  9 E5 @@l w*.w p5DC E5<E@e33. @;E  5 , @;% & fE 3 5  B5U3 3  w4w.4Zw(4*J w4w 4D* R ?E G ߎ  -?v% 4& d 3  T݀5T4E: -: ?,%  4&  3 w354 w 3DeEE&E&E& e w3w |3D v 07l -b \. s 3  33 a r w w43+& f X3ew 2DLw2ԋ w 2D Lԋw2w 2DC @ / 7 0555  5  55@- 47@wH2w 42 @e5ff %w$2w 2D5 N*# %EAEt =_ F5]Ne NBfej %CaejNe ,GAej@ e`5 b ZBR N HQ %`52  T %` ӕ:ӕ Bej%_ mo N \Y %` 5 Nfej %`Aej@55 *@e`5^}^f@ej@A^1e^\^@^fe` %  DU> %0Nfej :%@-`R ffej e O5K 65h%D 4 ^ L3%5kfej h3 e>fej   NAej@f :%N 6 : & fh %%%wX/w D/D w>w6 57,%<n &%5,  %7%  L3 7b7%' %%6 %%z 6pwp.w \.\ 6R7wV.w B.DH 7@w<.bw-w ".N , w .w .D el&&&&Wpef Wpexf ew-w -5 5  AaAE f&A@vUU5u %w-w r-D wh-̥/ 55 3&f % e %Nfe 3 *fe h3 fe h3 ԥ.̋De &  & L3 %fe0 R3% 6 %,@e05e J wFNe$ J w8Ne( J w*%r _ _ % _ %2_ WpfWpeme, _ @e\5 N J f&te - @ E3 - *te5.N J f&@.e@.A Ep@.A Ep -* sf -3f _ - t-0 VlS7 9 ; = ? R0äR0ä0i_ -f77te5  ef7 - _ @ef7bw * Nefe 2w*7 \AWp@7 7  f  f 3 f77 w L*7 7 R7 P7 P,f 3 f77w.*w *0 N̋    2  w)w ) b @55 w-w-|  t  -^  t5, 5, -4 ܣue&&fe Xe3 efpef3w")w )& f e37w(w ( Q@f& ~ e5uQ@f& e5uumumu _eeQu  %QQ eu % ff et ff  e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ;ttwN&!w%\w%w .&De LN 34e<ex \  34e? Be v Nfe %w%w %-@ Tw%NA %ew$aw$w j%w&@7% ?@wR%N f w ,%DC_R̥%_8 5 r y _8 9% 5afe & 1%5@e5 5 N  _P 5 N  _P w$ _P _P _P  b% _P0 b% _P0 r  r f b% _P0 b% _P  b% _P  r  r f b% __P0 b% __P  __P __P0 b% __P __P  __P0e r& b% __P0e  @ r& b% __P0 b% _P_ _P_ _  _P_ _ _ _8 _% _b_pfe & 1%5@e5_| _8 _ _2 _8 _ _N _8 _ _h _80 el rdf b% _P_ _ _80 b% _P_ _ _ _8  _P_ _ _0 h_  _ _ Y% _ _ _^ G0 b% H_ _ _ - 2_ ! 0 el b% _ _ _ _ _?~ z ̋_j_w A r e0@ A r 5   % @  L %  wPw <D w@ ?w  fe 2@w @pHA@twRw n N!,&    w 1& &%7˕,Nf  w jD &  !     +  w6e% - r<N r<&@&  e ~ ~w  Nef h ww D 5  =& 8% `5ȥ=  = @wNe  w * BuNefef F;%=@@wЋ Ћ  Jҋ~ @@BI I7Iw  BuNeff F;%=@@wVw B fff ew8wyw&  4  b '     ` TW ~  s`K6!  w D85U5_ 5P_ t mj@e4 ,5Ne & 8  uN \84USt%(54 B55@ B55& & R3% 45@e-4  % U5EU  whE w F  uff Xe55 D fe& 1%e  & 1%e& 1%e<@A@ 7r5%  <x& 1%mjmf   wZw FD@et5r%=r D  N# 7; =   we =r r̋ =rNet 3 Net 3e  @et5Net 35&f 4% J z$7 B w XDC ".  N# 7% =  2!f .1%    xwu5&f % X z$7 w 4$ \8 $ w5 4@E%@EU5N&e 3 &e h3 Nf&e L3%4 IN&e 3  &e h3 Nf&e L3%  (Ne& 8  ff eee@ 4t@t"4 4t 6 9_h#w N 6@ 6N 9wzw fDff %5u4 4 @ A f&A@EE4tmm@ 4 t  l+ ve@ 4tww D55ff %f&& "eff&e e &e - 55 wwPwb5 5 w DD5#5ff T %f&& eff&e *ew&e /'44  && ef&& X3e&e & :%%U w vD5_'o5ff %f&& eff&e Ze L&e /8f f ff&e V e 744  && ef&& X3e&e & :%%UUw @@m e%fe 7  &e - 55 3ff `%f&e@ &50c &e - 55 3@ D2 U44  && ef&& X3e&e & :%%&_x'fffffe e _x'&e % _'_x'e_'  mm@ e@ f& ef&& X3efe& :%%_x' v,_&w @0 0 @0 N p)77Tww D85_|*Ne& 8q fe Ve4-4-/44  &&  ef&& X3e&e & R3%%&e 7 &e - 55 ew wXw4 et 5-5-5 5 w ~D4 4 @ A f&A@EE4tmm@ 4 t  l+ ve@ 4t4-4-/44  && ef&& X3e&e & R3%%&e 7 ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& X3e&e$& R3%%&e$ 7 `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& X3e&e$& R3%%&e$ 7 `Btp$t t"  ff Nef&& X3e&e$& :%%UwD w 0 D5#5 5 whwd\w  @ a@ a@m5A a@5w D 5# aB- f a@m& .1% w e aC-w ^ D@ A 5@u@e@ 5u   w, uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l 5l u te%w L D5u-5 w2 @e@- @ a@ a@ a5@ a@@@m`&fNm 1% a@ `` e w D a@@m e  wj e  aAm HN@`@m &f 1%  aN f`f 1%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef F;% B5U4 4  fef F;%5 wZ    6v&  @ppC`p   6@Cw8w27, Ћ P ы A@PЋ w FD:5UE5Hw* _(55uNfe & :% _(5bNe & 8  uN \8)U5| m- 5 & :%St%4 h $8 U   & :% S U _3 @_3w DE%%"5   & :% U wv w ^D55@ B5  6 3 9 4 4 4 4 4 ww~w  `$(5+ ` &5e-4Be % &     7 ww  5f 7 7 f 7 7`wX@ m7(%e w   z    7 e-^ww D J(5 e %w&  5 e- w 5 7ww  N :ww rDCDpC \8 7 wZw FN 9wJ ~5 & E        ~5>wlYwfw Net@f V8e  w6w.w  zU7xU7zxAe vB7   % 55 a  a!PE -%x w$ \: `e vWt vwf@ `e @  \:%>:e U?(( `e 7xU?  a7 ?U ew dDE wZw FD5 9 5N \8!w5A vBB-  }ee@ !ۃ `!ւ ` `&m& E%Էmԇ%w w7*'$!     ( 7& A& BF7!W-C7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_=@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff .e w5  @ 0   Wp `e0eӕ?w  &Bw]w|w h  57 ,& z$7 7 wLw 8 s ? 7v ll %5#uf >  xf > bN ?f&ۈ ̥ ̥ 747{& >  ̥̋ ̥ %Z~& >   *wLw 8ww>w *D CKw ˋ 5 w D  +   r= wB w5 a U5ff L3%ށ̥a &  X3e 3     U̥r 33w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff e A f&A@vee@ 5u 5 @  W-@D Ae B ḁ.@e@- @D @pHe _@̋@pHeA Be vC ̂ xuuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw D B5 & & X3e 4E05Eww DCB P  5 , :% & E& 3 z   5 , @ :% & f E 3  (˥-%0     ,:% &  3 8 5E& z   5 , @ :% & f E 3  w*z/usr/ucb/fingerfingerdslp:illegal option -- %cgetpeername: %squery from %s must provide username fowarding service denied -lpipe: %sexecv: %s: %sfork: %srfdopen: %s: illegal option -- : option requires an argument -- %d.%d.%d.%d/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d &6NXr "4CSbs".ARh -D^+Op/Bdw , > R h RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator8 ? F N X a h q y ZdNlSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%yu y , h   TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired `\\> !  9  & %ue%N 5% # \;  NC 5% # \;%aZf ^7Y eNe 5 # \;N  Ne 5 f %N @   # \;Ne 5   N   # \;w*=w =N l N 5@5@w  )ff *!%       e >  \;Ne $!ff % w ;D & % Wp$e@Wp$eP~WpeNWpef z7 % & 5 5  >  \; Wp,Wp$NWp$fWp$@f&Wp$@f&Wpeff 5e %N 9w:w :D & 5  5 _6 Nfe 0$% lfe : 5a=   uf : 5D= FNWpef z7 Wp$eNWp$efWp$efWp$eff e 5% NW 5% %N 9 _f  Wp_p WpeNWpef ^7 %%bWp1Wp$@f&Wp$@  Wp$efWp$^Wp$@f&Wp$@&% Wp$Wp$Wp$efWp$^, Wp$Wp$ C-_`%U WpJWpeNWpef z7 Wp$1 Wp$1 Wp$@0 0 Wp$@0 0 Wp$@f&Wp$@  Wp$efWp$^ % %~ & V %w7w 7D̋C w7 ˋ  w v7Di  wr7w T7DCBP  5_L Nef X#uB@&gfe "eNefe X#ԁu-Nef& ze Y%  zm 5% 2 fe 6 5 Wpf& f 67efef 6%  ; 5 Ne > N 9_fe ; N 9eAe P~s@ z7 e$e_A@v5uA@v5uA@v5u > w5w 5DCB<5 5  5 5%e$e %ʋwJ5 F7 V F7 Ne X# ef& ze 6 5 >  & & t,ef&f 67ee5v f&@@v f&@@ v f&@ ef `>%%  5  > N 9_ w3w3w 4Nef w 4w 3  5/f #@Nevf& %@ 6   \Tw3v@ev5xt%t t@t @aAt AmpxNev 0  %ч 2Nfev 0      w 2DCB̥:̋ ҕ/Ҕˋ ̋ w2 | ;ew"2 w2w 2D̥: ̋̋w|2w h2 C Wp De` ˋi ˋ =K ˋˋ w*2w 2* 0$%w2= X @0 X @0 X :&fe z % &fe z %w 1  $  & 77 | wn1w T1 hb 97 ZwJ1w 61 H   5%%w1w 0 p  N& ^7w0 w 0 B  N& ^7w0 pw 0   N& ^7w0 @/w/w b0 2  . L  wT0  5 ff L% 50  8 w /  uN 75&f %5w/ 5  f ^7  0   w z/ p  @e5ff l%5wN/ 5  w-   4 w . 0 Wl V   R0R00h 6  &  &%7 w. ^7*5=f & 7l  w . hw.w z. t  w|.wZ w \. 0 * (7 "    97  wB.w ..wRw4.w .   @ E w . $5% %  0$%   #?  7 B&  7z E&   7b H&   7J K&  7@ N&   87" w Q&   87 w T&  7 W&  7 Z&  7 _w ,  w,  7  , -55 ffb te55H  D8 2 & &5%e& &5%e& &5%e    & &5%e7 w +  _] ^7_@_Di5 & f 6%5=d 85u fff 67e5 #u 1f 6%50 := N 9w+w +D      + - ̥9 Wp @@`e̥0  w*w *D5 5      + -! ̥9 f& ff !eee@ ee@ 5u̥0 A@  w,*A@w)w *Nef `%w)w )Neff `%w)w )D A555  ԋuNeffe `%w)w )DC 5 5 _%%_5 %*e5  AWp `eui  0u%l5  %h%[ Pi e  _Neffff e   * O  A@ EN $5% % % %Nf ^# &    %_| A@ E%Nf ^# @w'N $5 w 'N%c%s%[Nf ff f& Pew'5 5 5 5 %e%f %o%xDe5 5 A @ EN $% % % %- Ԑ A @ EN $ _%+_  _%a%f %A_&%F_& % A@vN $O% A@v@mAm@ vA@v5ui 0 %a%fW7 5`u`u C% S P Ԑ A @ E =i %%.%e%E- *% ' $ ! Ԑ A @ EN $%+%-%0%9 A@  5u% N  ^# =   @e! @e! _T@t@]   x|Ne A _TNe A @H@pHw $DC = 5%c%0u5 %s    $%r|%c5 %[r|      $%%   ^# =  D- %cw# w #D ̥^  ||| % %]%-+ | $%-̥]4  | ̠ | || %]  w"w "D*\5% %-%+ 5 55 55  B5eA5 i %.55  B5eA5 i  %E%e$%+%-  Wp B`ei   @`5 @ 5AupAm%55 @5A5u555555  55555AupN& e5 55w !6 m 7"w Nf  w wR w Nf , w ~w6 w 4De _ t4 t t4 4t Ne&& #% _t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5  55 Nefe #% & p%5u7  && #%  fe #%ff <% fe& #%wXA@E f& w .Rw4w D Lԋww DC  w5 7@  55@- 7 5!w De LN 74ee2  74e Be v Nfe *$%w2w -@ wN "%w  Nef ! ww D 5  =v& 0#% `5ȥ= P = @we  w d Nef !@wXw > f !@w8 w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef X#,5@ 'Nef X# %ʕ/  f 6% %0%  w`Nef X#ҕaʋʥzi ʕaw  BuNefef @%=@@wЋ Ћ  Jҋ~ @@&w w D% 5     |@wV4-  wSwmown#lw e& 7 7gwbw  & f $$eww>yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_%5P_%  m@e4 ,5Ne & ;  uN :<4USt% 5X 95T 95& & 6% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff 6%ށ̥a &  67e 3     U̥r 33w 4$ :< w5 4@E%@EU5N&e z7  &e F7 Nf&e 6%4 IN&e z7  &e F7 Nf&e 6%  (Ne& ;  ff eee@ 4t@t"4 4t 9 ~=_'w N 9@ 9N ~=ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  / ve@ 4tw"w D55ff %f&& "eff&e e &e p1 55 ww(w5 5 w D5#65ff T %f&& eff&e *ew6&e T3'44  && ef&& 67e&e & `>%%U w D5_(+fo5ff %f&& eff&e Ze L&e T38f f ff&e V e 744  && ef&& 67e&e & `>%%UUw @@m e%fe ;  &e p1 55 3ff `%f&e@ &50c &e p1 55 3  5 U44  && ef&& 67e&e & `>%%&_+fffffe e _+&e % _X+_+e_X+  mm@ e@ f& ef&& 67efe& `>%%_+ 0_R*w @0 0 @0 N -7.7*,ww D85_.Ne& ;q fe Ve4-4-/44  &&  ef&& 67e&e & 6%%&e ; &e p1 55 ewFwB0w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  / ve@ 4t4-4-/44  && ef&& 67e&e & 6%%&e ; ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& 67e&e$& 6%%&e$ ; `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& 67e&e$& 6%%&e$ ; `Btp$t t"  ff Nef&& 67e&e$& `>%%Uw w r D5#5 5 ww4wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& 4% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5lj @Et5l 5l u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm &5% a@ `` e w D a@@m e  w e  aAm HN@`@m &f &5%  aN f`f &5%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef @% 9U4 4  fef @%5 w    6v&  @ppC`p   6@Cwzwtw D 9 & & 67e 4E05Ew7p Ћ P ы A@PЋ w FD:5UE5Hw* _95uNfe & `>% _9bNe & ;  uN :<)U5| m- 5 & `>%St%  < U   & `>% S U _7 @_7w DE%%"5   & `>% U wv w ^D55@ 9  9 3 ~= 4 4 4 4 4 ww~w  Z$ 5+ &5e-.e % &     p; ww  5f p; 7 f p; 7wX@ m7 %e w   t    p; e-Xww D D 5 e %w  5 e-w 9 :ww  N f>ww rDCDpC :< ; wZw FN ~=wJ ~5 & E        ~5>wlYwfw Net@f 4 `e vWt vw`@ `e @  :>%84e U?"" `e 7PU? a7 ?U ew dDE wZw FD5 ~= 5N :<!w5A vBB-  }ee@ !ۃ `!ւ ` ` mZ& E%LзmFЇ%w w7@*'$!      7& A& BF7!W-F7& & e Ӌ  &7L& e :ӕ-4ӕ0B~ ӕ.  ӕ0~ B~&7 & Le ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_A@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& 7 z   5 , @ :% & f E 7  (˥-%0     ,:% &  7 8 5E& z   5 , @ :% & f E 7  w&w Nefef 5& Ee C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& XEeww  fff 5& XEeww  5 %O N  = \555Ne5& Fe555'0Ne5 B& Fe57 Be0" 5%55 5 B5@B e\ a=%\7\w %5 B5Ne& Fe55e0%7`Jʕ0%\ʕ1  %\˕0 ʥ9 6@~ /tmp/EdP.aXXXXXquotasUsage: %s [-p username] username ... %s: permission denied -p%s: no such user You have too many processes forkEDITOR/usr/ucb/viwedquota: fs %s blocks (soft = %ld, hard = %ld) inodes (soft = %u, hard = %u) rCan't re-read temp file!! blocks (soft = %ld, hard = %ld) inodes (soft = %u, hard = %u) %s: bad format %s/%sWarning: %s Quotas are not compiled into this kerneledquota: read error in %s: not in /etc/fstab /edquota: /bin/shPATH:/bin:/usr/binsh/etc/fstabr/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd66@  $: Unknown error: %dhpz 2DVbx (7F^k-J[z <Sr - E f   - < P f   > S RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator. ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 8Ad@oAxAfAe@gAcAs@l@LAuAD@OAX0AU=(\0 Xl 8    R0R00g  (( e7cce7 /  7%  w @ d w<w (D* R ?E G ߬  -?% <& ߂ F  r݀5r<EX -X ?J%  <<& 0 F w5&< w bD LԋwZw FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%<   U   & % S U _n @_rw DE%%"5   & % U wv w ^D55@    3 ( 4 4 4 4 4 ww~w  $05+ t &5e-xVe %  & V     ww  5f  7 f  7wX@ m70% e w        e-ww D 05 e % wj  5 e-Pw . ww  N ww rDCDpC  V wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  XFU7JDU7@F>D6Ae vB"7 $  % 55 a  a!PE -%D w$  `e vWt vw@ `e @  %~e U?ll `e 7ZDU?N a7@ 8:?2.U ew dDE wZw FD5 ( 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `jm4& E%&m %w w7*'$!      7& A& BF7!pW-7\dumpfs hasn't been implemented under 2.11BSD.,PP0 Yl :  R0~R0~0g  *( e7cce7 /  7%  w @ d w<w (D* R ?E G ߮  -?% >& ߄ F  t݀5t>EZ -Z ?L%  >>& 2 F w5(> w bD LԋwZw FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%>   U   & % S U _n @_rw DE%%"5   & % U wv w ^D55@    3 ( 4 4 4 4 4 ww~w  $25+ v &5e-zXe %" & X     ww  5f  7 f  7wX@ m72%"e w        e-ww D 25 e %"wl  5 e-Rw . ww  N ww rDCDpC  V wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  ZHU7LFU7BH@F8Ae vB$7 &  % 55 a  a!PE -%F w$  `e vWt vw@ `e @  %e U?nn `e 7\FU?P a7B :DE%@&5 5 57$ -4%e$Q "e 4Ne w   "d'ed$` "e ^4  d' 0 w D,$  0 5    4o " 4# "ewL w 8 D ,7vu5  ff %5u  !&eff 2eEaelL 4, Ă w w   ff ef&"# eN f# z %@- ff eN f wN w :   W-@tm" W-" "  w   feZ"f& 2e@t@aw DC->2-:2 02$2 1`~'2 ~'wz  w ^ 2$7 1 & 1 vf& ef&! e 1B %w ~'! T%%1w D | vWt wr1@e7j1 & \1 vf& ef&>! e >1B %w ~'! z %%1 w w P D5 5      + -! ̥9 f& ff leee@ ee@ 5u̥0 A@  w A@w 6fef %5 w w D Lԋw $w h Nef @w\ w B  f @w< w $ D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef ,5@ 'Ne&  %ʕ/  f t % %/% / wdNef ҕaʋʥz)ʕa&w ww D5"E@e44fef %  U4 4  fef %5 w   @ppC`pww7. w FD:5UE5Hw* _ 5uNfe & T% _ bNe &   uN .)U5| m- 5 & T%St%6  U   & T% S U _ @_ w DE%%"5   & T% U wv w ^D55@    3 r 4 4 4 4 4 ww~w  +$*5+ + &5e-+n+e % & n+    d ww  5f d 70+ f d 7wX@ m+7+**%e w  * *    d e-*ww D **5 e %w*  5 e-h*w x ww  N Zww rDCDpC . wZw FN rwJ ~5 & E        ~5>wlYwfw Net@f (e  w6w.w  p)7U7b)7U7X)7V)7N)Ae vB:)7 <)  2)%,) 55 a  a!PE -(%7 w$ . `e vWt vw(@ `e @  .%((e U?(( `e 7r(7U?f( a7X( P(R(?J(F(U ew dD&(E wZw FD5 r 5N .!w5A vBB-  }0 Zl r R0}R0}0gee@ !ۃ `!ւ ` `'m& E%m%w w7('*'$!     X 7N& A>& BF7! W-7 w 8uDAB %u f& & e w5 5  W- W00~u5  .lu"Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& z   5 , @ :% & f E  (˥-%0     ,:% &  8 5E& z   5 , @ :% & f E  w/tmp/dchkXXXXXXCan't create tmp file: %s Bad flag %c cannot open %s %s: %u bad; %u/%s %u arg; %u/%s entries link cnt %u %d %d read error %ld %u - huge directory lseek error %d in tmp file write error %d in tmp file lseek error %d in tmp file read error %d in tmp file . ((((( AAAAAABBBBBB 777doxfegcslLuDOX.U0 [l" @ R0zR0z0f @2  e7cce7  / b  7%  *w -vNefe& % N t%%  * % .   * &  |&%7   cfe& e * @        (  & %@a0 Ne & % cfe& e׀%T   7 F w b, & !% wZ,w F,4  W x * Ne ,+ Kw- Fw 'w- "@e7 80 ,  p+7   * & p &eN\ &%  r,7F wx+w d+6 Wp,Dm@f $  X5uf&e % ff& e,-`w+w *DL& %Ne 5@ _&e e_ &e e  _    * # 5 , % -Net@@ & j+e55 CD7 &efe %5   @fe Ff t%efffef eN ( -w)w p)Dwf # _ f f De05 fe "% R $   yfe % fe %  fe  fe& t%eNe &5  XN& t%%wh(w T( De t4 tt 4 4 Ne&& !% w(  eu @ wj' w\'w 'DE5_% _L _L5`uu '& & &e5u%%wZ' @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & &e5u %%    "%%%_5 V(5 5 E4N ff & &e W _%_>%_>_w %D5 5      + -! ̥9 f& ff leee@ ee@ 5u̥0 A@  wB%A@fw$Ww$w$w %4De _n  t4 t t4 4t Ne&& !% _n t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5  55 Nefe !% & %5u7  && !%  fe !%ff % fe& !%w#A@E f& w #rw#w #D Lԋwz#w f# @e5ff %wV#w B#D5 N# %EAEt =_ 5]vNe Nfej t %CaejNe Aej@ |e`5  `   t %`5   t %` ӕ:ӕ Bej%_ mo N > t %` 5 Nfej x!%`Aej@55 \*@e`5^}^f@ej@A^1e^^@^fe` !%`  U %Nfej -%@-`R ffej pe O5K H5h%D 4  |&%5fej & e>fej  NAej@f -%N ) - & fh !%%%^w w v D ww 57%<0  %5,  v%7%  |& 77v%n'` %%T@ %%0 )&ww  )7fww tD 7wnbww TN  wRw >D el&&&&Wpe&f Wpef t eww 5 5  AaAE f&A@vUU5u %ww D w̥/ 55 &&f  e %Nfe & fe & fe0 [l @ R0zR0z0f & ԥ.̋De &  & |& %fe0 &% ) %,@e05e ,wNe$ ,wNe( ,w%r_ _% _%2_rWpffWpem`e, _@e\5 N ,f&t8:e - @ E3 - *ter5.N ,f&@.e@.A Ep@.A Ep - s -3 _ -p t-dx_ -T7b7\ter5  e78 - _@e7w  Nefe w7 AWp@7  7  f 4  & 77 w ~7 7 7 7  & 77w`w L  ̋  t  t  2  ww   @55 w-w-  t v -  t5,8 5,: - uer&&fe Xe3 epJe3wTw @& f eVw,w  Q@f& e5uQ@f& e5uumumu _eeQu  %QQ eu % ff &et ff `e5u< ff et< ff (eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A~ 5 8u 4  A~ f&A@ 5u r  r   A~ @mAm@ 5u e4 tWpeNu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw!w\ww `De LN &4ee >  &4e Be v Nfe !%ww -J@ wN t %ew(aw"w w@7% ?@wN f w ^DC_4̥%_ 5 r y _ 9% 5afe & $%5@e5 5 N  _2 5 N  _2 w_ _2t _2 _2  D% _20 D% _20 r  r f D% _20 D% _2  D% _2  r  r f D% _n_20 D% _n_2  _n_2 _n_20 D% _n_2 _n_2  _n_20e r& D% _n_20e  @ r& D% _n_20 D% _2_n _2_n _n  _2_n _ _ _ _n% _nb_Rfe & $%5@e5_^ _ _t _ _ _ _0 _ _ _J _0 el rdf D% _2_n _ _0 D% _2_n _ _ _  _2_n _ _ h_ _ _ Y% _ _ _@ G0 D% H_n _ _ - 2_n ! 0 el D% _n _ _ _  _n? ̋__pw 2A r e0@ A r 5   %( @  L %(  ww nD wr h b ^?Zw Du@t5254@ 5Nefef !% (3A@u5Btr422@ Aup fef !% u-u-u-@ww  fe @w~ @pHA@tww F !,&   w, 1& %7 ˕,Nf 4 w D   !     +  we% - r<N r<&@&m  t e ~ ~w 0 Nef  w*w D 5  =& % `5ȥ=  = @w e  w BuNefef Z.%=@@wx Ћ Ћ  Jҋ~ @@&w Sw mow n(!lwz e& 7 *7"gwL BI I7Iw BuNeff Z.%=@@wv w b Nff !ewV w B  fff !ew8 w yw &  4  b '     ` TW ~  s`K6!  w D85U5_#5P_#  m@e4 ,5Ne & ,+  uN p+4USt%z 5V V(5R V(5& & &% 45@e-4  % U5EU  wh E w F D > +   r= wB w( 5 a U5ff |&%ށ̥a &  &e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef Z.% V(U4 4  fef Z.%5 w>    6v&  @ppC`p   6@Cww7j Ћ PPЋ w FD:5UE5Hw* _<(5uNfe & -% _<(bNe & ,+  uN p+)U5| m- 5 & -%St%  8+ U   & -% S U _& @_&w DE%%"5   & -% U wv w ^D55@ V(  ) 3 , 4 4 4 4 4 ww~w  $z 5+ &5e-e %j &     * ww  5f * 7 f * 7wX@ m\7Zz P%j e w  : ,    * e-ww D z 5 e %j w  5 e-w ( 2*ww  N -ww rDCDpC p+ * wZw FN ,wJ ~5 & E        ~5>wlYwfw Net@f j+e  w6w.w  @U7>U7@>Ae vB7   % 55 a  a!PE -J%> w$ p- `e vWt vw@ `e @  p-%e U? `e 7>U? a7 ?U ew dD|E wZw FD5 , 5N p+!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%߷m߇%w w7V*'$!     f 7\& AL& BF7!.W-27w 8uDAB %u f& & e w5 5  W- W00~u5  .lur Bw* J@B |_&0@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& & z   5 , @ :% & f E &  (˥-%0     ,:% &  & 8 5E& z   5 , @ :% & f E &  w@(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)comsat.c 5.11 (Berkeley) 3/29/88/dev/%s: getsocknamecomsat/usr/spool/mailchdir: /usr/spool/mail/etc/utmp.main: /etc/utmp: %mmalloc failed%s: wrong mode on %snotify %s on %s wfopen of tty %s failed %s New mail for %s@%.*s has arrived:%s ----%s rFrom:Subject:%s%s ...more...%s ----%s /usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d .>J\n 3Rap8Wt6f}!;Wo  0 D W f z  - F h } RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator   & * / 4 ; E M V <Fd0N|SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y    % ) ,- 1 h5 9 = A E I M Q Y ] a e i TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d&JJR/d8/oD/x0f0e/g/c/s/l/LZ/u^/D A@ 3@5%@ A@,@% A@ EN@E&NE +  @_ w D'5  Nefe& fef e Nef@f |0e @w&w & De t4 tt 4 4 Ne&& &(% w&  eu @ w%w f&DE5_f% _ _ 5`uu '& & ~+e5u%%w% @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & ~+e5u %%    )%%%_J 5 h-5 5 E4N ff & ~+e W _J %_ %_ _J hw#}w#fw#w 8$D  @!7 -  s 3  33 a r w w#+& f ~+e&& e& & %ReR$ @  1  x "@! 0 \l `F R0=R0=0f@#E B Ew # 2%w#pw"w "4De _ t4 t t4 4t Ne&& &(% _t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5  55 Nefe :(% & %5u7  && &(%  fe :(%ff % fe& &(%w!A@E f& w |!w!w n!D Lԋwf!w R! @e5ff %wB!w .!D5 N# %EAEt =_5]Ne %N6fej '%CaejNe 4;Aej@ e`5 N F:> : 4E '%`5  H '%` ӕ:ӕ Bej%_mo N dM '%` 5 Nfej (%`Aej@55 *@e`5^}^f@ej@A^1e^P^@^fe` )%  0U* %Nfej 2%@-`R ffej e O5K H5h%D 4 R r+%5_fej + e>fej '  NAej@f 2%N ,. 2 & fh (%%%vwvw bD w*w" 57% <hbh &%5,  %7%   r+ 77%' %%fv %%f ,.\ww zH ,.>7wtw `D4 7,wZbww @N 4 w>w *D el&&&&Wpef Wpelfv 'evww 5 5  AaAE f&A@vUU5u %ww D w̥/ 55 +&f  e %Nfe + fe + fe + ԥ.̋De &  & r+ %fe0 x+% ,. %,@e05e RwNe$ RwNe( Rw%r_ _% _%2_WpfWpeme, _@e\5 N Rf&te -T @ E3^ -8 *te5.N Rf&@.e@.A Ep@.A Ep - s  -3  ^_ - t-_ - 77te5  e 7n -R _@e 7Nw  Nefe %w7 AWp@7B <7 > f Z&   +  77 w j7 7 7 7    +  77wLw 8X$ '̋      2  w w   @55 8 w-6w-.  t  -  t5, 5, - ]ue&&fe Xe3 e pe 3w@w ,& f e'+ww  VQ@f& e5uQ@f& e5uumumu _eeQu  %QQ eu % ff et ff 0e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 /ttwl!w\ww LDe LN +4e0e d  +4e3 Be v Nfe )%ww -@ HwN5n '%newaww w@7% ?@wpN f w JDC_Z$̥%_@$ 5 r y _@$ 9% 5afe & V*%5@e5 5 N $ _X$ 5 N $ _X$ w _X$ _X$ _X$  j$% _X$0 j$% _X$0 r  r f j$% _X$0 j$% _X$  j$% _X$  r  r f j$% __X$0 j$% __X$ $ __X$ __X$0 j$% __X$ __X$ $ __X$0e r& j$% __X$0e  @ r& j$% __X$0 j$% _X$_ _X$_ _ $ _X$_ _ _ _@$ _% _b_xfe & V*%5@e5_ _@$ _ _:  _@$ _ _V  _@$ _  _p  _@$0 el rdf j$% _X$_ _  _@$0 j$% _X$_ _! _ _@$ $ _X$_ _ _8! h_" _  _ Y% _  _  _f! G0 j$% H_ _! _ - 2_ ! 0 el j$% _ _  _! _$!> : _?0 , ̋__w A r e0@ A r 5   % @  L %  $wnw ZD w^ ?w 0u@t55@ 5 Nefef :(% (3A@u5Btr2@ Aup  fef :(% u-u-u-@w w x  fe %@wj @pHA@tw w 2 b '!,& '   w 1&P &%7E˕,P Nf Z& w D   !     +  w e% - r<N r<&@& P 'eP  ~ ~w  Nef (' w w  D 5  = & '% `5ȥ=  = @w e  w BuNefef l3%=@@wd Ћ Ћ  Jҋ~ @@&w Sw mow| nN(lwf e& 7 b7Zgw8 NB@I I7Iw BuNeff l3%=@@wb w N  fff (ewD w yw w $ D85U5_@*5P_@*  m@e4 ,5Ne & >0  uN 04USt% 50 h-5, h-5& & x+% 45@e-4  % U5EU  wE  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5b   6v&   6@Cw8w27 Ћ P ы A@PЋ w FD:5UE5Hw* _N-5uNfe & 2% _N-bNe & >0  uN 0)U5| m- 5 & 2%St%  J0 U   & 2% S U _ , @_,w DE%%"5   & 2% U wv w ^D55@ h-  ,. 3 1 4 4 4 4 4 ww~w  ^$ 5+ &5e-2e % &     / ww  5f / 7 f / 7wX@ m7 %e w   x    / e-\ww D H 5 e %w$  5 e- w - D/ww  N 2ww rDCDpC 0 / wZw FN 1wJ ~5 & E        ~5>wlYwfw Net@f |0e  w6w.w   U7 U7  Ae vB7   % 55 a  a!PE -%  w$ 2 `e vWt vwd@ `e @  2%<8e U?&& `e 7 U? a7 ?U ew dDE wZw FD5 1 5N 0!w5A vBB-  }ee@ !ۃ `!ւ ` `$m>& E%0ܷm*܇%w w7*'$!      7& A& BF7!zW-,77fw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_85@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& + z   5 , @ :% & f E +  (˥-%0     ,:% &  + 8 5E& z   5 , @ :% & f E +  wJJ  /@axtftpdioctl(FIONBIO): %m recvfrom: %m fork: %m socket: %m bind: %m connect: %m netasciioctet/../rwtftpd: write: %m tftpd: read: %m tftpd: write: %m tftpd: read: %m Undefined error codeFile not foundAccess violationDisk full or allocation exceededIllegal TFTP operationUnknown transfer IDFile already existsNo such usernak: %m @(#)tftpsubs.c 5.5 (Berkeley) 6/1/90longjmp botch longjmp botch /usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d*BLfx (7GVg{"5F\v!8RtCd} # 6 X k x  2 F \ v RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator, 3 : B L U \ e m v | !b"l""""$#V#t####"$SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%yi m u y , h   TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB  d4dJ4oV4x5f"5e4g4c4s$4l$4Ll4up4DN4OZ4X4U0, ]l K{ }  R0R00e @; e7cce7 / 0  7%  /w 2r x  6*  //+ 7 3 6*  /  /5 nNn . n% n T + & & V + 5n qt fn b0eNn ._ > o  /V !  p%? J    /. $ 5p=p? #%  + 7n 8  .  + 7H D    / V  D%7    /fer  ^e    /7 %    /   /P ! >Ne>fe& ,feDB De 5B B%*  p- N P %DENeP  ff   eNeP(fet B$%fet +%5@Net0ABe r5:fJfH %%5HuJ5 <@<t@arpf& |%%B \   /4 Ne $A@@A f& "%3se - fe `  t@a0C & !%f&t$& %5 Z"f& !%7(w&@@&& f Xe u   l > | % / w*w * & fefefe $e %    /ff %7pwnw\*w H**@e5Neif b0e   w*uA r 57  f +  @eAP~ h0N +  h04  1 e N& +  h04  1&fe |)%Nei f b0e   55t5Nei f b0e &fe |)%5Nei f b0e &fe |)%5@h p07,_ w B( De t4 tt 4 4 Ne&& %% w(  eu @wX' wR'|wL' w>'w6'w 'D & fefefe $e wx'%  @a0uWtAm !w *'H L  f +e  f + N& +  6w&w & , ( 7 "+w]w&w &  -7 7 w&w v& . ( 7r rh: &%5#0f  w3f 5=  6f N  P7779&  ̥̋ ̥ %<&   w~%w j%D CKw`% ˋ 5 Zw$hw$w *%D      + - ̥9 Wp @@`e̥0  w$}wL$WwF$w8$iw2$w $D Lԋw$w $ @e5ff %w$w l$D5 N^# %EAEt =^_l45]DNe Z"Nvfej B$%CaejNe {Aej@ Je`5    B$%`5   B$%` ӕ:ӕ Bej%_mo N  B$%` 501 ]l K{ }  R0R00e Nfej L&%`Aej@55 **@e`5^}^f@ej@A^1e^^@^fe` &%  U p%Nfej 2%@-`R ffej~ >e O5pK N5h%D 4  +%5fej t+ e>fej $  NAej@f 2%N . 2 & fh &%%%w!w !D ww 57%<` #%5,  D%7l% L + 7TP 7D%<'. %%" %% .w w  .7w w D 7w bw w ~ N  w| w h D el&&&&Wpef Wpef B$ew* w  5 5  AaAE f&A@vUU5u %ww D Fw̥/ 55P +&f . e %Nfe + ^fe t+ fe t+ ԥ.̋De & z & + %fe0 +% . %,@e05e wNe$ wNe( w%r_X _X% _X%2_XWpfWpeme, _X@e\5 N f&t68e -L @ E3 -0 *tep5.N f&@.e@.A Ep@.A Ep - s -3 _X - t-v_X -707*tep5  e7 -J _\@e7w  Nefe "w7 AWp@7: 47 6 f #  + 77 w 7 7 7 7 ` + 7V7Pww vPd #̋  B  B  2  wHw 4  @55 0 w-.w-&  t t -  t5,6 5,8 - uep&&fe Xe3 epe3w~w j& f eg$kwVw B Q@f& e5uQ@f& e5uumumu _TeeQu  %QQ eu % ff et ff ,e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ottw!w\ww De LN +4epef   +4es Be v Nfe &%ww -@ wNu B$%ewRawLw w@7% ?@wN f w DC_!̥%_ 5 r yR _ 9% 5afe &, |)%5@e5 5, N x! _! 5: N x! _! w _! _!" _!  !% _!0 !% _!0 r  r f !% _!0 !% _!  !% _!  r  r f !% _<_!0 !% _<_!0 x! _<_!3 _<_!0 !% _<_!E _<_!N x! _<_!0e r& !% _<_!0e  @ r& !% _<_!0 !% _!_<P _!_< _< x! _!_< _ _ _ _<% _<b_ fe &: |)%5@e5_, _  _B _ _  _f _ _  _ _ _ 0 el rdf !% _!_< _ _ 0 !% _!_< _ _ _ + x! _!_< _ _ h_ _ _T Y% _p- _t _ G0 !% H_< _ _x -9 2_< ! 0 el !% _< _R _ _6 2 _<?( $ ̋__>w 0A r e0@ A r 5   %& @  L %&  x!ww D w ?w nu@t5052@ 5Nefef %% (3A@u5Btr220@ Aup fef %% u-u-u-@ww  fe "@w @pHA@tww p #!,& $   wV 1& #%7=˕,Nf # w D Z  !     +  we% - r<N r<&@&  B$e ~ ~w Z Nef # wTw @D 5  =>& $% `5ȥ=  = @we  w  BuNefef H4%=@@wЋ Ћ  Jҋ~ @@&w w B%Nf f fff %e _%&g %]@ D  %0  Q% 80 - f + % xF c  = ?   @ ǃVwH w Sw %lw e& 7 J7Bgwp 6B(I I7Iw BuNeff H4%=@@w w  fff &ew| w yw &  4  b '     ` TW ~  s`K6!  w D85U5_p(5P_p(  m@e4 ,5Ne & $0  uN h04USt%n5z N-5 N-5& & +% 45@e-4  % U5EU  w E w D  +   r= wB wl 5 a U5ff +%ށ̥a &  d+e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef H4% N-U4 4  fef H4%5 wt    6v&   6@Cwzwtw D N- & & d+e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _4-5uNfe & 2% _4-bNe & $0  uN h0)U5| m- 5 & 2%St%z  00 U   & 2% S U _+ @_+w DE%%"5   & 2% U wv w ^D55@ N-  . 3 1 4 4 4 4 4 ww~w  $n5+ &5e-e %^ &     / ww  5f / 7 f / 7wX@ mb7`nV%^e w  @ 2    / e-ww D n5 e %^w  5 e-w - */ww  N 2ww rDCDpC h0 / wZw FN 1wJ ~5 & E        ~5>wlYwfw Net@f b0e  w6w.w  >U7<U7><Ae vB7   % 55 a  a!PE -P%< w$ h2 `e vWt vw@ `e @  h2%e U? `e 7<U? a7 ?U ew dDE wZw FD5 1 5N h0!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%ܷm܇%w w7*'$!     b 7X& AH& BF7!*W-;7& & e Ӌ fj &7& e ӕ-ӕ0B~ӕ.  ӕ0~ B~fj&7 & Le nӕ-0 bӕ.V B~ӕeH ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .lulBw* J@B V_6@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& + z   5 , @ :% & f E +  (˥-%0     ,:% &  + 8 5E& z   5 , @ :% & f E +  w&w Nefef 5& <9e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& 9eww  fff 5& 9eww  5 %O N  = H555Ne5& ;e555'0Ne5 B& ;e57 Be0" 5%55 5 B5@B eH a=%H7Hw %5 B5Ne& ;e55e0%7`Jʕ0%Hʕ1  %H˕0 ʥ9 6@~ rwhod: not super user whoudprwhod: udp/who: unknown service //dev/tty/usr/spool/rwho/usr/spool/rwhorwhodgethostname: %m/etc/utmp/etc/utmp/etc/utmp/etc/utmp: %msocket: %msetsockopt SO_BROADCAST: %mbind: %mrecv: %m%d: bad from portmalformed host name from %xwhod.%s%s: %mrwhod: malloc failed /etc/utmp/devchdir(/dev): %m/usr/spool/rwhochdir(%s): %m/usr/spool/rwhocannot get boottime: %mioctl (get interface configuration)ioctl (get interface flags)ioctl (get dstaddr)ioctl (get broadaddr)/etc/servicesrr# ,/ /usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec>Bmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d.6@Zj (>JVhw $1GVbu!@ax8H_ , N c v   , N ` r   RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorl s z  2P J t SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y , h     TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/usr/bin:/bin:/usr/ucb:/usr/local:/usr/new:/etcb%j%b%r%%z%%%%%%%%%%%%%% ((((( AAAAAABBBBBB $@5d&5o25x5f5e4g5c5s5l5LH5uL5D*5O65X^5U=(\0A ^lȕ D R0R00d 4d  e7cce7 /   7%  ,w *0Nefe& % N, t'%1 Z ,Ne& w/w /B  4   4   4  f f f < 5 AWp B`eufef (%% ,  <  %5 ,f %  ,< N ZA1ff T%  , Zfe %cfe %lfe % Ne ` 5t T , @fe  5@f ( T ,@  T , /% _fNe *5% T , _: x+ x+ x+N x+N x+ 5vf& 5vUU5uNe~ff -euu & & fe be 5v50u0fef (%   5v5@u@@f  5v50u0)fef (%5f   5v5@u@ Nfef /%   , &  N x+N x+f @%N x+@ h@f @ T :@& %9@& %f~ %/@& N 5 @5 fef@& e@ Z ,w6+w "+N ffffe eNe )fe /%w*w * fe& (%% ,}   N T  ,w*w * De t4 tt 4 4 Ne&& x% wF*  eu @w *  X@m4 t@m4( %  v 5   %ww t 5 )( %wu   Wp0`@p DWp0`@p \ % % 4D %0wd)w P) @m3t %@5 u `3 %  AWp0`AD@DmA@x3 %0 WpDtWt@`Wt@`Wt@` @`@`Wt@`utE4tE4 E4E4 % tA@x` %  t %  %_J Ĝt`3t` %  @`Hs %@w'w '  4$ %B   tE4$ % B%@$ ` 4$ %B B f%Z%9.  t5Wp`ADuWp`eDfWp`^\Wp`q\ % %  $ & %   Wp`A$BP %e.%9e%Zeh % 4h  fw& w& w&w%w v&"5  @ @ap t- 5N m& ()%N" t'% rNef ~H Zw%@ @a0  m  w % `R  7 (w%w % tn +7 fw%w z%DC  ̋̋wh%w T% 4 bR  7  Ev %7 :& 7 :&  V7  :&  &  %,& ̋ xw$w$$Zw$*J w$hw$w z$     L  wl$ 5 ff L% 50   8 w $  uN )5&f %5w# l 5  ^ f ( `  0   w # p  @e5ff l%5wf# 5  w-    4 w #  (  &  ~%7 w"t (5f  7B  w " w"w " t  w"w0 w t"   7    +7 wZ"w F"w,wL"w 8"   @ E w$" F5% %0 %  0 00  7^&  7P&   V78&   V7 &  7&   7w&   7w&  7&  7&  7_bw  P w  7 b nX 55 ff8 e550F ^lƔ D R0R00d P D0& &%e& &%e& &%e(& &%e7w   _R (__5 & f |(%5=: 5u fff (e5 #u 10f (%5000 :=0N x+w4w D      + - ̥9 Wp @@`e̥0  ww D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  wDA@w]ww Nf  w PwxRwrwlw Nf  w~wPwJ ы ~ w D Lԋww DC V wv5 7B@  55@- 7 5!bww De LN )4eep   )4e Be v Nfe %ww -@ wNd %dawe& ;eww Bu@t5x5z@ 5Nefef ~% (3A@u5Btrz2x@ Aup fef ~% u-u-u-@ww  BuNefef 0%=@@wZЋ Ћ   Ћ Ћ Sw~lwn e& 7 7gw@yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_5P_ D m:@e4 ,5Ne & -  uN -4USt%5 *5 *5& & (% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff |(%ށ̥a &  (e 3     U̥r 33w 4$ - p w5 4@E%@EU5N&e ) &e ( Nf&e |(%4 IN&e ) &e ( Nf&e |(%  (Ne& -  ff eee@ 4t@t"4 4t x+ /_w N x+@ x+N /ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  ve@ 4tw"w D55ff %f&& "eff&e e &e # 55 w`w\8w5 5 w D5#5ff T %f&& eff&e *ew6&e $'44  && ef&& (e&e & /%%U w D5_,o5ff %f&& eff&e Ze L&e $8f f ff&e V e 744  && ef&& (e&e & /%%UULw @@m e%fe @-  &e # 55 3ff `%f&e@ &50c &e # 55 3 t' U44  && ef&& (e&e & /%%&_fffffe e _&e % __e_  mm@ e@ f& ef&& (efe& /%%_ !_w @0 0 @0 N 77<ww D85_Ne& -q fe Ve4-4-/44  &&  ef&& (e&e & (%%&e @- &e # 55 eww@w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  ve@ 4t4-4-/44  && ef&& (e&e & (%%&e @- ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& (e&e$& (%%&e$ @- `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& (e&e$& (%%&e$ @- `Btp$t t"  ff Nef&& (e&e$& /%%Uw w r D5#5 5 w wDwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& ^&% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l 5l u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm &% a@ `` e w D a@@m e  w e  aAm HN@`@m &f &%  aN f`f &%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef 0% *U4 4  fef 0%5 w    6v&  @ppC`p   6@Cwzwtw D * & & (e 4E05Ew76 Ћ P ы A@PЋ w FD:5UE5Hw* _*5uNfe & /% _*bNe & -  uN -)U5| m- 5 & /%St%  - U   & /% S U _X) @_\)w DE%%"5   & /% U wv w ^D55@ *  x+ 3 / 4 4 4 4 4 ww~w  $5+ j &5e-Le % &     - ww  5f - 7J f - 7wX@ m 7%e w       - e-ww D 5 e %w  5 e-w + ,ww  N /ww rDCDpC - @- wZw FN /wJ ~5 & E        ~5>wlYwfw Net@f -e  w6w.w  bU7|`U7rbp`hAe vBT7 V  L%F 55 a  a!PE -%` w$ / `e vWt vw@ `e @  /%e U? `e 7`U? a7r jl?d`U ew dD@E wZw FD5 / 5N -!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%߷m߇%w w7*'$!     ^ 7T& AD& BF7!&W-x47w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_2@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& 0) z   5 , @ :% & f E 0)  (˥-%0     ,:% &  0) 8 5E& z   5 , @ :% & f E 0)  w@(#) Copyright (c) 1983 Regents of the University of California. All rights reserved. @(#)rexecd.c 5.4 (Berkeley) 5/9/86USER=HOME=SHELL==~%s: getpeernamePATH=:/usr/ucb:/bin:/usr/binusernamepasswordcommandLogin incorrect. Password incorrect. No remote directory. Try again. /bin/sh-c%s too long :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     initgroups: %s is in too many groups setgroups/etc/grouprrh/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd: Unknown error: %d,<HZl~ 1P_n 6 U r  4 d {   9 U m  . B U d x  + D f { RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired Hll1d1o1x`2fn2e`1g:2cF2sp1lp1L1u1D1O1X1U0U _l X S0]~S0]~0c Ft  e7cce7d /   7%  L9w  - 7%:f  ( $f v $ v $ > $ > ?w/ ̥:7 8*+0* w-. $f v $/ @m7RQ B 9 E5 @@l w'w \.DC E5<E@e33. @;E  5 , @;% & fE 5 5  7U3 3  w-w -B  f N5e  f N5 N& N5  6wH-w 4- bR . 7 4w]w-w -  t77 |7 w,w ,0Z _l X S0]~S0]~0c j dR . 7V rL\ \%5#ff   wif  5=  lf  N ( 7f7d7Xo&   ̥̋ ̥ %$r&    w+w +D CKw+ ˋ 5 w +D      + - ̥9 Wp @@`e̥0  wd+w L+DeEE&E&E&v& e &w+}w*w *fef >%5 &w* ]wJ*zwD*w *D Lԋw*bw"*w *N  Lw*w *D el&&&&Wpef Wpef8 e8wH*w 4*5 5  AaAE f&A@vUU5u %w*w )D w)̥/ 55& |5&f L" e %Nfe j5 4fe 65 fe 65 ԥ.̋De &  & 4 %fe0 4% 7 %,@e05e wnNe$ w`Ne( wR%rH_ @_% 4_%2_ WpfWpeme, _@e\5 N f&tXZe - @ E3  - *te5.N f&@.e@.A Ep@.A Ep -R s ->3 . _ - t-_ -7b7\te5  e78 - _@e7w ,' Nefe w'7 AWp@7 7  f P  j5 77 w &7 >7 z7 x7 x6 j5 77w&w &: ̋      2  wf&w R&  @55 w-w-  t  -  t5,X 5,Z -\ ue&&fe Xe3 epe3w%w %& f e=VAwt%w `% Q@f& e5uQ@f& e5uumumu _eeQu  %QQ eu % ff et ff Je5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 Ettw"!w4"w "De LN |54eFe"   |54eI Be v Nfe V%w<"w ("-P@ ^w""NK0 %0ewv!awp!twj!w !J !,&    w! 1&D %7C˕,DNf P w !D   !     +  wN!e% - r<N r<&@& D eD ~ ~w Nef  w w D 5  =B& % `5ȥ=  = @wf e  w F BuNefef >%=@@w Ћ Ћ  Jҋ~ @@  E6P6 EPyw&  4  b '     ` TW ~  s`K6!  w D85U5_5P_  m@e4 ,5Ne & 9  uN *:4USt% 5 75$ 75& & 4% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff 4%ށ̥a &  &5e 3     U̥r 33w   uff e55 Dfe& 3%e  z& 3%e|& 3%e@A@ 7r5%  & 3%m~mz  vww D@et5r%=r D  $ 7v;: :@ 0 * w|e =r r̋ =rNet N5 Net N5e  @et5Net |55&f 4%  &7 w DC . 0 $ 7%X :@ N 2!f 2%  (  wpu5&f % & &7  w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @  W-@D Ae B ḁ.@e@- @D @pHe _"̋@pHeA Be vC ̂ x uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ *: w5 4@E%@EU5N&e j5 &e 65 Nf&e 4%4 IN&e j5 &e 65 Nf&e 4%  (Ne& 9  ff eee@ 4t@t"4 4t 7 n;_$w N 7@ 7N n;ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  , ve@ 4tw"w D55ff %f&& "eff&e e &e `/ 55 www5 5 w D5#5ff T %f&& eff&e *ew6&e D1'44  && ef&& &5e&e & P<%%U w D5_)Lo5ff %f&& eff&e Ze L&e D18f f ff&e V e 744  && ef&& &5e&e & P<%%UUlw @@m e%fe 9  &e `/ 55 3ff `%f&e@ &50c &e `/ 55 3$ 3 U44  && ef&& &5e&e & P<%%&_)fffffe e _)&e % _H)_)e_H)  mm@ e@ f& ef&& &5efe& P<%%_) ._B(w @0 0 @0 N *77ww D85_,Ne& 9q fe Ve4-4-/44  &&  ef&& &5e&e & 4%%&e 9 &e `/ 55 ewww4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  , ve@ 4t4-4-/44  && ef&& &5e&e & 4%%&e 9 ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& &5e&e$& 4%%&e$ 9 `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& &5e&e$& 4%%&e$ 9 `Btp$t t"  ff Nef&& &5e&e$& P<%%Uw w r D5#5 5 wHwDwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& 2% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm 3% a@ `` e w D a@@m e  w e  aAm HN@`@m &f 3%  aN f`f 3%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef >% 7U4 4  fef >%5 w    6v&  @ppC`p   6@Cwzwtw D 7 & & &5e 4E05Ew7V Ћ P ы A@PЋ w FD:5UE5Hw* _65uNfe & P<% _6bNe & 9  uN *:)U5| m- 5 & P<%St% ~ 9 U   & P<% S U _5 @_5w DE%%"5   & P<% U wv w ^D55@ 7  7 3 n; 4 4 4 4 4 ww~w  $ 5+ &5e-le % &     `9 ww  5f `9 7r f `9 7vwX@ mH7F <%e w  &     `9 e-ww D  5 e %w  5 e-w t7 8ww  N VwlYwfw Net@f $:e  w6w.w  U7U7Ae vB|7 ~  t%n 55 a  a!PE -6% w$ *< `e vWt vw@ `e @  *<%e U? `e 7U? a7 ?U ew dDhE wZw FD5 n; 5N *:!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%Էmԇ%w w7&*'$!     > 74& A$& BF7!W-`F7& & "e Ӌ  &7& \e ӕ-ӕ0B~ӕ.  ӕ0~ B~&7d & e Jӕ-0 >ӕ.2 B~ӕe$ ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & ze w5 5  W- W00~u5  .lu Bw* J@B V_?@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff e w5  @ 0   Wp `e0w  4w]6ww |  t77 NH &7 @7 w`w L ] . 7 l \%5#_f A  bf A LN "f&܈ ̥ ̥ 7h7be& A  ̥̋ ̥ %h& A   w`w LwwRw >D CKw4 ˋ 5 w DCB P  5 , :% & E& 5 z   5 , @ :% & f E 5  (˥-%0     ,:% &  5 8 5E& z   5 , @ :% & f E 5  ww Nefef 5& De C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @w^w Jfff 5& Dew8w $ fff 5& Deww  5 %O N  = 555Ne5& RFe555'0Ne5 B& RFe57 Be0" 5%55 5 B5@B e a=%7w %5 B5Ne& RFe55e0%7`Jʕ0%ʕ1  %˕0 ʥ9 6@~ H  tJ$tJ$$Source: /usr/users/louie/ntp/RCS/ntp.c,v $ $Revision: 3.4.1.6 $ $Date: 89/05/18 18:21:29 $UnspecifiedSymmetric ActiveSymmetric PassiveClientServerBroadcastReserved-1Reserved-2ntpudpudp/ntp: service unknown; using default %d vsf No such host: %s ntp socketconnectsendntp select*Timeout* Host %s is not responding recvfromPacket from: [%s] Leap %d, version %d, mode %s, poll %d, precision %d stratum %d (%s) [%s] Synch Distance is %04x.%04x %f Synch Dispersion is %04x.%04x %f Reference Timestamp is %08lx.%08lx %sOriginate Timestamp is %08lx.%08lx %sReceive Timestamp is %08lx.%08lx %sTransmit Timestamp is %08lx.%08lx %sInput Timestamp is %08lx.%08lx %s%.20s: delay:%f offset:%f Offset too large - use -f option to force clock set. Can't set time from %s - unsynchronized Can't set time (settimeofday)tJ$$Source: /usr/users/louie/ntp/RCS/ntpsubs.c,v $ $Revision: 3.4.1.3 $ $Date: 89/05/18 18:33:50 $%d.%d.%d.%d: illegal option -- : option requires an argument -- /etc/servicesrr# ,/ %d.%d.%d.%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d 0@Xb| ,>M]l},8K\r 7 N h   5 Y z  $ 9 L n  $ 6 H \ r RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorQ U ] a i m ,q u hy }   TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d$4$^$$ ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired ?d>o>x?f?e>g?c?s>l>L ?u?D>O>X ?UR/etc/hostsr# =(\0n `lx K ,0oV,0oV0b-0.0556178160 -0.0556178160 0.0000000000 0.0000000000 0.0000000000 2 87 0p alDA R & & 0b @ ( ecce7  w   .% hG  h wlw XD* R ?E G ߂ ~v -v?j% & X J  H݀5HE. -. ? %  &  J w5 a7w  $ 5+ &5e-e % &      w"w  5f  7H f  7w@ m7 %e w        e-ww pD  5 e %wX  5 e-w D Pw$w  N  ww DCDpC   ww N Zw ~5 & E        ~5w vD:5UE5KwZ _5 @5Nfe & B% _gNe &    uN -U5 @< m- @% 5 & B%St%   U   & B%  @ U _r @_vw DE%%"5   & B% U w w |D55@    3 Z 4 4 4 4 4 w07T>7DY74w Net@f e  w67w   U7U7 Ae vB7   % 55 a  a!PE -% w&  `e vWt vwR@ `e @  %*&e U? `e 7U? a7 ?U ew fDE w\w HD5 Z 5N !w 5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%77*'$!     N 7D& A4& BF7!W- 7NOYES**0t bl5t ed f h j l R0R00b U> e7cce7l# / ,  7%  Fw I l%Nefe& 2% N PA% $ Ife& e   | Ne&  w8Iw $I., X<" ^B%7."' "" : |  F v !77 ` wHw H !!!P @%el ^-!!X|T @%el 0-!!w\Hw HHFpRn!j!p`!0 NeP! . 5 @!Apz .! XB 5 % %sf   f 8  Bm ȕt XB 5 qt f bGeN E XB 5 f   f x f   + p,  + H XB 58 f  Net@f bGe Ne tf bGeNet@f bGeENe tf bGeNfe 1%5u @f& v%5wrwj ~ @5f  Nf  N EN E f 8 f 8 f 8 N E 7 \#8 & f +e f  wEw |ENfe Z.%Ne Bfef I% FwLEw 8E| ffe Z.eNef  wEw Dfe F  C r vf&A r t@aUUZfe& & f e5%%    C r vf&A r t@a&50w@D w (DNNe~ff bGeNe~ff bGeNeptf bGefe e +  +  & ֝S  ^G  ^t Z.%eh @fe  J* @%e:Ne B*fe @%Ne B7` > @%e _ fe F fe F fe F  A r f vf&A r t@aUUA r f vf&A r t@aUUDB `A r f vf&A r t@aUUA r f vf&A r t@aUU A r f vf&A r t@aUU fefefe e%%%_  _  r f vf&h r t@a&50B8 r f vf&  r t@a&50 ^B%7%#7  _ A r f vf&A r t@a&5%0#A r f vf&A r t@a&50_ f ^B%7 %#87 \ _  <  7 <>"%7ğ E %? ? |% , ^E% PE H?L H b?> : TA r f vf&A r t@a&50   nA r f vf&A r t@a&50 ( _2 _2 Jwl>w X>_L x7 _L% _L%v_L T_L% T? _L  xd 7 ._L  B e  lNett@ bGe@%   7~ Net@ bGe%@@5@%0 ,P 7N JFRR_LH_L>_L4_L?%_L% %@# %@#? j%@#f? a%" _0 _0  V_0 _0  _0 _0  ^_0 _0  _0 ,%%ğ E *F _  |%(   F Ӏw;w ; @% 1 %  3%@0Nf Z.%ezwx;   @7 Z  ^ hdjw ; @   @0Nf Z.%ew: &   w : @  x%@0Nf Z.%ew~:   @  w D: @ &  0y bl1q ed f h j l R0R00b@Nf Z.%e w:@0w 9E  2  ȵ& Be7-ğ E7 e ? %?w9w l9 Net@ bGeu]uMNe t\ bGew09w 9 Net@2 bGe5 ?Net@  bGe @? w8w 8 \Net@ bGe5 ?Net@ bGe @?` \w`8w L8 NL5 >` I%5 wm$-77w8w 7@E%@  x@eDeE%E%w7@E ڃ@ew 7 -JE%@E%9E%2  DE%E% E% 5f& @%um7!캇 7!w7 w6w 6 5-,  N I%5% f fp :%e5 %#wmJ-HD7 @-887,7*w&6w 6  T4   Fw6w 5<5  XB _TNe& $G N hG55 |  i fNf& ^B%5 r,5uIef .% 9@4 A A f&& dBeHfe -%Ife -%Ne( r,,f& I% e,AWp,AmA- E 5  XB , eb# -%Jj# -%Ky# -%# r,,b#& I% E~   & p %L Bm^ ȕpR   & D %w4w3wz3|wt3 wf3w^3ZwX3w 3DeEE&E&E&R# Z.e #w3Ww 3w 3fef RJ%5 wp3 ]w2Rw2iw2w2w @34De _8 t4 t t4 4t Ne&& .% _8t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 R 55 Nefe .% & %5u7  && .%  fe .%ff % fe& .%w1A@E f& w 1J w1w 1D Lԋw1w 1 @e5ff %w1w p1D5 N|# |%EAEt =_hn 5]fNe r,Nfej Z.%CaejNe Aej@ F%e`5    Z.%`5   Z.%` ӕ:ӕ Bej%_mo N % Z.%` 5 Nfej b/%`Aej@55 L*@e`5^}^f@ej@A^1e^^@^fe` /%8  U l%Nfej I%@-`R ffej :%e O5K d5h%D 4  XB%5fej tB e>fej .  NAej@f I%N E I & fh /%%%w.w .D ww 57%<# -%5,  @%%7% j XB 7vr7f%^'P |$%%D#0 %% EXw-w - E7>w-w -D 7w-bw-w -N  w-w l-D el&&&&Wpef Wpef<# Z.e#w.-w -5 5  AaAE f&A@vUU5u %w,w ,D dw,̥/ 55n B&f 2% e %Nfe B |fe tB fe tB ԥ.̋De & v$ & XB %fe0 ^B% E %,@e05e wNe$ wNe( w|%rr_T j_T% ^_T%2_TJWpf>Wpem8e, _T@e\5 N f&t##e - @ E3) - *te+5.N f&@.e@.A Ep@.A Ep -| sd+ -h3d+ X)_T -H t-<+_T -,d+7R7Lte+5  ed+7( - _X@ed+7w * Nefe ,w*7 AWp@7 7  f - d+ B d+77 w )7 h7 7 7 ~d+ B d+7x7rw)w z)  -̋  >  >  2  wL)w 8)  @55  w-w-  t + -  t5,# 5,# - ܡ)ue+&&fe Xe3 ed+ped+3w(w n(& f eFwZ(w F( +Q@f& e5uQ@f& e5uumumu _P"eeQu  %QQ eu % ff 8et ff re5u< ff et< ff :eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A8 5 8u 4  A8 f&A@ 5u r  r   A8 @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw%!w%\w%w %De LN B4ee %  B4e Be v Nfe /%w%w %-:@ w%N+ Z.%+ewV$awP$w $wx@7n% ?b@Xw$N f %w $DC_*̥%_* 5 r yp _* 9% 5afe &J @%5@e5 5J N t+ _* 5X N t+ _* w# %_*. %_*@ %_*  +% _*0 +% _*0 r  r f +% _*0 +% _*  +% _*  r  r f +% _8&_*0 +% _8&_*N t+ _8&_*Q %_8&_*0 +% _8&_*c %_8&_*l t+ _8&_*0e r& +% _8&_*0e  @ r& +% _8&_*0 +% _*_8&n %_*_8& _8& t+ _*_8& _% _% _* _8&% _8&b_&fe &X @%5@e5_(& _* _>& _& _* _b& _& _* _' _' _*0 el rdf +% _*_8& _' _*0 +% _*_8& _' _% _*I t+ _*_8& _& _' h_( _& _P& Y% _l'K _p' _ ( G0 +% H_8& _' _t& -W %2_8& ! 0 el +% _8& _N' _~( _' _8&? ̋_%_:&w +A r e0@ A r 5   %+ @  L %+  t+ww D w @ : 6?2e& ;eww Vu@t5+5+@ 5T,Nefef .% (3A@u5Btr+2+@ AupT, fef .% u-u-u-@ww  fe ,@w @pHA@tww X -!,& .   w> 1&, -%7˕,,Nf - w D x  !     +  we% - r<N r<&@&' , Z.e, ~ ~w B Nef - w<w (D 5  =& .% `5ȥ= Z = @we  w  BuNefef RJ%=@@wЋ Ћ  Jҋ~ @@&wSwmown/lw e& 7 D7'44  && ef&& dBe&e & I%%U w vD5_6o5ff %f&& eff&e Ze L&e >8f f ff&e V e 744  && ef&& dBe&e & I%%UUw @@m e%fe F  &e < 55 3ff `%f&e@ &50c &e < 55 3b PA U44  && ef&& dBe&e & I%%&_6fffffe e _6&e % _6_6e_6  mm@ e@ f& ef&& dBefe& I%%_6 ;_5w @0 0 @0 N |877.ww D85_9Ne& $Gq fe Ve4-4-/44  &&  ef&& dBe&e & ^B%%&e F &e < 55 eww.w4 et 5-5-5 5 w ~D4 4 @ A f&A@EE4tmm@ 4 t  x: ve@ 4t4-4-/44  && ef&& dBe&e & ^B%%&e F ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& dBe&e$& ^B%%&e$ F `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& dBe&e$& ^B%%&e$ F `Btp$t t"  ff Nef&& dBe&e$& I%%UwD w 0 D5#5 5 ww.w  @ a@ a@m5A a@5w D 5# aB- f a@m& :@% w e aC-w ^ D@ A 5@u@e@ 5u   w, uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l8@Et5lX5lZu te%w L D5u-5 w2 @e@- @ a@ a@ a5@ a@@@m`&fNm @% a@ `` e w D a@@m e  wj e  aAm HN@`@m &f @%  aN f`f @%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef RJ% NDU4 4  fef RJ%5 wZ    6v&  @ppC`p   6@Cw8w27 Ћ P ы A@PЋ w FD:5UE5Hw* _4D5uNfe & I% _4DbNe & $G  uN hG)U5| m- 5 & I%St%  0G U   & I% S U _B @_Bw DE%%"5   & I% U wv w ^D55@ ND  E 3 H 4 4 4 4 4 ww~w  $z5+ ( &5e- e %j &     F ww  5f F 7 f F 7wX@ m\7ZzP%je w  : ,    F e-ww D z5 e %jw  5 e-w D *Fww  N Iww rDCDpC hG F wZw FN HwJ ~5 & E        ~5>wlYwfw Net@f bGe  w6w.w  8.U76.U78.6.Ae vB7   % 55 a  a!PE -J%6. w$ hI `e vWt vw@ `e @  hI%e U? `e 76.U? a7 ?U ew dD|E wZw FD5 H 5N hG!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%ƷmƇ%w w7*'$!     n 7d& AT& BF7!6W-T7"w 8uDAB %u f& & e w5 5  W- W00~u5  .lurBw* J@B |_L@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w  Sw]w|w h  D7 rl 37 d7 wLw 8  O 7 lB. N%5#f M  f M N Pf& ̥ ̥ 7h.7b& M  ̥̋ ̥ %/& M   .wLw 8ww>w *D CKw ˋ 5 &  4  b '     ` TW ~  s`K6!  w xD85U5_O5P_O  m@e4 ,5Ne & $G  uN hG4USt%z5@ ND5< ND5& & ^B% 45@e-4  % U5EU  wJE w (D  +   r= wB w 5 a U5ff XB%ށ̥a &  dBe 3     U̥r 33w @D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff e A f&A@vee@ 5u 5 @7  W-@D7 Ae B7 ḁ.@e@- @D7 @pHe _P̋@pHeA Be vC ̂ xuuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw D ND & & dBe 4E05Eww DCB P  5 , :% & E& B z   5 , @ :% & f E B  (˥-%0     ,:% &  B 8 5E& z   5 , @ :% & f E B  wX%c%c%c%c 2.11 BSD UNIX () "" 8 , T > 0 p   ( 2  8 ttttTERM=<2222/usr/adm/wtmp/etc/utmptelnetd%s: getpeernamesetsockopt (SO_KEEPALIVE): %mttloop: read: %m ttloop: peer died: %m /dev/ptyXX/dev/pty/dev/ptyp/dev/ptyp0123456789abcdefAll network ports in use/dev//dev/ttyfork/bin/loginlogin-h-p/bin/logintelnetd: %s. %s: %s select [Yes] telnetd: panic state=%d telnetd: panic state=%d utmp malloc failed/dev/%d.%d.%d.%d/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec\`mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %dLT^x(:F\ht *BOet.?^ 7Vf} ) J l  4 J l ~ " 7 RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator   ()).)L))))*F*p***SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y , h         # TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired .//JKd0Ko @ B D R0ǨR0Ǩ0a ;| e7cce7t /   7%  3w 67 5O u) vG h F@ ? p  J S Y T ,  .#@    8  .% 357 Sff %5% 5`  N , `e  P 3 p   %  .% 3& %7wv7wX& %w >&  /eWpBuN 47  .  3N  /%@- > l      l p-eB^ , (  3w 5D  7(    w 4 54  w4  A, v f& /e /%%L & $ .e  A, vf&N /e: /%%V & V %w 3: 8- . &8&  /efe /%% >  f %w3w 3H5  4 f&  /eBfej /%%B fH ^ %w>3u : Neff % R :  f e@  x"  N  @ = x& N % f T &%& fff& fE@& e_TN _Tw 2@E     @  ` =w1%)-159w 1 Am@ f& /eDfe /%%D dfl ^ %_ rlAm@ f&V /efe@ /%%kf .(Am@ f& /efe /%%sf% zfe, 0 . Am@ f& /efe, /%5L fz ^ %5,@@mL0,% Nffe, N@ &,fe, e@ _ x8N %3 *  Am@ f& /e*fe` /%%*f_&Nt   w/ N N   Am@ f&j /efeNT /%% T@e(5&5 <& &-& &5>& &=&NTfe( %Nfw . @ % & ' ( ) * + ,N  wt.w . %5 @ ! @ &&  /e fe /%%  > %w-Nf@& %w -t- t-=wt-  w V-6Nef ~N h wB- 45  .  3TwL@E%` @p@p @0 @p@pw , &  /%7# h 3 & - /%76 h 3 & ? /%7~I h 3wX,w D, X NfS %w8,w $, 8 Nf"s ew,w +  ff /efe /%% f ^ %A w+w + T  3w+w +w- @m7ȥ- > - 7R%:f ` (v n h f T  T     ?w* ̥:7 *+  w- f T  @m7 ~ 9 E5 @@l w"w .*DC E5<E@e33. @;E  5 , @;% & fE <0 5  1U3 3  w)w l)f  5wV)N0fe 2e%_Z%%%  %%%cNe >5uu5 Ne D5u fff 0e ?f  55D 55444  ,05@-5e  % . N $2N $2@_<CeXN 2e%  @ A@bl@ f&f 0e Nffe* 2eDNe*& /0 clK< > @ B D R0ǨR0Ǩ0a 4 e   w R'DE5_% _8 _85`uu '& & /e5u%%w& @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & /e5u %%    R%%%_5 15 5 E4N ff & /e W _%_*%_*_w >%D >5u5mu A@w"%w %D 5u5 A@w$w $De m@ e@ 5u%% du %e u 5mu A@w$w t$D 5u5 A@wX$w D$D%%055  m@ 5u%% e du %umumu 5umumu A@w#w #   L  w# 5 ff L% 50   8 w J#  uN ,05&f %5w# 2 5  $ f / &  0   w " p  @e5ff l%5w" 5  w-    4 w J" l f / \  &  %7F w"8 /D5Wf  7  w ! w!w ! t  w!w w !  7   $27 w!w z!ww!w l!   @ E wX!n R5% %V  %   `Y  7$ \&  7 _&   .7b&   .7e&  7h&   7wk&   7wn&  7q&  7t&  7v_:w * J ( w$  7 ( z% %55 ff e55 ( D& -%e& -%e& -%e& -%e7nw   _*w /__5 & f /%5= 5u fff /e5 #u 1 f /%50   := N 2whw TD      + - ̥9 Wp @@`e̥0  ww D5 5      + -! ̥9 f& ff Deee@ ee@ 5u̥0 A@  wxA@ww PDC AupB 4  & -%b R5% 傎& -%`@ @m A &@w  w fef 7%5 w w D Lԋww zDC  wn5 7@  55@- 7 5!w De LN ,04ee   ,04e Be v Nfe %ww -\@ wN! %!w b BuNefef 7%=@@w6Ћ Ћ &wW f r @  W f r@  @ yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_5P_  m@e4 ,5Ne & 4  uN 44USt%5 15 15& & /% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff /%ށ̥a &  /e 3     U̥r 33w 4$ 4 w5 4@E%@EU5N&e 0 t&e / Nf&e /%4 IN&e 0 y&e / Nf&e /%  (Ne& 4  ff eee@ 4t@t"4 4t 2 6_w N 2@ 2N 6ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  ' ve@ 4tw"w D55ff %f&& "eff&e e &e * 55 w2w.!w5 5 w D5#~5ff T %f&& eff&e *ew6&e +'44  && ef&& /e&e & 7%%U w D5_#o5ff %f&& eff&e Ze L&e +8f f ff&e V e 744  && ef&& /e&e & 7%%UUw @@m e%fe L4  &e * 55 3ff `%f&e@ &50c &e * 55 3~ . U44  && ef&& /e&e & 7%%&_#fffffe e _#&e % _#_#e_#  mm@ e@ f& ef&& /efe& 7%%_# (_"w @0 0 @0 N %7|7x!ww D85_&Ne& 4q fe Ve4-4-/44  &&  ef&& /e&e & /%%&e L4 &e * 55 eww!w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  ' ve@ 4t4-4-/44  && ef&& /e&e & /%%&e L4 ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& /e&e$& /%%&e$ L4 `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& /e&e$& /%%&e$ L4 `Btp$t t"  ff Nef&& /e&e$& 7%%Uw w r D5#5 5 ww"!wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& j-% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5lT @Et5lt 5lv u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm -% a@ `` e w D a@@m e  w e  aAm HN@`@m &f -%  aN f`f -%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef 7% 1U4 4  fef 7%5 w    6v&  @ppC`p   6@Cwzwtw D 1 & & /e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _15uNfe & 7% _1bNe & 4  uN 4)U5| m- 5 & 7%St% X 4 U   & 7% S U _d0 @_h0w DE%%"5   & 7% U wv w ^D55@ 1  2 3 6 4 4 4 4 4 ww~w  $5+ &5e-|e % & Z    4 ww  5f 4 7 f 4 7PwX@ m7%e w       4 e-ww D 5 e %wn  5 e-Tw $2 3ww  N 7ww rDCDpC 4 L4 wZw FN 6wJ ~5 & E        ~5>wlYwfw Net@f 4e  w6w.w  \@!U7N>!U7D@!B>!:Ae vB&7 (  % 55 a  a!PE -%>! w$ 6 `e vWt vw@ `e @  6%e U?pp `e 7^>!U?R a7D <>?62U ew dDE wZw FD5 6 5N 4!w5A vBB-  }ee@ !ۃ `!ւ ` `nm& E%طm؇%w w7*'$!      7& A& BF7!W-;7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_9@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& <0 z   5 , @ :% & f E <0  (˥-%0     ,:% &  <0 8 5E& z   5 , @ :% & f E <0  w<BIRnAHOUY] _proc_nproc_netdatap:u:vfstat: -p option requires a process id. %s: unknown uid /vmunix%s: No namelist /vmunixfstat: out of space. proc table/dev/kmemUSER CMD PID FD DEVICE INODE SIZE TYPE%s NAMEunknownfstat: can't read u for pid %d from %s /dev/drumfstat: can't read page table for u of pid %d from %s /dev/memtext table/dev/kmeminodeswapper%-8.8s %-10.10s %5d wdtext%4d* (deallocated) %2d, %2d %5lu %6ld %3s %s pip* (unknown file type) chrdirblkreglnksocunkunusedstreamdgramrawrdmseqpaksocketprotoswdomaininetchar* (%s unk%d %x* (%s %s %xinpcb %x %x %xunpcb %s %x %d %x) ipicmpggptcpegppupudpidpraw %d %sfile/dev/kmemfstat: out of space. /dev/kmem/dev/kmem/dev/mem/dev/mem/dev/drum/dev/drumfstat: error reading %s from %serror %d reading %s at %x from kmem wordusage: fstat [-v] [-u user] [-p pid] [filename ...] : illegal option -- : option requires an argument -- rrnlist: sym 2 big ,/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd: Unknown error: %dT\f 0BNdp|#2JWm|6Gf( ? ^ n  1 R t   ( < R t  * ? RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired &!J!J!8d8o8xl9fz9el8gF9cR9s|8l|8L8u8D8O8X8U0 dltM     R0ɨR0ɨ0` @>$ e7cce7, / J*  7%  2w 5 e q@ȥ-le ԋ r y    7V7P  ~ z | x * 3 8 : <  2 0 4 5 9 :   Bfe !%% @77   . 7 " 6!  2 v . 7 f1 6!  2 wJB ֝@68& 0@ 6!e 2R ]R ]< ]< ]6 ]6 ]4 ]8 5p 6! 2     `   X          ^   dw3w 3 6!w3w 3 & D%5Bf 2 5@ %' N ".%_  ". _ f&  .eAWpBNf .%D  eBAWpBAm! N# 6!N3 6!%H 6!D_ _ A rBWpBAmN 6! L&E& .%U&E& .%A&E& .%M&E& .%W&E& .%T&E& .%C&E& .%S&E& .%E&E& .%Z&E& .%P&E& .%m&E& .%r&E& .%x&E& .% 6! E& 6!%5   6! 5   6!   6! 4 6! 6 6! 8 6! 4E%`4E% E& 6!% &>&< ~e 6!  6!eBAWpBAm!_N 4wL0w 80  ff* .efe .%@w0w 0   @ 6!  6!w/w / 55& ~%5f 2 5 %' N ".%_  ". _ f& V .e@tf< .%D    e@t@m! Nff, 6!e_NffL 6!ei 6!D_ _ A vWtAmN 6! P E&& .%T E&& .%W E&& .%L E&& .%K E&& .%w E&& .%u E&& .% 6!  6!  6!   6!    6!    6!  6!  6! e@t@m!_vN 4wb-w N-& %5Bf 2 5 %' N ".%_N  ". _N  f&  .eAWpBNf .% D eBAWpBAm! N9 6!NL 6!%] 6!D_2  r_.  A rBWpBAmN 6!  6!  6!  6! && e 6!  6!   6!   6!  6! ( 6!   6!  $ 6! ,) 6! 00 6! .7 6! 2m4> 6! 6E 6! *L 6! 8S 6! Z 6!eBAWpBAm!_ N 4w*w *WpFN 37\ 6!]r 2 % u 2 %   x 2 % { 2 %  2 %  2 %  2 %  2 %w*w )  @t&&  .efe .%Nf 6!%-wWpFN 4 7 6!w) @t&& r .eAWpFN|X .% 6!f \ rF&  eFAWpFm<!w )N 6! D& 6!%*(&&& &&  6!e T&$E& .%W&$E& .%O&$E& .%F&$E& .%C&$E& .%B&$E& .%A&$E& .%X&$E& .%S&$E& .%H&$E& .%b&$E& .%r&$E& .%w&$E& .%a&$E& .%& 6! )  x0 6!w') 6! w V'Be XRvf&: .efeP$ .%NP 6! 5|&5t&5l&5d&5\&5T&fR  e4N' 6! Nf3 6!%ND 6! NP 6! NeZ 6! Nfffffc 6!e N 6!  6!  @a0 dltM     R0ɨR0ɨ0` 6! % 6!N 6! N 6! @ 6! @ 6! Nfff 6!e 6!  r  6! @a 6!  r% 6! %  AaA W  r  6!N 6! N 6! N 6!  6!  @a  6! %  6!" 6!  @a0) 6! %/ 6!1 6!  r 6 6! @a@8 6!  r%> 6! %݂ r @ 6!B 6!  r G 6! @a`I 6!  r%O 6! %݂ r Q 6!@S 6! Nfff[ 6!eq 6!  r z 6! @a| 6!  r% 6! % r  6! 6!  r  6! @a 6!  r% 6! %  r  6! 6!  r  6!t@af& e r% 6! %  r  6!flfj efpfn eftfr v eNv 6! Nxfz 6!% 6!  r  6! @a| 6!  r% 6! % r  6! 6!  r  6!@a 6!  r% 6! % r  6!N 6! N* 6! N5 6!  @ 6! NK 6!  N@&V 6!%Nb 6! n 6!@e5N t@mNf&r e % w 6!y 6!@e5N t@mNf&~ e %  6!fHfFfDfBf@f>f 6! D 6! & &L ee e AWp Am!_N 4wb& &T w @L& %5 J& " .efe .%A A vuf 2 5 f&  .e@tf .%5 5 @t@m5b @t@m Nf[ 6!%A vNAA vfr 6!%wXw D f , 5w.N0fe e%_.%%%  %%%cNe  5uu5 Ne 5u fff e ? f , 55D 55444  .5@-5e  %  ". N 0N 0@_CeXN e%  @ A@bl@ f&f e Nffe* eDNe*& . 4 e   w *DE5_% _  _ 5`uu '& & .e5u%%w @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & .e5u %%    0+%%%_5 l05 5 E4N ff & .e W _%_%__w D  5u5mu A@ww D 5u5 A@ww De m@ e@ 5u%% du %e u 5mu A@w`w LD x5u5 A@w0w D%%055  m@ 5u%% e du %umumu 5umumu A@ww DC AupB 4  & h-%b 0+5% 傎& h-%`@ @m A z &@w  w  fef f7%5 w w Nef !%ww Neff !%ww D A555  ԋuNeffe !%w^w JDC 5 5 _&#%%_H#5 %*e5  AWp `eu  0u%l5  %h%[ ' e  _|#Neffff #e   * O  A@ EN 0+5% % % %Nf * &    %_" A@ E%Nf * @wN 0+5 w N%c%s%[Nf ff f& &ewf5 5 5 5 %e%f %o%xDe5 5 A @ EN 0+% % % %- Ԑ A @ EN 0+ _%%+_%  _%%a%f %A_%%F_% % A@vN 0+O% A@v@mAm@ vA@v5u 0 %a%fW7 5`u`u C% S P Ԑ A @ E = %%.%e%E- *% ' $ ! Ԑ A @ EN 0+%+%-%0%9 A@  5u% N  * =   @e! @e! _#@t@]   x Ne (A _#Ne (A @H@pHw ZDC = 5%c%0u5 %s    0+%r %c5 %[r       0+%%   * =  D- %cwr w ZD ̥^     % %]%-+  $%-̥]4   ̠     %]  w w D*\5% %-%+ 5 55 55  B5eA5  %.55  B5eA5   %E%e$%+%-  Wp B`e   @`5 @ 5AupAm%55 @5A5u555555  55555AupN& Z*e5 55w 6 m 7b"w D Lԋw W f r @  W f r@  @ w N D% 5     |@w 4- w D85U5_j,5P_j, h m^@e4 ,5Ne & B3  uN 34USt% 5  l05 l05& & .% 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff .%ށ̥a &  .e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef f7% l0U4 4  fef f7%5 w ww7  ы A@Ћ w FD:5UE5Hw* _R05uNfe & 5% _R0bNe & B3  uN 3)U5| m- 5 & 5%St%  N3 U   & 5% S U _/ @_/w DE%%"5   & 5% U wv w ^D55@ l0  01 3 4 4 4 4 4 4 ww~w  ,$ 5+ &5e-e % &     2 ww  5f 2 7 f 2 7wX@ mv7t j%e w  T F    2 e-*ww D  5 e %w  5 e-w 0 H2ww  N 5ww rDCDpC 3 2 wZw FN 4wJ ~5 & E        ~5>wlYwfw Net@f 3e  w6w.w  pU7nU7pnAe vB7   % 55 a  a!PE -d%n w$ 5 `e vWt vw2@ `e @  5% e U? `e 7nU?ڔ a7 ?U ew dDE wZw FD5 4 5N 3!w5A vBB-  }ee@ !ۃ `!ւ ` `m@& E%2ٷm,ه%w w7*'$!      7& A& BF7!|W-2>7h& & e Ӌ  &72& e ӕ-ӕ0B~ӕ.  ӕ0~ B~&7 & Le ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_29@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& . z   5 , @ :% & f E .  (˥-%0     ,:% &  . 8 5E& z   5 , @ :% & f E .  w&w Nefef 5& Ze555'0Ne5 B& $>e57 Be0" 5%55 5 B5@B ez a=%z7zw %5 B5Ne& $>e55e0%7`Jʕ0%zʕ1  %z˕0 ʥ9 6@~ BLU]djpx # RAW CAN OUT MODE ADDR DEL COL STATE PGRP DISC @n r x  /dev/kmem/dev/mem/vmunix_inode_text_proc_dz_tty_dz_cnt_cons_file_nswap_nkl11_swapmap_dh11_ndh11_nproc_ntext_nfile_ninode_pt_tty_dmf_tty_ndmf_npty_dhu_tty_ndhu_dmz_tty_ndmz_dhv_tty_ndhv/core%loCan't find %s Can't find %s no namelist, n_type: %d n_value: %o n_name: %s pstat: one or more of -[aixptfsu] is required usage: pstat -[aixptfs] [-u [ubase]] [system] [core] number of inodes is preposterous (%d) can't allocate memory for inode table %3d/%3d inodes %d/%d active inodes LOC FLAGS CNT DEVICE RDC WRC INO MODE NLK UID SIZE/DEV FS %7.1o %4d%4d,%3d%4d%4d%6u %7.1o%4d%5u%6d,%3d%10ld %2d %c number of texts is preposterous (%d) can't allocate memory for text table %3d/%3d texts active, %3d used %d/%d active texts, %d used LOC FLAGS DADDR CADDR SIZE IPTR CNT CCNT FORW BACK %7.1o %7.1o %7.1o %7.1o %7.1o%4u %4u %7.1o %7.1o number of procs is preposterous (%d) can't allocate memory for proc table %3d/%3d processes %d/%d processes LOC S F PRI SIG UID SLP TIM CPU NI PGRP PID PPID ADDR SADDR DADDR SIZE WCHAN LINK TEXTP %7.1o %2d %7.1o %3d %8.1lx %5u %3d %3d %4d %3d %6d %6d %6d %7.1o %7.1o %7.1o %7.1o %7.1o %7.1o %7.1o pstat: out of memory kldzdhdmfdhudmzdhvpty%d %s lines pstat: out of memory %2d%4d%4d%4d %12.1lo %7.1o %4d %4d %6d ntty berknet tab slip %d pcb %.1o fps %.1o %g %g %g %g %g %g fpsaved %d fperr %.1o %.1o procp %.1o ar0 %.1o comm %s arg %.1o %.1o %.1o %.1o %.1o %.1o ap %.1o qsave %.1o r_val1 %.1o r_val2 %.1o error %d eosys %d uids %d,%d,%d,%d groups %u tsize %.1o dsize %.1o ssize %.1o ssave %.1o rsave %.1o uisa %.1o uisd %.1o sep %d ovdata %d %d %.1o %d ov_offst %.1o signal %.1o sigmask %.1lo sigonstack %.1lo sigintr %.1lo oldmask %.1lo code %u onstack %d %.1o ofile %.1o pofile %.1o lastfile %d cdir %.1o rdir %.1o pdir %.1o ttyp %.1o ttyd %d,%d cmask %.1o ru %ld cru %ld timer %ld %ld %ld %ld start %ld acflag %d prof %.1o %u %u %u rlimit cur infinite %ld rlimit max infinite %ld quota %.1o base,count,offset %.1o %u %ld segflg %d ncache %ld %u %d,%d endoff %ld dirp %.1o dent %u %s ???inodesocketpipenumber of files is preposterous (%d) can't allocate memory for file table %3d/%3d files %d/%d open files LOC TYPE FLG CNT MSG DATA OFFSET %7.1o %-8.8s8d %3d %3d %7.1o 0%lo %ld %d/%d swapmap entries %u kbytes swap used, %u kbytes free rrnlist: sym 2 big &&&&&&&&&&&&&&&&&&& ((((( AAAAAABBBBBB V^8dD8oP8x9f9e8g8c8s8l8Lf8uj8DH8OT8X|8U=(\0 el    U)+U)+0_# Device Configuration Table #Name Unit# Addr Vector Br Handler(s) # Comments # dr ? 172410 124 5 drintr # dr11-w (b-bus emulator) # dr ? 172430 130 5 drintr # dr11-w (gc-bus emulator) # dr ? 172450 134 5 drintr # dr11-w (em-2 interface) # du ? 160020 310 5 dhurint dhuxint # dhu11 terminal mux # dhv ? 160020 310 5 dhvrint dhvxint # dhv terminal mux # dm ? 170500 310 4 dmintr # dm11 dh modem control # dh ? 160020 320 5 dhrint dhxint # dh11 terminal mux # dz ? 160100 310 5 dzrint dzdma # dz11 terminal mux hk ? 177440 210 5 hkintr # rk611/711 rk06/07 # hp ? 176700 254 5 hpintr # rjp04/06, rwp04/06 ht ? 172440 224 5 htintr # tu 16 massbus tape # vp ? 177500 174 4 vpintr # Versatec; should be before lp # lp ? 177514 200 4 lpintr # lp-11 line printer ra ? 172150 154 5 raintr # uda50, rqdx1/2/3 # rk ? 177400 220 5 rkintr # rk05 rl ? 174400 160 5 rlintr # rl-01/02 # rm ? 176700 254 5 rmintr # rjm02/rwm03, rm02/03/05 # br ? 176710 254 5 brintr # Eaton br1537/br1711 # rx ? 177170 264 5 rxintr # rx01/02 # si ? 176700 170 5 siintr # si9500 tm ? 172520 224 5 tmintr # tm11 driver tms ? 174500 260 5 tmsintr # tmscp driver ts ? 172520 224 5 tsintr # ts11 driver xp ? 176700 254 5 xpintr # xp driver # If you have DL11s, you must give each line an explicit unit number instead # of using a '?' as above. If you use a '?', autoconfig(8) will start # assigning unit numbers starting at 0 which will effectively move your # console to that first line. Start your unit numbers with '1'. # # cn 1 176500 300 5 cnrint cnxint # kl/dl-11 (on mvx11-aa) # The following entries are provided for information only, actual # configuration is done elsewhere. # acc ? 167600 5 accin accout # lhdh driver # de ? 120 5 deintr # deuna # qe ? 174440 400 5 qeintr # deqna ethernet # il ? 163000 340 5 ilrint ilcint # interlan ethernet # kw ? 172540 100 6 hardclock # kw11-p clock # sr ? 500 5 srirint srixint # sri dr11-c arpanet imp # vv ? 161000 350 5 vvrint vvxint # pronet 0 flB (    R0qR0q0_  < e7cce7 / \  7%  Lw &5 <%N %24N 5u  % ff zeNf %   e ˀN Lw wd w D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  w` A@w B D Lԋw: w & De LN |4e$e. 2  |4e' Be v Nfe %ww -@ <wN) d% w n BuNefef  %=@@wByww (D5"E@e44fef  % U4 4  fef  %5 w    6v&  @ppC`pЋ w FD:5UE5Hw* _5uNfe & P % _bNe &   uN *)U5| m- 5 & P %St% R  U   & P % S U _ @_w DE%%"5   & P % U wv w ^D55@    3 n 4 4 4 4 4 ww~w  b$5+  &5e-6e % &     ` ww  5f ` 7 f ` 7JwX@ m7%e w   |    ` e-`ww D L5 e %w(  5 e-w t ww  N V ww rDCDpC *  wZw FN n wJ ~5 & E        ~5>wlYwfw Net@f $e  w6w.w  J U7H U7J H Ae vB7   % 55 a  a!PE -%H  w$ *  `e vWt vwh@ `e @  * %@<e U?** `e 7H U?  a7 ?U ew dDE wZw FD5 n  5N *!w5A vBB-  }ee@ !ۃ `!ւ ` `(m& E%m%w w7*'$!      7& A& BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_ @  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   wSector %s <= 0 or > 131071 mknod: Unknown error: %d6@Zl~ +;J[o ):Pj,Fh7Xq*L_l&:Pj}RError 0Not ow0 flE (    R0qR0q0_nerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator0 T T d o x f e g c s l L u D O X* U0 gl R0wR0w0_ @X < e7cce74 /   7%  w 5 % N8 % @&   @   @m D  @m1  D-  _4 @m l5 @mG Ae vf& \e5u ff e X  %  @m  @m l5T   Ae vf& e5u ff eX  %@eE55 @t@m0X %@ ff eX  % D- w w @ w w D      + - ̥9 Wp @@`e̥0  wv w ^ , fef j %5 LwJ w 2 D Lԋw* w  De LN 4ebe   4ee Be v Nfe %ww -~@ zwNg\ %\w ^ BuNefef j %=@@w2yww D5"E@e44fef j % fU4 4  fef j %5 w   @ppC`pww7  Ћ w FD:5UE5Hw* _L5uNfe & % _LbNe & <   uN )U5| m- 5 & %St%, < H U   & % S U _  @_w DE%%"5   & % U wv w ^D55@ f  * 3 4 4 4 4 4 ww~w  L$ 5+  &5e- e % &      ww  5f  7 f  74wX@ m7 % e w  t f     e-Jww D 6 5 e % w  5 e-w  Bww  N ww rDCDpC   wZw FN wJ ~5 & E        ~5>wlYwfw Net@f z e  w6w.w  U7U7Ae vB7   % 55 a  a!PE -% w$  `e vWt vwR@ `e @  %*&e U? `e 7U? a7 ?U ew dDE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%zmt%w w7*'$!      7& A& BF7!W-*7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_6@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 ,0 gl R0wR0w0_ @ :% & f E   w@(#)clri.c 2.3usage: %s filsys inumber ... %s: is not a number. %s: is zero clearing %u : Unknown error: %d (2L\t~0<HZiy#9HTgx2Sj *:Qu@Uh@Rdx RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB pb dH oT xf e g c s" l" Lj un DL OX X U0 hl 6 g i k R0nR0n0^  &( e7cce7 /  7%  w @ d w<w (D* R ?E G ߪ  -?% :& ߀ F  p݀5p:EV -V ?H%  ::& . F w5$: w bD LԋwZw FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%:   U   & % S U _n @_rw DE%%"5   & % U wv w ^D55@    3 ( 4 4 4 4 4 ww~w  $.5+ r &5e-vTe % & T     ww  5f  7 f  7wX@ m7.%e w        e-ww D .5 e %wh  5 e-Nw . ww  N ww rDCDpC  V wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  VDU7HBU7>D<B4Ae vB 7 "  % 55 a  a!PE -%B w$  `e vWt vw@ `e @  %|e U?jj `e 7XBU?L a7> 68?0,U ew dD E wZw FD5 ( 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `hm2& E%$m%w w7*'$!      7& A& BF7!nW-7Zarff hasn't been implemented under 2.11BSD.*NN0 il= < a c e R0ѦR0Ѧ0^  ,( e7cce7 /  7%  w @ d w<w (D* R ?E G ߰  -?% @& ߆ F  v݀5v@E\ -\ ?N%  @@& 4 F w5*@ w bD LԋwZw FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%@   U   & % S U _n @_rw DE%%"5   & % U wv w ^D55@    3 ( 4 4 4 4 4 ww~w  $45+ x &5e-|Ze %$ & Z     ww  5f  7 f  7wX@ m74%$e w        e-ww D 45 e %$wn  5 e-Tw . ww  N ww rDCDpC  V wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  \JU7NHU7DJBH:Ae vB&7 (  % 55 a  a!PE -%H w$  `e vWt vw@ `e @  %e U?pp `e 7^HU?R a7D <>?62U ew dDE wZw FD5 ( 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `nm8& E%*m$%w w7*'$!      7& A& BF7!tW-7`XNSrouted hasn't been implemented under 2.11BSD.0TT0 jlvI |h) + - / 1 R0JR0J0] R  e7cce7 / "  7% \ TGw J % XwJ +7<@ JN @ I A HP& X % eN D17(7"& A% 5 5 fe 2 5 x"2`  s Xe     X%~  f&^w @I~%_f  5z b A _j@z5@ J  D17 x"_jfe& A%fe rC |}Ne| 6 Nfe& Lfe|< e % 5 5 fe G   r vf& r t@aUUNe& & fe e 7Nefe& Lfe| De 5,_Ne| | Ne5 X_ @| Sk XwGw lG TGwrGw ^G% Xb A wFG  55 N X e%9 eN D17@t@aAp@t@ap@t@ae&& A% %fg@ J fer rC Nef 6 @ N@t@ae&& Lfef e ߀ x"_w F%_  5x b A _@x5@ J  D17fe& A%@& VCzz5 fe rC {Nez 6 Nfe& Lfez e  x"_ 5 5 fe G   r vf& r t@aUUNe& & fe e 9Nefe& LfezB De 5%Nez z  .E @z ] X_u Xw&Dw D  6#%7 x"wC5 5 N P5fe % %0%1 x"b A T E %% 6#%7& x"w :C R b%  Yb A  TG   4 76eN %~ X TG  X TG    X TGNf   TG  G7    7  ) ~ t w BB n  TG  w4Bw B Q  H `2 %( X95d V -V  ?H %  : V& . CV       XV E8      wLAw 8AD5 5 5 p,C@ 5uwAʋ ʋ @-@- etep@-ˇ%@w @7 8̋ w@ ̋  ̋̋w T@ %_ 5  Xp  C5@-5etep!@eE5P 5r5Am 5r5 '  B- upD`uep+ X @ta^Wtep@ . X C-w? C5     -# ?% V& ߨ C u-@eE5 р5V  L X eC %0& f Xew >@ PA1 @     "@f& T&%Br2@ f& 2&%Br 2w:>w &>@ PA1 @     "@f& %%Br2@ f& %%Br 2w=w =DeCex@e5vu55u fe G  u55u r f vf& r t@aUUNe& & fe e Ne& & fe De 5w<˕ 33 v3 3 3 3 fe G 5 5 j b^3 @5555 fe *  ff 3ef& Qff 3ef& 3eee@ s 35u  3f& fex e 50_ %% % A@@A f& 2ee@ 7w@_$ r f vf&  r t@aUUNe& & fe e532Ne& & fe0 jllI |h) + - / 1 R0JR0J0] De 5 fe * _DvEuDae̥-x- _2 ff 1ef& Qff ,2ef& 1eee@ 5u@A 5u _2 && "%5uE _A@@A 5u%l % e&e\u % %-&\ A@@A 5u%l % e&e\u % %-&\ u- u-uuu- u-uu _2W-_2uuuu_Fw 8DC ,5  tc@  & 5 `B  A eB ~  `B @ wj8J  r     SW ~#r`J   w 7  R f VCe  f VC N& VC  6w7w 7  \/ 7 Bw]wl7w X7 pj |E7 b7 xwN7w :7 P  \/ 7< r2 -%5#f   wf  5=  f  N  P7r7p7d &   ̥̋ ̥ % &    wB6w .6D CKw$6 ˋ 5 hwz5w 5D      + - ̥9 Wp @@`e̥0  w5}w5Ww5w 5Vfef K%5 wn5 ]w4w4&& e& & %ReR$r @  1   "@! @#E B Ew 4 XJ%w4w 4Nf J w4~w4pw 4w 4D Lԋw|4w h4 @e5ff %wX4w D4D5 NL# r%EAEt =Z_^ 5]@Ne L*Ndfej 4,%CaejNe iAej@ <#e`5   s 4,%`5  v 4,%` ӕ:ӕ Bej%_mo N "{ 4,%` 5 Nfej "-%`Aej@55 &*@e`5^}^f@ej@A^1e^~^@^fe` -%  U b%Nfej XJ%@-`R ffejz 0#e O5lK 25h%D 4  B%5fej >C e>fej t,  NAej@f XJ%N E ^J & fh `-%%%w1w x1D ww 57%<P +%5,  6#%7h% : B 7PL7@%8'* r"%% ~%% Ew0w 0 E7w0w v0D 7wp0bw/w V0N  wT0w @0D el&&&&Wpef Wpef  4,ew0w /5 5  AaAE f&A@vUU5u %w/w /D 4w/̥/ 55> C&f ( e %Nfe rC Lfe >C fe >C ԥ.̋De & l" & B %fe0 B% E %,@e05e wNe$ wNe( w%r_J _J% _J%2_JWpfWpeme, _J@e\5 N f&te -< @ E3 -  *teR5.N f&@.e@.A Ep@.A Ep - s -3 _J - t-X_J -t7,7&teR5  e7 -: _N@e7w , Nefe *w,7 AWp@7* $7 & f *  rC 77~ w ,7 7 7 7 N rC 7R7Lwb,w N,@R +̋  4  4  2  w ,w ,  @55 w-w-  t V -  t5, 5, - ueR&&fe Xe3 epe3wV+w B+& f eU Yw.+w + Q@f& p"e5uQ@f& "e5uumumu _F eeQu  %QQ eu % ff !et ff "e5u< ff !et< ff !eL A@e@ f& !et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ]ttw(!w'\w'w b(De LN C4e^eR "  C4ea Be v Nfe -%w'w '-@ vw'Nc 4,%ew*'aw$'w 'w@7% ?@w'N f z#w `'DC_(̥%_( 5 r y@ _( 9% 5afe & A%5@e5 5N j) _( 5(N j) _( w& z#_( z#_( z#_(  )% _(0 )% _(0 r  r f )% _(0 )% _(  )% _(  r  r f )% _.$_(0 )% _.$_( j) _.$_(! z#_.$_(0 )% _.$_(3 z#_.$_(< j) _.$_(0e r& )% _.$_(0e  @ r& )% _.$_(0 )% _(_.$> z#_(_.$ _.$ j) _(_.$ _# _# _( _.$% _.$b_$fe &( A%5@e5_$ _( _4$ _$ _( _X$ _$ _( _v% _ % _(0 el rdf )% _(_.$ _% _(0 )% _(_.$ _% _# _( j) _(_.$ _$ _% h_& _$ _F$ Y% _b%_f% _& G0 )% H_.$ _% _j$ -' z#2_.$ ! 0 el )% _.$ _D% _t& _%& " _.$?  ̋_#_0$w ! A r e0@ A r 5   % @  L %  j)w!w p!D wt! ~?zw F!u@t5 5 @ 5 Nefef ,% (3A@u5Btr 2 @ Aup  fef ,% u-u-u-@w w  fe *@w @pHA@tww H  +!,& t,   w. 1& +%7-˕, Nf * w D H !     +  we% - r<N r<&@& 4,e  ~ ~w 2 Nef + w,w D 5  =.& ,% `5ȥ=  = @we  w  BuNefef K%=@@wzЋ Ћ  Jҋ~ @@m,lw e& 7 P7Hgwd 47 6 w 4$ 2H w5 4@E%@EU5N&e rC (&e >C Nf&e B%4 IN&e rC -&e >C Nf&e B%  (Ne& G  ff eee@ 4t@t"4 4t E vI_2w N E@ EN vIww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  ; ve@ 4tw"w D55ff %f&& "eff&e e &e h= 55 ww L"w5 5 w D5#5ff T %f&& eff&e *ew6&e L?'44  && ef&& .Ce&e & XJ%%U w D5_ 7o5ff %f&& eff&e Ze L&e L?8f f ff&e V e 744  && ef&& .Ce&e & XJ%%UUw @@m e%fe G  &e h= 55 3ff `%f&e@ &50c &e h= 55 32b A U44  && ef&& .Ce&e & XJ%%&_ 7fffffe e _ 7&e % _P7_ 7e_P7  mm@ e@ f& ef&& .Cefe& XJ%%_ 7 <_J6w @0 0 @0 N 97Z7VP"ww D85_:Ne& Gq fe Ve4-4-/44  &&  ef&& .Ce&e & B%%&e G &e h= 55 ewrwnT"w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  ; ve@ 4t4-4-/44  && ef&& .Ce&e & B%%&e G ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& .Ce&e$& B%%&e$ G `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& .Ce&e$& B%%&e$ G `Btp$t t"  ff Nef&& .Ce&e$& XJ%%Uw w r D5#5 5 wwX"wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& @% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l(5l*u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm A% a@ `` e w D a@@m e  w e  aAm HN@`@m &f A%  aN f`f A%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef K% EU4 4  fef K%5 w    6v&  @ppC`p   6@Cwzwtw D E & & .Ce 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _D5uNfe & XJ% _DbNe & G  uN 2H)U5| m- 5 & XJ%St%V  G U   & XJ% S U _C @_Cw DE%%"5   & XJ% U wv w ^D55@ E  E 3 vI 4 4 4 4 4 ww~w  $J5+  &5e-Ze %: & 8    hG ww  5f hG 7 f hG 7wX@ m7J%:e w       hG e-ww D pJ5 e %:wL  5 e-2w |E Fww  N ^Jww rDCDpC 2H G wZw FN vIwJ ~5 & E        ~5>wlYwfw Net@f ,He  w6w.w  :v"U7,t"U7"v" t"Ae vB7   % 55 a  a!PE -%t" w$ 2J `e vWt vw@ `e @  2J%d`e U?NN `e 7<t"U?0ٔ a7" ?U ew dDE wZw FD5 vI 5N 2H!w5A vBB-  }ee@ !ۃ `!ւ ` `Lm& E%ʷmʇ%w w7*'$!     t 7j& AZ& BF7!<W-R7(w 8uDAB %u f& & e w5 5  W- W00~u5  .luBBw* J@B |_L@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w $ Bw]w|w h  |E7 xr 47 j7 zwLw 8  \/ 7 l" -%5#f N  f N N Nf& Ո ̥ ̥ 70#7& N  ̥̋ ̥ %V#& N   &#wLw 8ww>w *D CKw ˋ 5 w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff .e A f&A@vee@ 5u 5 @ W-@D Ae Bḁ.@e@- @D@pHe _N̋@pHeA Be vC ̂ xuuff t%5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw DCB P  5 , :% & E& C z   5 , @ :% & f E C  (˥-%0     ,:% &  C 8 5E& z   5 , @ :% & f E C  wb48@DNX`iqzANYADJTIMEACKMASTERREQMASTERACKSETTIMEMASTERUPSLAVEUPELECTIONACCEPTREFUSECONFLICTRESOLVEQUITDATEDATEREQDATEACKTRACEONTRACEOFFMSITEMSITEREQTESTSETDATESETDATEREQLOOPUsage: clockdiff host ... %s: unknown host measure%s is down %s time transmitted in a non-standard format %s is unreachable time on %s is %D ms. ahead of time on %s %s and %s have the same time time on %s is %D ms. behind time on %s Usage: msite timedudpudp/timed: unknown service gethostbynamesendtorecvfrommaster timedaemon runs on %s received wrong ack: %s communication error Usage: testing host ... timedudpudp/timed: unknown service %s: unknown host sendtoUsage: tracing { on | off } timedudpudp/timed: unknown service onsendtorecvfromtimed tracing enabled timed tracing disabled wrong ack received: %s communication error opening socketbindall reserved ports in use opening raw socketmeasures clock differences between machinesgets help on commandsfinds location of masterexits timedccauses election timers to expireturns tracing on or offL6| (nX clockdiffelectionhelpmsitequittrace?@(#) Copyright (c) 1983 Regents of the University of California. All rights reserved. @(#)timedc.c 2.3 (Berkeley) 6/5/86timedcCould not get priviledged resources ?Ambiguous command ?Invalid command ?Privileged command timedc> ?Ambiguous command ?Invalid command ?Privileged command Commands may be abbreviated. Commands are: %s ?Ambiguous help command %s ?Invalid help command %s %-*s %s directory@(#)byteorder.c 2.4 (Berkeley) 5/20/86@(#)measure.c 2.4 (Berkeley) 5/28/86@(#)cksum.c 2.1 (Berkeley) 6/6/86/etc/servicesrr# ,/ longjmp botch longjmp botch /usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec,0mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d $ . H X p z  , 8 D V e u   5 D P c t  . O f  & 6 M q <Qd<N`tRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorZahpz&&'$'B''''(<(f(((SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired \"X#X#LdKoLxLfLeKgLcLsKlKLLu LDKO LX2LU"#/etc/hostsr# HPnPPP0 klL )     R0lR0l0\ @%<@ e7cce7 /   7%  zw 'j) p$ w"$e@ȥ-e@ d 6   ew  ۀww5 8 5/7   z#%  5  D5%   4D % BN,< te%7~d 8   zww |D@_{% . *_x+ 3`s`s e%Ľ7 7 _-|-t 7ػ wW@ wT7 7   0, --~  h2 2 e%x+~7 1tĝe WpO@@`ea %b a<>  WpCex+   w w  5 5 5 N  DAWp@5x5z  umumu z'AWp x  zAWp qxWaFfAWpehfT je %    5aF&b 2e w<w (x+N&  e%Ľww  HD  A@B 5u  @pmp pm@pp <= 6h5  % @@mAHD%e%x+5 @@mAHD %}ww  Ҹw  m AWp`@h ҋ% % - w Ne 8 j1 f.Ne < f e7@w>Ne ( " - mHmD w -w@w , ee@ 5uNe Jeo  ww D Nefe xLt ff ~etttww DC AupB 4  & %b 5% 傎& %`@ @m A &@w  w fef 8%5 w w D Lԋww N  `ww D el&&&&Wpef Wpetf޽ e޽wbw N5 5  AaAE f&A@vUU5u %ww D w̥/ 55 &f f e %Nfe  &fe  fe  ԥ.̋De & 2 & d %fe0 j%  %,@e05e wNe$ wNe( w%rڴ_ Ҵ_% ƴ_%2_WpfWpeme, _@e\5 N f&te -\ @ E3à -@ *te85.N f&@.e@.A Ep@.A Ep - sŵ -г3 _ - t->_ -7@7:te85  e7 -Z _@e7w F Nefe xw67 AWp@7J D7 F f    77 w 7 в7 7 7 (  7f7`ww `, ̋      2  ww l  @55 @ w->w-6  t < -  t5, 5, - ue8&&fe Xe3 epe3ww & f e/43ww z Q@f& .e5uQ@f& \e5uumumu _ eeQu  %QQ eu % ff et ff e5u< ff Pet< ff eL A@e@ f& het e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 7ttw !wN w  fe x@w @pHA@tw w  !,& \   wh 1& l%7E˕,Nf  w D 80 klQ )     R0lR0l0\ !     +  w e% - r<N r<&@& e ~ ~w l Nef  wf w R D 5  =& z% `5ȥ= ެ = @w e  w BuNefef 8%=@@w Ћ Ћ  Jҋ~ @@W f r @  W f r@  @ w  D85U5_"5P_"  m@e4 ,5Ne &   uN X4USt%5l >5h >5& & j% 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff d%ށ̥a &  pe 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5b   6v&  @ppC`p   6@Cww7b Ћ PPЋ w FD:5UE5Hw* _$5uNfe & ~% _$bNe &   uN X)U5| m- 5 & ~%St% :  U   & ~% S U _ @_w DE%%"5   & ~% U wv w ^D55@ >   3  4 4 4 4 4 ww~w  $5+ &5e-e % &      ww  5f  7 f  72wX@ mV7TJ%e w  4 &     e- ww D 5 e %wҬ  5 e-w  ww  N ww rDCDpC X  wZw FN wJ ~5 & E        ~5>wlYwfw Net@f Re  w6w.w  "U7 U7"Ʀ ƞAe vB7   %| 55 a  a!PE -D%  w$ X `e vWt vw@ `e @  X%e U?ԪԪ `e 7ª U? a7 ?U ew dDvE wZw FD5  5N X!w5A vBB-  }ee@ !ۃ `!ւ ` `ҩm& E%xmr%w w7N*'$!      7& A& BF7!W-%7& & e Ӌ  &7x& e fӕ-`ӕ0B~Lӕ.  ӕ0~ B~&7 & Le ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_ @  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w&w Nefef 5& ,#e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& v#eww  fff 5& v#eww  5 %O N  = ,555Ne5& $e5|55'0Ne5 B& $e57( Be0" 5%|55 5 B5@B e, a=%,7¡,w %|5 B5Ne& $e55e0%|7ǡ`Jʕ0%,ʕ1  %,˕0 ʥ9 6@~ Q@(#)ac.c 4.7 (Berkeley) 7/2/83/usr/adm/wtmprNo %s ac: Bad tty name: %s %-*.*s%6.2f total%9.2f %.6sSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB ||0do"xfegcslL8u<DO&XNU=(\0 llO R0FR0F0\ {P e7cce7& / O  7% / ow s 5 @@ "( `j 2 `j N> `j%Nf  N <f& Lf Le C O  o 5 5 N feff Pe7,!-( "&W `je  wr5  %w qj O `j \fe k Ne <fe& Lfef Le  O  o 5 5 Nfe& & Pe5 @ \ xfe  %@wp .*Wp f&h V9e7w  \fe k @eP~ fe fefe Le5 O F> `j f w 6p\5 AWp KW,GNJ~ `j% -Xd `j A@<: 5uNe &@ePPPPNe FffZ fe_AWp@f&S `feAWp W,qA@Cp 5uNe &@ePPPP\fe k  AWpfAWpeffe Le5AWp@ c_ffh ee -rv `j wxnqm `j%w Pn  @f& feu%@C e@C ee@ %@C Br  @f& ee5u  ff (eef&@ f& ee5u ee@Bu  &AePPPP&w0mw m@    F@ ,@" , f C,@f&x 8Ie fe Nc Nfe   fe 4N O w~lw jlDCblL llt %%@B eL @B    ee@Bt w lw k d }d h 7P FM O `j   -   5 5  fe Nc u-Tu-OA@e@ 5u& z%:$  \fe k Ne <&e& Lfe Le  O  o A@@A 5u5 5  fe& & Pe5 @ _h xfe  5@f X _@exP~ 3feV k Nefe Nc @eAePPPP@5555 Nefe 4N NeV O%@e&&&&@e&&&& P e@\fe k N <fex& LfP Le  O  o _Ne 5 O_ AWpB,_AWp 1feV k Nefe Nc @eAePPPP@5555 Nefe 4N NeVfe  Oe@e&&&&@e&&&& e , h 7 FM 1 `j%_  03 `j% n7 _ \fe k @eFP~ fe feFfe Le5vI Ofe  _\fe k2_ @eFP~ fve feFfe Le5X Ofve  & efe Le5vn _ fe Nc A@e@ 5u_  n7 & M_ \fe k @eFP~ fe feFfe Le5vn Ofe  _ `j f _ w e %_ fe Nc %Z J, . `j%5 AWpN `j% -^ `j 7  7 7 85 5  AWpeNfe = 5  O  oAWp@%  - 5 ff [eff%N 5u f ffV \[eff % fe Nc uu uu  ee@Bu  ff h[ef& ff z[eee@ f&4 ZeAWp  W,N 8 -x 50 ll@ R0FR0F0\ff 0%wtcw `cP;\fe k  fe Nc  AWpfAWpeffe Le5 AWpN O% - wbw b - AWpNf ku@wbw b N 5:f Wpe@AP~@ pD Wp1N4 Wpf k " Wp1  %d     O AWp1 @waw aD  !@ A f&AWp@EE4  t N  -z  l  bwaw pa Z AWpN&F `j%AWpN q 0 AWpe@ Wpe P~w&aw a 2 `j AWpN> `j% - B `j w`w `V\fe k Ne <fe& Lfej Le D O  o fe   5 5 Nfe&  Pe5w`w `N  AWpq-HAWpq\fe k  @N fe Nc  AWpfAWpeffe Le5AWpNO O%N wb_w N_ @BA @ee @ f& Ve@mAm@ 7w@BA@ee @ f& jVe@m Am@ 7w-- l hk 5 X f r%N dnw^w ^5 AWp@BtBarZ2X -X5 U@t@a5X5Zu@ 5@t@a5,X5,Z@t@a5X5Zu -@t@aZXBtBarZ2X@t@apZpX  @-5 5 %N_@t@aZXBtBaZX ;W 8@ @- @t@aZXBtBaZX W @@AA@ uu u -t@aVTBtBaZX W `@ AA@ uD 5@@ 55 T5 Vu@t@a5lXT5lZVu T u-f feT 8ReAV@Tw&\w \ 3 @N@ &l ( `jeF\D `j O `j eL  \  \5_ K_  e f k_ !RP@ A f&@ EEf&@ &%Z XH&&P~eLP~@\\-^wV q7 " @ A f&EE4 t 7N w F Qz `j H&  H&w~Z\ _ 0& Nc @m m @ 7 w @m m @ 7 w %%@B  @B e w fe ,p_  7 w   7 w ev e@Br w l d ^ Z  wV 7P 7H wF \@ : 4 . [D JPe : r f vf&" r t@aUU8&& & fe Le ZNe& LH& Le s O  oH& := 5  `j  0& Nc -T b -L Z -B P _-8 F _-. < _-" 0 _ _7 9rl@ A f&EE4 't $7 $ #     `j H&   n \T& k   z  v j b  h_ ,  ^ ,    w 8 T&f k- !HB@ A f&@ EEf&@ &%   __^ p1\7\ 0 \H&&P~eLP~_w nVN @  M x@eH&&P~\fe k  `j fe  Ne @\fe k N < |N& Lf Le # O  o h e7w fe( Nc A*@(mm@ 5u5 5 _" _", _" fe( Nc A*@(mZmX@ 5u_"@eHP~@\fe k  -   _"& &ef Le5_"N <NfeH& LfN Le . O  o_"@eHP~%P_" _", _"B -  Ne 59 O_$Ne [ O%\fe k & &ef Le5_"N <NfeH& Lf6 Le _"_,'  h 7 FM  `j%_"   `j% n7 _"5_"d _", _"fe  5@f X_$ k, g fe( Nc A*@(mm@ 5u5 u-( u-*  A*@(e@ 5uNe fe k \fe k z@eP~ fefef Le5_"_) X\fed k @eP~ fe fefeX Le5_)fe _$ _", _"\fed k2_" X@eP~ fe fefeX Le5 Ofe  X<& 2efeX Le5 _" _"@e8P~@\fe k N& Def Le5_"N 5N dn   hk & H & H ( hk 5 qt f peN dn%F1  h 74 FM  3  `j%R L D 5 V  O  o@55  \%7 r  O  ofe  .Ne }  O  ofej 2L% %0   O  o fe Nc A@@mAm@ 5uff `% (w5 5    ff `7ef& 7e  f& n7e5u fe C 817?\ L   O  o\  .՞'N C5 N  O% o@f&@@5 @e5Nei pe   O  oA r 5 u7@%,@eAP~ " pt t Nei ` pe '  O e   q D  O  of_,755555 Nei  pe  tt Nei  pe ! eAeP~Nei X pe 3 _5eAeP~t  U&& $3%5u&& 3%5u fe 2/%fe "/%AE Ә@5,5,@5   _5  _5@ A f&EE4t 7=5 _5 8  j@ ' e7LwJ h e7DwB $_n8 \%7 V  O  o& M5 J x  |&    ,   ; ,  ~ ~ ^XN ; Tfm  O %8) (*& M   : : ;   -     xw:w :  -  8 w:w x:D \fe k & &efe Le5^S u\5Z5VuXfeV&  Pe5^ _: u\5Z5VuXfeV&  Pe5^ u\5Z5VuXfeV&  Pe5^ N^e fe k @eP~5 V5 XZ\feV&  Pe5^3Nef^e k( `\fel k  fefefe` Le   O  ow8w 87 7777   `j ;   x f&&& % N `j%  6 x | l  `j f7] X EL <B@>  `je w7   w 7  - D-  ww7w 7  - w7  w t7 Ef& 75A @@A f& u u &w,7w 7 fe Nc Ne Sw7w 6 e  p    O  o& ,p |w6w 6@ LA1 @     "@f& d,%Br2@ f& B,%Br 2w<6w (6@ LA1 @     "@f& +%Br2@ f& +%Br 2w5w 5DeCex@e5vu55u4 .fe ,p  u55uz r f vf&b r t@aUUNe& & fe Le Ne& & fe Le 5w4˕ 33 3 3 3 3 fe ,p 5 5 j 3 @5555 fe Nc  ff +ef& Qff +ef& +eee@ s 35u B 3f& fex Le 50_> %% % A@@A f& *ee@ 7*w(@_> r f vf&v r t@aUUNe& & fe Le532Ne& & fe& Le 5 fe Nc _>DvEuDae̥-- _? ff )ef& Qff .*ef& )eee@ 5u@A 5u _? && (%5uE _@A@@A 5u%l % e&e\u % %-&\ A@@A 5u%l % e&e\u % %-&\ u- u-uuu- u-uu _?W-_?uuuu_?w 0DC ,5  tc@  & 5 `B  A eB ~  `B @ wl0w/ w/w B0D~ pC k ke  b F 6w0w / 2   h 7 tkw]w/w /  n7 7 w/w /   h 7 m' f%5# f D  w f D  ̥ ̥  & D 5=  F7w"(7 D ̥̋ ̥ %f( & D   (w.w .D CKw. ˋ 5 w r. VE f ke  f k N& k b 6w .w . l   h 7XR tkw]*w-w - <6 n7 .7 w-w -    h 7 rh( f%5# f F  w f F 5=   f F N 8L L77)7 & F  ̥̋ ̥ %0) & F    )w,w ,D CKw, ˋ 5 w ~,D @e55 5  ̥0 ̥x̥X. 'Ae f&ffff #e A f&A@vee@ 5u 5 @  W-@D  Ae B ḁ.@e@-3 -@pHe _F̋@pHeA Be v@5  @w&+5 5  A@v5uWtAaAE 5PuP  5 u ߇A@Zw:*w * p w*p !mNAtmf& "ee90@ f&tmbň -ZVtmH7@@<  : 4Wp !w *e  Ā vWpmfİ % # " `j w)7 7 7 -%@%~z %h?d`@e7NNtmB7FN H 4,* Ā vWpmfİ w ( D && eC && 0 eBe5  À vWpmfð  6 xp 7 h 7 `e7P Ntm@7:Ám< 7r4Wtm(w $tm7@w (" `j w ' mNAf& fee90@ Er 5u0r`J `vE5uex-rpjef e^-dXTPA@wD'hw&w *'D      + - ̥9 Wp @@`e̥0  w&w &DeEE&E&E&2) de 2)w&}w&Ww%]w%w%w d&D 3 qEtU4 4t w0&w &D  m & & L% p5 f& L%Uw%&& e& & *%ReR$8΂ @  1   "@! @#E B Ew N% r%wH%iw$zw$pw$w "%4De _O t4 t t4 4t Ne&& e% _Ot 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 O 55 Nefe e% & ~%5u7  && e%  fe e%ff J% fe& e%w#A@E f& w #xw#w #D Lԋw#w v# @e5ff P%wf#w R#D5 NP# O%EAEt =_RF5]ʾNe cNhfej d%CaejNe HXmAej@ \e`5 l d&\ X Rw d%`5<  z d%` $ӕ:ӕ Bej%_Rmo N x\ d%` 5 Nfej Hf%`Aej@55 *@e`5^}^f@ej@A^1e^^@^fe` f%f  NUH R%:Nfej( r%@-`R ffej \e O5K 5h%D 4  hk%5fej k e>fej 6e  NAej@f r%N dn r & fh f%%%w w D wHw@ 576%(<6J) Bd%5 ,  \%7% > hk 7ڻֻ7ʻ%»' [%%H) S%% dnzww f dn\7lww DR 7Jw~bww dN HX Twbw ND el&&&&Wpef WpefX) deX)ww 5 5  AaAE f&A@vUU5u %ww D 8w̥/ 55B l&f  e %Nfe k Pfe k fe k ԥ.̋De & [ & hk %fe0 nk% dn %,@e05e fTwNe$ fTwNe( fTw%r_T _T% _T%2_TxWpflWpemfe, _T@e\5 N fTf&tx)z)e -" @ E3@/ - *te05.N fTf&@.e@.A Ep@.A Ep - s1 -31 @/_T -v t-jҸ0_T -Z177te05  e17 -  _T@e17lw  Nefe Ncw7 AWp@7 7  f c 1 k 177 w 7 7 7 7 R1 k 17ܷ7ַwpw \&V jd̋  T  T  2  w.w   @55  w-w-  t 0 -  t5,x) 5,z) - ?/ue0&&fe Xe3 e1pe13wdw P& f eY]w<w ( 81Q@f& ~e5uQ@f& e5uumumu _YeeQu  %QQ eu % ff et ff e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A  5 8u 4  A  f&A@ 5u r  r   A  @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 attw!w\ww pDe LN l4ebex x\  l4ee Be v Nfe f%ww -@ zwNgP1 d%P1ew8aw2w w@7% ?@wN f \w nDC_nb̥%_Tb 5 r yD _Tb 9% 5afe & i%5@e5 5N b _lb 5,N b _lb w \_lb \_lb \_lb  ~b% _lb0 ~b% _lb0 r  r f ~b% _lb0 ~b% _lb  ~b% _lb  r  r f ~b% _]_lb0 ~b% _]_lb" b _]_lb% \_]_lb0 ~b% _]_lb7 \_]_lb@ b _]_lb0e r& ~b% _]_lb0e  @ r& ~b% _]_lb0 ~b% _lb_]B \_lb_] _] b _lb_] _*] _0] _Tb _]% _]b_]fe &, i%5@e5_] _Tb _] _N^ _Tb _] _j^ _Tb _^ _^ _Tb0 el rdf ~b% _lb_] __ _Tb0 ~b% _lb_] _"_ _0] _Tb b _lb_] _] _L_ h_(` _^ _] Y% _^_^ _z_ G0 ~b% H_] _"_ _] -+ \2_] ! 0 el ~b% _] _^ __ _8_  _]?η ΄ ̋_]_]w r1A r e0@ A r 5   %h1 @  L %h1  bww ~D w n h d?`w T fe Nc@wF @pHA@tww  jd!,& 6e   w 1&r1 Bd%7 ˕,r1Nf c w D L !     +  wxe% - r<N r<&@&r1 der1 ~ ~w  Nef d ww D 5  =& Te% `5ȥ=  = @we  w l BuNefef t%=@@w@Ћ Ћ  Jҋ~ @@   6v   6v   6vb"Sw mow nelw e& 7 7gw ֵxBnȵI I7fIw  BuNeff t%=@@w w  fff few w> yw8 &  4  b '     ` TW ~  s`K6!  w 0 D85U5_lh5P_lh  m@e4 ,5Ne & vp  uN p4USt% 56 m52" m5& & nk% 45@e-4  % U5EU  w E w D  +   r= wB w 5 a U5ff hk%ށ̥a &  ke 3     U̥r 33  @A  v @A ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef t% mU4 4  fef t%5 w    6v&  @ppC`p   6@Cwzwtw D m & & ke 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _m5uNfe & r% _mbNe & vp  uN p)U5| m- 5 & r%St%  p U   & r% S U _Dl @_Hlw DE%%"5   & r% U wv w ^D55@ m  dn 3 q 4 4 4 4 4 ww~w  H$ 5+  &5e-e % &     o ww  5f o 7 f o 7wX@ m7 %e w  p b    o e-Fww D 2 5 e %w  5 e-w n |oww  N rww rDCDpC p ,p wZw FN qwJ ~5 & E        ~5>wlYwfw Net@f pe  w6w.w  1U71U711Ae vB7   % 55 a  a!PE -%1 w$ r `e vWt vwN@ `e @  r%&"e U? `e 71U? a7 ܿ޿?ֿҿU ew dDE wZw FD5 q 5N p!w5A vBB-  }ee@ !ۃ `!ւ ` `m8& E%*m$%w w7*'$!      7& A& BF7!tW-f{7`& & e Ӌ  &7*& e ӕ-ӕ0B~ӕ.  ӕ0~ B~&7ҧ & Le ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_fv@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& l z   5 , @ :% & f E l  (˥-%0     ,:% &  l 8 5E& z   5 , @ :% & f E l  w&w Nefef 5& ye C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& yeww  fff 5& yeww  5 %O N  = 1555Ne5& X{e5255'0Ne5 B& X{e57ڡ Be0" 5%255 5 B5@B e1 a=%171w %25 B5Ne& X{e55e0%27`Jʕ0%1ʕ1  %1˕0 ʥ9 6@~ @(#)acksend.c 2.4 (Berkeley) 5/27/86acksend: broadcast: %s: acksend: sendto: %macksend: seq # %d != %d @(#)candidate.c 2.3 (Berkeley) 4/21/86  XXz  z        jjTHIS MACHINE IS A CANDIDATETHIS MACHINE IS A CANDIDATE sendto: %merror in electioncandidate: @(#)correct.c 2.3 (Berkeley) 5/28/86%s down%ld %ld %s down%ld %s down clock correction too large to adjust (%ld sec)can't set time@(#)master.c 2.14 (Berkeley) 6/5/86h h h  h h h h h $ ` h  2 t|{/usr/adm/timed.masterlogwThis machine is masterTHIS MACHINE IS MASTER sendto: %mdate changed from: %ssendto: %mDATEREQ from uncontrolled machinedate changed by %s from: %swTracing started on: %s Tracing ended on: %s election errorerror on sending QUITloop breakage: no reply to QUITgarbage: %s %.7s measure: %msubmaster correct: %ld ms. master correct: %ld ms. %D ms. no reply to SETTIME from: %sno more slots in host tablermmach: %s host table: %s sendto: %mno reply to initial SETTIME from: %s/usr/adm/wtmp@(#)networkdelta.c 2.1 (Berkeley) 12/10/85@(#)readmsg.c 2.9 (Berkeley) 6/5/86&&*&&&&&&&&*&&&&&looking for %s from %s ANYmsgqueue: readmsg: readmsg: wait: (%D %D) receiving datagram packet: %mreadmsg: version mismatch readmsg: discarded: readmsg: discarded: readmsg: Slaveack: sendto: %mIgnoreack: sendto: %mMasterack: sendto: %mMasterack: sendto: %mMasterack: sendto: %m%s %d %u (#%d) %s %s %s %d %u (%ld, %ld) %s %s %s %d %u %s %s @(#)slave.c 2.16 (Berkeley) 6/5/86"%/ (/%B'**""<,"-///:*v*--/f(6)-sendto: %m/usr/adm/timed.masterlogwTHIS MACHINE IS A SUBMASTERTHIS MACHINE IS A SUBMASTER THIS MACHINE IS A SLAVETHIS MACHINE IS A SLAVE election timer expired Looking for nets to master and loops /usr/adm/timed.masterlogwsendto: %mslave ignored: slave ignored: date changed by %s from: %ssendto: %msendto: %msendto: %mDATEREQ from uncontrolled machineforwarding date change request for %ssendto: %mwTracing started on: %s Tracing ended on: %s no answer from master candidate election error: no reply to QUITconflict error: no reply to QUITsendto: %mgarbage: loop kill errorsendto: %mloop kill error2garbage:    % , 5 = B G O W _ h n w | /usr/adm/timed.log778";::(;|;.;;;OANYADJTIMEACKMASTERREQMASTERACKSETTIMEMASTERUPSLAVEUPELECTIONACCEPTREFUSECONFLICTRESOLVEQUITDATEDATEREQDATEACKTRACEONTRACEOFFMSITEMSITEREQTESTSETDATESETDATEREQLOOPtimedTimed: not superuser timed: -i and -n make no sense together timed: -i and -n make no sense together timed: -%c: unknown option /dev/null/dev/ttywTracing started on: %s timedudpunknown service 'timed/udp'socket: %msetsockopt: %mserver already runningbind: %mgethostname: %mgetnetbyname: unknown net %sget interface configuration: %mget interface flags: %mget netmask: %mget broadaddr: %mget destaddr: %mNo network usableopening raw socket: %mAttempt to enter invalid stateerror on sending TSP_CONFLICTNet status: %-16sMASTER SLAVE IGNORE invalid state %d nets = %d, masters = %d, slaves = %d, ignored = %d malloc failed@(#)byteorder.c 2.4 (Berkeley) 5/20/86@(#)measure.c 2.4 (Berkeley) 5/28/86@(#)cksum.c 2.1 (Berkeley) 6/6/86/etc/networksrr# /etc/servicesrr# ,/ ?192$f1]B; ߵoH@Itk屾\YeT.h=yC-kg*.i]sO5֏oQnakA6?"Ƙ¤*{׭ "'G tKKKKKinitstate: not enough state (%d bytes) with which to do jack; ignored. setstate: state info has been munged; not changed. %d.%d.%d.%dlongjmp botch longjmp botch /usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec04mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d (2L\t~0<HZiy#9HTgx2Sj *:Qu@Uh@Rdx RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator^elt~ `v````a8ajaaaa b6bSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB 122udxuouxBvfPveBugvc(vsRulRuLuuuD|uOuXuU=(\0* mla #000Z/dev/ra0a:/:rw:1:1 /dev/ra0b::sw:: 0, nlE| f^R0)R0)0Z L  e7cce7 /   7%  @w C   NL ;% @ (% z & 8  C6  ; 8  C% K@& < Z#  .% N 8   T&& te5%T $7w&  &e&  e 5%Ww B $fd W x C .wBw B 5(%"Ne t'5% u-5@%b 8  Nf <  CwBw BZNeDufe %% fe 2'}fe ) 5 qt @ & AeNe@ & ZAwA5Nff %N > w \A5 *5 &Nefe R$ Ne 5A*WpxAaef % A*WpxAaeN  qt @ & Aew>>w *>DC˕ 3& D&%3s̥  8%_N&& &%4t 4%  8%P 4% + 8%9&*&( %%4(t* J   \ x&   T%%3s3 Z w= & n   %%3seeP~ 3&& %3w vwT;fe < N,fe e%3ffe X&% +Nefe < Nefe &5Nef < 5 N >@Nfe <w :D2* R$ HD   VT@A W <    X  w:   e8&e, <e,&e8 <w 9D2* R$ ~ N  VT@A W <    X  wN9   e8&e8 <e,&e, <3-((3-**sTsVw 82* R$  &@ @f& %f&@\ A  8  CtTtVA*P~X XX0Z4 Z7rw68w "8h r>w\TPw8w 7B ff e 5-5-  z   X   w7w 7D B  7!7X ZZ0XX XX0ZZ BwT7w @7DR fe %%@e5  5eD&e8&e,&&ff 8ew6w 6D fe %%@e5  5  feV %%@eV5T  5T&& z%f&fTff ew,6w 6 De t4 tt 4 4 Ne&& &% w5  eu @ w.5 w 5w 5DC E5<E@e33. @;E  5 , @;% & fE = 5  >U3 3  w4fwR4WwL4w 4DC AupB 4  & :%b '5% 傎& :%`@ 01 nlI f^R0)R0)0Z@m A &@wN4  w3w *4D Lԋw"4w 4 @e5ff \%w3w 3D5 N6# 8%EAEt =~_$z5]dNe $NNfej %%CaejNe SAej@ e`5   ] %%`5  ` %%` ӕ:ӕ Bej%_dmo N e %%` 5 Nfej 6'%`Aej@55 J*@e`5^}^f@ej@A^1e^h^@^fe` '%  U (%Nfej C%@-`R ffej e O5K 5h%D 4 j <%5wfej < e>fej :&  NAej@f C%N H? C & fh '%%%w21w 1D ww 57%<z> F%%5,  %7% $ < 7tp7d%\'N 8%%B^<. D%% H?.wJ0w 60 H?7w00w 0D 7w0bw/w /N  `w/w /D el&&&&Wpef WpefL %eLw/w /5 5  AaAE f&A@vUU5u %w`/w L/D wB/̥/ 55( <&f ' e %Nfe < 6fe < fe < ԥ.̋De & 2 & < %fe0 <% H? %,@e05e wnNe$ w`Ne( wR%rH_ @_% 4_%2_ WpfWpeme, _@e\5 N f&tlne - @ E34 - *te5.N f&@.e@.A Ep@.A Ep -R s ->3 .4_ - t-_ -7P7Jte5  e7& - _@e7w , Nefe R$w|,7 AWp@7 7  f $  < 77 w &,7 >7 z7 x7 x8 < 7v7pw,w +< n%̋      2  w+w +  @55 w-w-  t  -  t5,l 5,n -\ 3ue&&fe Xe3 epe3w*w *& f e?DCw*w * ,Q@f& X"e5uQ@f& "e5uumumu _ eeQu  %QQ eu % ff !et ff !e5u< ff z!et< ff !eL A@e@ f& !et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 Gttw((!w'\w'w (De LN <4eHe   <4eK Be v Nfe '%w'w '-8@ `w|'NMD %%Dew&aw&w D'wN@7D% ?8@.w,'N f @w 'DC_"̥%_" 5 r y* _" 9% 5afe & :%5@e5 5 N 0# _" 5 N 0# _" w`& @_" @_" @_"  "% _"0 "% _"0 r  r f "% _"0 "% _"  "% _"  r  r f "% __"0 "% __" 0# __" @__"0 "% __" @__"& 0# __"0e r& "% __"0e  @ r& "% __"0 "% _"_( @_"_ _ 0# _"_ _v _| _" _% _b_fe & :%5@e5_ _" _ _ _" _ _ _" _< _ _"0 el rdf "% _"_ _R _"0 "% _"_ _n _| _" 0# _"_ _J _ h_t  _d _  Y% _( _, _ G0 "% H_ _n _0 - @2_ ! 0 el "% _ _  _:  _ _? ̋_T_w |!fA r e0@ A r 5   %\ @  L %\  0#w*!w !D w!   ?w u@t5f5h@ 5Nefef &% (3A@u5Btrh2f@ Aup fef &% u-u-u-@wH w 4  fe R$@w& @pHA@twtw z n%!,& :&   w 1&& F%%7˕,&Nf $ w D 2  !     +  wXe% - r<N r<&@& & %e& ~ ~w  Nef % ww D 5  =& X&% `5ȥ= ` = @wpe  w L BuNefef D%=@@w Ћ Ћ  Jҋ~ @@&wFW f r @  W f r@  @ Sw&lw e& 7 &7gw>B4I I7Iw  BuNeff D%=@@ww  & f 'eww  fff 'ewwyww D85U5_(5P_( 4 m*@e4 ,5Ne & ZA  uN A4USt%45@ >5L >5& & <% 45@e-4  % U5EU  w^E w <D 4 +   r= wB w5 a U5ff <%ށ̥a &  eC ff e5u4 t "-t t"  ff ef&& U4 4  fef D%5 wZ    6v&  @ppC`p   6@Cw8w27 Ћ P ы A@PЋ w FD:5UE5Hw* _j>5uNfe & C% _j>bNe & ZA  uN A)U5| m- 5 & C%St%@ 2 fA U   & C% S U _(= @_,=w DE%%"5   & C% U wv w ^D55@ >  H? 3 B 4 4 4 4 4 ww~w  n$45+ &5e-Be %$ &     @ ww  5f @ 7 f @ 7*wX@ m74%$e w       @ e-lww D X45 e %$w4  5 e-w > `@ww  N Cww rDCDpC A A wZw FN BwJ ~5 & E        ~5>wlYwfw Net@f Ae  w6w.w  "U7U7 Ae vB7   % 55 a  a!PE -% w$ C `e vWt vwt@ `e @  C%LHe U?66 `e 7$U?ڔ a7  ?U ew dDE wZw FD5 B 5N A!w5A vBB-  }ee@ !ۃ `!ւ ` `4m~& E%pͷmj͇%w w7V*'$!      7& A& BF7!W-L7w 8uDAB %u f& & ne w5 5  W- W00~u5  .lu,Bw* J@B |_TF@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w  Jw]\w|w h  >7 x  -7 7 ,wLw 8 T P ) 7@ l6 LH%5#f H  f H nN Hf&Ո ̥ ̥ 77& H  ̥̋ ̥ %& H   zwLw 8wZw>w *D CKw ˋ 5 &  4  N '     ` TW ~  s`K6!  w xD@e55 5  ̥0 ̥x̥X. 'Ae f&ffff e A f&A@vee@ 5u 5 @  W-@D Ae B ḁ.@e@- @D @pHe _H̋@pHeA Be vC ̂ xuuff 4%5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw RD > & & %h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d2BZd~".@O_n .:M^t9Pj 7 [ |  & ; N p  & 8 J ^ t RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorD K R Z d m t } X !P!!!!","X""SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y , h   TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired EdfEorEx0Ff>Fe0Eg FcFs@El@ELEuEDjEOvEXEUvt/etc/hostsr# 6J\JJJ0F ol* F {}R0oR0o0Y 6 < e7cce7 /   7%  X w 5 e% H  H  X  N& l.e N/ H%J H  W H%e [ H  X @]fe %e _ fe P 5 Ne J X   &  f& |ef&f \eNe& f ef&g e6 f V%%Ne H% X L F  e<  _T x > 5  vl@ 5u N %   . E vf&  vf& & & Zeee@ f& HeE`@ f&e e e %~ X fe P 5 Ne J X Ne f7 w 7   @-% - %    _    %~  X 5 5 s_Ne f5u  4 t &&ff" e tp f&ff e@AWt1> tp f&fe e& ff ef& ff ^eve@AWt1@ @t@ @t> %~  X   &  f& ef&f \e6 f \%% Ne J X  X w  @A  @C@Aw x D5 5      + -! ̥9 f& ff 2eee@ ee@ 5u̥0 A@  w A@w  fef %5 w w D Lԋw w De LN 4eBe   4eE Be v Nfe B%w" w  -&@ Zw NG: %:w  BuNefef %=@@wyww D5"E@e44fef %  U4 4  fef %5 w0    6v&  @ppC`p   6@Cww7  ы A@Ћ w FD:5UE5Hw* _ 5uNfe & \% _ bNe &   uN 6 )U5| m- 5 & \%St% d U   & \% S U _ @_w DE%%"5   & \% U wv w ^D55@    3 z 4 4 4 4 4 ww~w  t$ 5+ 0 &5e-He % & &    l ww  5f l 7 f l 7\wX@ m7 % e w       l e-rww D ^ 5 e % w:  5 e- w  ww  N bww rDCDpC 6  wZw FN zwJ ~5 & E        ~5>wlYwfw Net@f 0 e  w6w.w  (hU7fU7hfAe vB7   % 55 a  a!PE -%f w$ 6 `e vWt vwz@ `e @  6%RNe U?<< `e 7*fU? a7  ?U ew dDE wZw FD5 z 5N 6 !w5A vBB-  }ee@ !ۃ `!ւ ` `:m& E%m%w w7*'$!     $ 7& A &0K ol. F {}R0oR0o0Y BF7!W-7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   wi` `   2a2  !! U0rk06rk07rm02rm03rm05cdc9766rp04rp05rp06rp07fuji160divaampex9300si_eagleusage: bad type disk [ snum [ bn ... ] ] e.g.: bad rk07 hk0 %s: not a known disk type known types: %s /dev/r%shbad block information at 0x%X in %s: %s: can't read bad block info (wrong type disk?) cartridge serial number: %D(10) alignment cartridge bt_flag=%x(16)? More bad sectors than system supports. The remainder are not being replaced automatically... sn=%D, cn=%d, tn=%d, sn=%d bad: too many bad sectors specified system is currently configured for only %d limited to %d (only 2 tracks of sectors) limited to 126 by information format %d: out of range [0,%d) for %s : Unknown error: %d,<T^x(:IYhy(4GXn3Jd 1Uv 5 H j } 2 D X n RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorNrrdo xfegcslL u$DOX6U0Q plƺ'R0ΨR0Ψ0Y @$r e7cce7 /  7%  w % @- 6 e (" p%7p-  Z v% & J |e7 %@&I l֝"O  %@&j p 5s  & f |e f v%%L%a0F %87 2%<7 6@e7"  vf&f |ef v%mmm7Ԥ 5 T e!e   -   ̥<̋2̵/ ,  ?   5 - ?% f& fE&  ̥>5 ̥  5 e!- wRw >  :N %   %   w w  v pNe Ne e ww f  5wN0fe * e%_%%%  %%%cNe 5uu5 Ne 5u fff e ?f  55D 55444  5@-5e  %r  N N @_CeXN * e%  @ A@bl@ f&f e Nffe* * eDNe*&  4 e   w DE5_(% _ _5`uu '& & |e5u%%w( @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & |e5u %%    %%%_ 5 f5 5 E4N ff & |e W _ %_%__ w D 5u5mu A@wrw ^D d5u5 A@wBw .De m@ e@ 5u%% du %e u 5mu A@ww D 5u5 A@ww D%%055  m@ 5u%% e du %umumu 5umumu A@ww DC AupB 4  & %b 5% 傎& %`@ @m A &@w  w pffef j %5 w\ w DD Lԋw<w (N J  w&w D el&&&&Wpef WpefL eww 5 5  AaAE f&A@vUU5u %ww xD twn̥/ 55~ &f e %Nfe  fe  fe  ԥ.̋De &  & p %fe0 v% * %,@e05e h w"Ne$ h wNe( h w%r_ _ % _ %2_ WpfWpeme, _ @e\5 N h f&te -~ @ E3 -b *te 5.N h f&@.e@.A Ep@.A Ep - s` -3`   _ - t- _ -` 77te 5  e` 7 -| _ @e` 7w  Nefe .w7 8AWp@7l f7 h f  `  ` 7H7B w R7 7 .7 ,7 ,`  ` 77w4w  J̋    2  ww  > @55 b w-`w-X  t   -:  t5, 5, - ܝ ue &&fe Xe3 e` pe` 3w(w & f eww   Q@f& e5uQ@f& e5uumumu _eeQu  %QQ eu %0V plø'R0ΨR0Ψ0Y ff et ff e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( AH 5 8u 4  AH f&A@ 5u r  r   AH @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttwT!w w : fe .@w, @pHA@twz w  J!,&    w 1& "%7g˕, Nf  w D  !     +  w^ e% - r<N r<&@&M e  ~ ~w Nef d w w D 5  =$& 0% `5ȥ=  = @wv e  w V BuNefef j %=@@w* Ћ Ћ  Jҋ~ @@W f r @  W f r@  @ w D85U5_5P_ v ml@e4 ,5Ne & <  uN 4USt%Z5f f5r f5& & v% 45@e-4  % U5EU  w\ E w : D 2 +   r= wB w 5 a U5ff p%ށ̥a &  |e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef j % fU4 4  fef j %5 w2    6v&   6@Cw8w27, Ћ P ы A@PЋ w FD:5UE5Hw* _L5uNfe & % _LbNe & <  uN )U5| m- 5 & %St%f v H U   & % S U _  @_w DE%%"5   & % U wv w ^D55@ f  * 3  4 4 4 4 4 ww~w  $Z5+ ` &5e-Be %J & n     ww  5f  70 f  7nwX@ m7Z%Je w        e-ww D Z5 e %Jw  5 e-hw  Bww  N ww rDCDpC   wZw FN wJ ~5 & E        ~5>wlYwfw Net@f ze  w6w.w  p U7b U7X V NAe vB:7 <  2%, 55 a  a!PE -%  w$  `e vWt vw@ `e @  %e U? `e 7r U?f a7X PR?JFU ew dD&E wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7*'$!     6 7,& A& BF7!W-*$7w 8uDAB %u f& & e w5 5  W- W00~u5  .luRBw* J@B |_6"@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w_msgbuf/usr/adm/msgbufCan't open /usr/adm/msgbuf /unixCan't get kernel namelist /dev/memCan't read kernel memory Magic number wrong (namelist mismatch?) ... %.12s rrnlist: sym 2 big SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDeclpmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT , h!%)-19=AE ITZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d   b!dH!oT!x"f "e!g!c!s"!l"!Lj!un!DL!OX!X!U0] qlO R0$R0$0X & e7cce7 / v>  7%  rw uD&& '%5u  @p&& |]%}Ewu fe T% A w Tu@f& f'%f&@f& L'%&%  wuw uD0- wtw t@ 3% wtw t@eAP~@e5 dpfff f =e h Jwptw \t@f& :\%5uE  @  A@E   5 @@m ws %w s@0 wsw s@f& 0%wsw sr)5$$=- fe&e k% 5$fe&e k%  wTsw @s 5$fe&e k%  wsw sD -> wsWpu5$ ,e&  w r B- wr Wpu`B >fe&e k% 35$fe&e k% !5$fe&e k%  ef   w q N Z" ^f&ffe6 e dNfd %e- AWpeu  ߀f >ewnq b  x5 De__%_  3  X%3s  ,  N@   & f %- Wp  p  , e@ W , e@ 3sd 3  6X%3see _ _eNf& @ _N@  _N Z NAWp  >_Z@0e !_ r_N@  _N@ N hN 5@( _4 *_N 5(4 * e_N N Z NAWp  %_ 3  V%3s W _- Wpeu 0NfAWp  &? >e_NfAWp  &z >e__@  p(E%@+ &ef k% , 3 s H E,@ f &ef k%  ,  , 3 s  3-,%Z*,, f& d%4 *e _w mw A% B,% "/ 7 0p m  rv7n %7f$ r @ BK@ȥ-FUf nXf n 7 ^e +L[f n^f naf ndp m  r  B #  r5 -N q %  n & 2 & 2  n 5 qt f `seN q N !  8 P  D7 ><8 3*1 S%r2$  Q   Q   Q  7v5u & & fe =e 7vZ50u0J w |jNefe& f 3e 5  &%" J% & I%5uNfe  ff I%wjw i ff K%5 J > 0$fe f =e  ff 2e  J > N qw^i@w Di$5 $5$e5$e5@$  % whw hff AWp e v  @"ffe> "e D fd %ewhw ph re5FAWpuAWpu<8C_T_H t-._F5(_F 5( @5$_F=-_FN& _F@5%:ff` e @  @"fffe> "e  Nfd %eHe5@eP~N 3=, e@ W  , e@ f& N%f&@e _ e@e _ 5 _ e@-:@5ff6 e   @"fffe> "e Nf 0b ql@ R0$R0$0Xd %ew$fw f  K%5 6 >  r@e5Neif `se A > N q _u~7 A r 57Nfe r @eA~eP~@eA~P~Nei f `se e > e ~ %" N q_@U@555@~ Ne h %5Nei f `se @eAeP~5Nei f `se @eAeP~Nei f `se  > uNei f `se _@e5|f& K%5u@e5|f& K%5xuzE 5 Az@xE?  Az@xCBB C @@5uAz@xCBB C @@5uu-u-UN fs5 3_ @Ae'P~5Ne h  5 N~ n  fsA1J@ J p m < =  qN q *-  uwDbN~@&J n wN N _w a@5$e!fe r & @0.f& e55@e5 5 (E%@_ N @$E%D& @(&f& e55N 5@$E?U0@&"fef e& @0.f& (e55A@L L @J >%@$E@&"fef ew`w ``=/ jX 5_@e5@e5@e5@eN5fe r fe r 0fe r _Neff % _Nef _^f nC@eAeP~@eAeP~ff nU UNe r,, `s  ffefe e[kf n RN fs5Nf r @$ff &%Br(2&tf n@U$@eAeP~@eAeP~@p"nwfN Nfefff?f 4e 5%_N pw^^w J^yf n_N R-5N 16@% w^@55 W-A@v% %A@vA@v5u& ff eBr2}f nN RZ5 N [Br2@%fe@& Rl%w ] N RZ5fe@& Rl%@=, w\N [Br2@,w \- w\NefAWp  BEteF f&e k%   5 BEtew \ u-> w\NefAWp  BEteF5f&e k%   t- N&e 5 BEteAWpu  w H[ u-~_`NefAWp  NAWp 55U E5 u@EteF u@Ete50 fs_`teAP~eAP~t,4 *@U4&@ U4(e 4. .e 4. U&N& 2 "% ,5((e r, `se  J%3 v "% 3 twYw Y05 5 ffe k% @5( @p-,  _ N "%@5@( E@(@.J >% -@eAeP~@eAP~Ne A1.@ . e A1.@p, @U&@E&@U( & N "% * 'Ne r, `se  JNe r, `se   JwXw X@5@( .J >% N?~ "% V@5(e r,f `se F JN 3N twWw vW & XX ewlWw XW4 e%FF4 e%w8Ww $WFerw l &< ^X Ne    60 Ne   5D_b _Z 5 (  5@(e*%*,%*  V5 5(LE( NF CD@8eeP~" 31, e@ W  , e@ f& =%f&$ !e@e!_h    ,wUw |UF n D ,!e@e! 5   rw*Uw UDe6& :!e>& :! 7 Jp m%wTw TD fs   wT44 3 3 ee tw T4 41Nef U@E%!f jX 7 & 2  & 2 w*Tw T   p7 7 wTw SD Uee-4%2   s-    t3  R seAP~   N fs3 5 N f Rl%s s wLSw 8S _$Nif m%@e5@e5@f& 2%mf m%@,@f& %&vf me@03&ff m%  e f m @03(ff m%  e   A@ ȕ 3@5&@ A@,@ % A@ EN@E&N n D@5 (  ..f $ N LpwxQw dQD : B$Jf m%e>f %%e6f %%f m N LpwQw PD f n54# Nf m%N LpwPNf m%Wp@#.e+e   ( &"f meeff %e e w PD C ˋ/˥,@ 3@f& . %&f &4f me  ` x@ 3@f& %&f& @f me f &Wf me0pf m e %  "7%f& ` %&sf Fe e N LpwNe&f mef m w NA@E 5 A@E?   B A@@ A f&,*EE4 &t (42@ A 5uA@@ A f&A @EE@]A]5uff 5%5uwwwMw Mff 5%5uE A@EA@ A@E?  A@E5u<%A@@ A f&,*EE4 &t (42@ A f&A@EEw2M A@w M ff 4%5uE %A@E 5uA@EA@ 5uA@ 5uA@E?  A@E5u @55 6'A@@ A f&,*EE4 &t (A@@ A f&42@ A EEw(L A@w L @f& 3%5uE %A@E 5uA@EA@ 5uA@ 5uA@E?  A@E5u @55 $)t-&$t-( 42@ A 50u0   w(K4-2*4-4,  w J@  f& 2%5u@f& 2%5uA@E _N,A@E f&A@E &% A@EG E@5(? ?W= @5(/W :A@ f&A@ &% A@ @5(  @5(wIA@E?  A@Ef&A@E&%  A @5(5@5(w NI De t4 tt 4 4 Ne&& U% wI  eu @ ;ewTH wDHw HD - n ne  b P 6wHw lH   jX 7 nw]wPHw 96 m 70"އ]w8w8iwz8w 84De _> t4 t t4 4t Ne&& U% _>t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 > 55 Nefe U% & %5u7  && U%  fe U%ff X% fe& U%w7A@E f& (w r7|wx7w d7D Lԋw\7w H7 @e5ff >%w87w $7D5 NR # >%EAEt = _A5]Ne RNj fej T%CaejNe "Go Aej@ Ke`5  L zy  T%`5d  |  T%` Lӕ:ӕ Bej%_@mo N RK  T%` 5 Nfej 0V%`Aej@55 *@e`5^}^f@ej@A^1e^ ^@^fe` V%j  vUp A%bNfejP u%@-`R ffej, Ke O5K 5h%D 4  n%5 fej rn e>fej T  NAej@f u%N q u & fh nV%%%4wl4w X4D wpwh 57^%P<: ( S%54,  K%7% @ n 77%' J%%& B%% qw3w p3 q7pwj3w V3Dz 7rwP3bw2w 63N "G Bw43w 3D el&&&&Wpe f Wpe f 6 Te6w2w 25 5  AaAE f&A@vUU5u %w2w 2D : w|2̥/ 55D  n&f * e %Nfe n R fe rn fe rn ԥ.̋De & J & n %fe0 n% q %,@e05e @CwNe$ @CwNe( @Cw%r_C _C% _C%2_C|WpfpWpemje, _C@e\5 N @Cf&tVXe -& @ E3$ -  *te%5.N @Cf&@.e@.A Ep@.A Ep - s% -3% $_C -z t-nؖ%_C -^%77te%5  e%7ă -$ _C@e%7w / Nefe Rw/7 AWp@7 7  f HS % n %7670 w `/7 7 7 7 T % n %77wB/w ./*X S̋  C  C  2  w/w .  @55 w-w-  t % -  t5,V 5,X - $ue%&&fe Xe3 e%p e%3w6.w ".& f e[ _ w.w - &Q@f& P%e5uQ@f& ~%e5uumumu _HeeQu  %QQ eu % ff $et ff $e5u< ff r$et< ff $eL A@e@ f& $et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpe u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 c ttwb+!w*\w*w B+De LN n4ed e RK  n4eg  Be v Nfe V%w*w *-@ | w*Ni .& T%.&ew *aw*w ~*w@7% ?@wf*N f Kw @*DC_HQ̥%_.Q 5 r yF _.Q 9% 5afe &  Rl%5@e5 5 N Q _FQ 5.N Q _FQ w) K_FQ K_FQ K_FQ  XQ% _FQ0 XQ% _FQ0 r  r f XQ% _FQ0 XQ% _FQ  XQ% _FQ  r  r f XQ% _L_FQ0 XQ% _L_FQ$ Q _L_FQ' K_L_FQ0 XQ% _L_FQ9 K_L_FQB Q _L_FQ0e r& XQ% _L_FQ0e  @ r& XQ% _L_FQ0 XQ% _FQ_LD K_FQ_L _L Q _FQ_L _L _ L _.Q _L% _Lb_fLfe &. Rl%5@e5_rL _.Q _L _(M _.Q _L _DM _.Q _M _^M _.Q0 el rdf XQ% _FQ_L _M _.Q0 XQ% _FQ_L _M _ L _.Q Q _FQ_L _L _&N h_O _L _L Y% _M!_M _TN G0 XQ% H_L _M _L -- K2_L ! 0 el XQ% _L _M _N _N _L?շ Ԅ ̋_K_Lw $P&A r e0@ A r 5   %F& @  L %F&  Qwd$w P$D wT$ r l h?dw &$u@t5P&5R&@ 5&Nefef U% (3A@u5BtrR&2P&@ Aup& fef U% u-u-u-@w#w n# fe R@w`# @pHA@tw"w (# S!,& T   w# 1&' S%7˕,'Nf HS w "D N !     +  w"e% - r<N r<&@&' Te' ~ ~w " Nef T w "w !D 5  =& T% `5ȥ=  = @w!e  w ! BuNefef Fw%=@@wZ!Ћ Ћ  Jҋ~ @@&w   6v   6v   6vb"w D% 5     |@wx 4- SwmownUlw e& 7 P7Hgw<.B$.I I7Iw  BuNeff Fw%=@@ww  fff Vewwyw&  4  b '     ` TW ~  s`K6!  w D85U5_TX5P_TX  m@e4 ,5Ne & "s  uN fs4USt%X5d Lp5p Lp5& & n% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff n%ށ̥a &  bne 3     U̥r 33w   uff e55 DN'fe& Rl%eN(  N(xH'& Rl%eJ'& Rl%ev(P@A@ 7r:5%  v(& Rl%mm  D'ww D@et5r%=r D " ^ 7;b vy 0 R w|e =r r̋=rNet n Net ne  @et5Net n5&f 4% ޹ B_7 ֹ w DC . @ ^ 7% vy N 2!f k%  P  >wpu5&f % 6 B_7 . w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @ W-@D Ae Bḁ.@e@- @D@pHe _[̋@pHeA Be vC ̂ x uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ fs w5 4@E%@EU5N&e n 6&e rn Nf&e n%4 IN&e n ;&e rn Nf&e n%  (Ne& "s  ff eee@ 4t@t"4 4t q t_0^w N q@ qN tww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  4f ve@ 4tw"w D55ff %f&& "eff&e e &e h 55 ww(w5 5 w D5#@5ff T %f&& eff&e *ew6&e j'44  && ef&& bne&e & u%%U w D5_Tbpo5ff %f&& eff&e Ze L&e j8f f ff&e V e 744  && ef&& bne&e & u%%UUw @@m e%fe r  &e h 55 3ff `%f&e@ &50c &e h 55 3@p m U44  && ef&& bne&e & u%%&_@bfffffe e _@b&e % _b_@be_b  mm@ e@ f& ef&& bnefe& u%%_@b >g_~aw @0 0 @0 N 8d7d7`(ww D85_DeNe& "sq fe Ve4-4-/44  &&  ef&& bne&e & n%%&e r &e h 55 ew|wx(w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  4f ve@ 4t4-4-/44  && ef&& bne&e & n%%&e r ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& bne&e$& n%%&e$ r `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& bne&e$& n%%&e$ r `Btp$t t"  ff Nef&& bne&e$& u%%Uw w r D5#5 5 wڿwֿ(wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& k% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l65l8u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm Rl% a@ `` e w D a@@m e  w e  aAm HN@`@m &f Rl%  aN f`f Rl%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef Fw% LpU4 4  fef Fw%5 w    6v&  @ppC`p   6@Cwzwtw D Lp & & bne 4E05Ew7z Ћ P ы A@PЋ w FD:5UE5Hw* _2p5uNfe & u% _2pbNe & "s  uN fs)U5| m- 5 & u%St%d  .s U   & u% S U _n @_nw DE%%"5   & u% U wv w ^D55@ Lp  q 3 t 4 4 4 4 4 ww~w  $X5+ &5e-de %H & B    r ww  5f r 7 f r 7wX@ mڶ7ضXζ%He w       r e-ww D zX5 e %HwV  5 e-<w p (rww  N uww rDCDpC fs r wZw FN twJ ~5 & E        ~5>wlYwfw Net@f `se  w6w.w  D(U76(U7,(*("Ae vB7   % 55 a  a!PE -ȴ%( w$ fu `e vWt vw@ `e @  fu%nje U?XX `e 7F(U?: a7, $&?U ew dDE wZw FD5 t 5N fs!w5A vBB-  }ee@ !ۃ `!ւ ` `Vmڢ& E%̢mƢ%w w7J*'$!     N 7D& A4& BF7!W-7& & "e Ӌ PT &7̡& \e ӕ-ӕ0B~ӕ.  ӕ0~ B~PT&7t & e Zӕ-0 Nӕ.B B~ӕe4 ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & ze w5 5  W- W00~u5  .luVBw* J@B V_y@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff e w5  @ 0   Wp `e0w  nw]^ww |  p7 ^X B_7 P7 .w`w L ʞ ƞ jX 7 l( V%5#f z  f z 8N [f&( ̥ ̥ 7n)7& z  ̥̋ ̥ %)& z   d)w`w LwНwRw >D CKw4 ˋ 5 w DCB P  5 , :% & E& n z   5 , @ :% & f E n  (˥-%0     ,:% &  n 8 5E& z   5 , @ :% & f E n  ww Nefef 5& }e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @w^w Jfff 5& ~ew8w $ fff 5& ~eww  5 %O N  = )555Ne5& e5)55'0Ne5 B& e57 Be0" 5%)55 5 B5@B e) a=%)7)w %)5 B5Ne& e55e0%)7`Jʕ0%)ʕ1  %)˕0 ʥ9 6@~ LN , *+:Jsendto@(#)if.c 5.3 (Berkeley) 4/20/86@(#)input.c 5.6 (Berkeley) 6/3/86  from"from" address in unsupported address family (%d), cmd %d trace command from unknown router, %spacket from unknown router, %sroute in unsupported address family (%d), from %s (af %d) bad host in route from %s (af %d) @(#) Copyright (c) 1983 Regents of the University of California. All rights reserved. @(#)main.c 5.7 (Berkeley) 4/20/86routedrouterudprouted: router/udp: unknown service -s-q-t-d-gusage: routed [ -s ] [ -q ] [ -t ] [ -g ] //dev/ttyrecvfromsocketsocket: %msetsockopt SO_BROADCAST: %mbindbind: %m@(#)output.c 5.3 (Berkeley) 5/30/86tototo@(#)startup.c 5.7 (Berkeley) 6/3/86socket: %mioctl (get interface configuration)ioctl (get interface flags)ioctl (get dstaddr)ioctl (get broadaddr)ioctl (get metric)ioctl (get netmask)routed: out of memory routed: ifinit: out of memory /etc/routedre-installing interface %s/etc/gatewaysr%s %s gateway %s metric %d %s passivehostexternalhostnethost@(#)tables.c 5.5 (Berkeley) 5/28/86ADDSIOCADDRTDELETECHANGE FROMchanging route from interface %s (timed out)CHANGE TOSIOCADDRTSIOCDELRTdeleting route to interface %s (timed out)DELETESIOCDELRT@(#)timer.c 5.3 (Berkeley) 11/20/85@(#)trace.c 5.3 (Berkeley) 5/30/86"* /7@>HPYb&&&'@'#0REQUESTRESPONSETRACEONTRACEOFFtraceinit: can't init %s aUPGATEWAYHOSTPASSIVEREMOTEINTERFACECHANGEDINTERNALEXTERNALSUBNET%s dst %s, router %s, metric %d, flags %s|%s state %s|%s*** Packet history for interface %s *** tofrom*** end packet history *** toOutputInput%s: no packets. %s trace: %.24s: metric=%D %s %s %s.%dBad cmd 0x%x %s %x.%d size=%d cp=%x packet=%x : dst %s metric %D , file=%*s @(#)inet.c 5.4 (Berkeley) 6/3/86/etc/networksrr# /etc/servicesrr# ,/ %d.%d.%d.%dD9D9N9*9*9*9*9*9*9*9*9*9*9*9*9*99929/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec2 6 mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d" * 4 N ^ v   2 > J \ k { %;JViz4Ul ,<Sw BWj  BTfz RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator`gnvNPOZOxOOOPDPbPPPPQSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02dJ]p]]] ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired ())>xd$xo0xxxfxewgxcxswlwLFxuJxD(xO4xX\xU`)/etc/hostsr# =(\0 rl ~R0 R0 0V @. @ e7cce7T / F  7% n, чw 5 u5 C @t5E5`”6%.N ff Le5  Y*}L 5   N54 }˜ @A  @m.t-(f Ь! =ru@ @m * @w  N tt@A p5 @m4@ @m0A1`@A @ N N= -H7@ w:@p uw ,DCB % % w w   =  7   7  F o2 pww @e5@ @m5u-%Be   ӄ  B  N w,w   6   a0  %  %ww $ uN u 7 #ww   $  N  4 4 4 ww n%NeNe  1  t t tt t4 4 4 4 &ef ˖%ww D 5 @ 5/  5@ e  >  K@ e 3 wpL-@ 535 @ a `e5rB  5# w   K  &e ww N ̀  5 W  Nf @w|w h5  fefe f Leu-w65 W T@ N@5H% @% ;@fe@f&@& @& e 50 @f Ufff e N _ _@ @&  % % @% AAWpT%f' N %O5  _5 'N r   N v@3  s @33_@  r 5 & 0S%  5 _5 _  _N v@5&  = t 5 N r 5 N r Kw D *5&7-H"7-HHHmm@ 4 t HHmm@ 4twnHHmm@ 4 t hHbHmmw (@   e f4@fe @  6   a  %   6  06 t apww @fe @ 6 8  a5/@$@ @&  % N r % a ap   % wˀ a0 w B% D  r@w `w DC,,  r ye&e :˖%we&e Ь ee55 f  % Bmum5 f  e&e Ьe aee `e5% NN Ь ̀ `N ̀ 5`fee5A @ _ A @ _   _  _ _ _  _  _ _ _  _  _* _  _  _  _  _ _ _  _  _ _ w uu@EHML-$f &e :˖%  pt-Nefe&e :˖% t-p Nefe&ne :˖%   @Uw &  f xt r4 tL CC <4=@0 @0 @0 @U e<fQPPPPeA P~N 4   @4&f ˖% f&& e &e(&e& ffC Ĭe =@E _: w D55BB@e5_Z@5 e55 @ ap-T 5-h@5<45fefef Leu-5 u 1% r-  ;A@e@ 2 1r -5), ,f d,%u _ t_ff d%%_ e(55 efe 0 rlp ~R0 R0 0V:˖%  eu-@ZA@@p@AWpa1 D % _6t% f&e( ڠe@@ww @B 5u    wj w Jmr@mn@u @p"p w@0 $$ , ,"t$@$ww w-@7$@4$$@0 $@0 0 "w^t-$$ $w D _ *4 * Wpa D Wpae<@fQPPPP __Wpa D  - Wpa%D- nn%*t1 T& & veEE vEEWtErP Wpa1 D -b np UUUEU H$%  = EE2P Wpae(f&e& && > Ĭe E T   f&& feww DWpae(u  @f& *ef& Ne W    @f& ef& e5u@&A@v5u W -A@- 5uww r  j7 dww D T ww D<3!w&  w jv    &7wBw .@  @ nn w-@7&@4&&N wt-&& &w ¿P5 C _B v5  vE%_B vE%  v5_B v5_B _5 e(xQe :˖%  e5-5-WpBae(e5 !    r-e( @ePPPP @f&:: f& ef& @f&:z: f& eee@ 5u@% Ep, ?   pp@7 u&@&& T%7 &@@, ,@B@@B% h h haT5 e(`u-U@% Op, I  _@    57@7 u&@&& v%7 &@@, ,@B@@B e5-7 8@e 5Q}e}e= 8NNmf  5_j _j 5` @t 5u @t 5u @@@-_j  <5 <5 <55 u%  _| _|u@@@-_j NNmf  5_j _j 5` @ߴt 5uߴ ee @ߴt 5uߴ @@AA@ _j um % p 4n4p4 4  % u@@m@m5@e5 t @&& %7 &@_5 T@@m@-_j 5 Nfe& fff e 5U UUff H$% w u-@@m@- @e@-}eum u- t  %*t @@m@-_j %e T5NNmfff Te%   p   v5   p_5n5pC_5 5 5 @e5  p 5pNfe&n uNfef ˖%Ce3 3 3 @e747 4@e5 @@mef  e5`ff@@me&fe e5_X @@mef  @@ae5&@e5 fefef Le5>u-: @Ae@5Nefefefff *e 55`5smu- %%  <3Nefeffe (e S xZ EU%U  Nfff Oe55`5 2Nf N%55`5 UUUf@efe_6 'CeNffef +e5S@ 5umuN <3l l%N % _ n_ 4 4 e<fQPPPPfe x /j j%   4&& & & fff& e4E h1d1 <4  T f&& e &e(&e& &&1 Ĭe _B_B 11 t% %_BEU UUU &p&_6w lBDfe&fNmf e EUw8` t55 t55 t55   5PuPA@v5u  5PuPA@v5u  5PuP t55@ r y^fe&fNmf e`@e5Ne  _#fe&fNmf e_ `Ne  @ae55%Nf&fNmf e_ `N ̀ 5`% f& ˖%``@Ae@@e5_#fe& ˖%@e5ef&fNmf e_ !`N ̀ 5` _! _! _!  "3@@m_! * _! " !U_ ! _! _! _!  _! !5C`% m-m-u fffff e 5p ,ffffe eN % } @_!w @ t7fe& ff@& Ĭe @ rNf@&r I%@r,,@r w|w hD fe&e &m& e Nffe d%%w(w     d%%7 *t7 ww ү r5 Nefeffe (e  xdfefef Le5 wr  44n+re<fQPPPP t 4 && & & fff& e4 ++ <4   EE2Pp!3-e&ee :˖% & fe x f&& e  e<fQPPPP &e(&e& &&& Ĭe _%w 5 7    <%   % N %"  7-)7-) & 0S%%   whw Tx)t)44/*% %e5  fefef Le5u-& f d%%  wڬ5 @  % 3-  ,,& f d,%5 w hDN  :-4T @ - 5  _@* f % WpT h'_|*wī u= B% =r- %5 &''e@ 2 r 5,' ,z'f d,%@e@-e @@ = =   _(%@ Q@ QN3 %w D 5 5 uBa@ Nf v+%   Nff d,%}@@wZ I   ff NJe5SBmu % %e= WpT h'%Uw @p- %-@p-    @  xx xh@%  @   w\w HD5 fef .P% I f &fe NJe@ w` `Ce @w ҨD 5Nf % & 0S%  ww \5 5 <7$Enw  ue @ A@l7  eBʥ-  _Z. ~c  U d p9 ( ʋ b  ewDe @ȥ-N 7    ?  eN  <7v# 8  , X & & 6 X   qt & e 8 ? %Ed  7.% ДG% P̖%% K %7 %7 %"$fQ BA _ b` oS p$N$J> > >  D? > 6? (? ? ?   Z%5 V  fef ʬeSf % # <## 2e%&n e @e5Neif e   A r 5 u+@%!@eAP~Nei f e ? e  N  7"   """0 0 5 Ҥ_b45Ne i f e  7N"   2"n("pp5 T"$ "f&!&%   !!7! ! !  5@p p Nei f e _0@ppNei f e _05@7 B!7 >!2!.!7 "!7 !7 !_05$Nei f e _0@@pp@  @ A f&@EEf&@= @57}u5 _0@  f& n %5u@5 u cA@@ A f&@  EE5u2Р@5 u @5 u 3uu  5pp@pp@  f&@  = wu _`3Ϥ}u  bϤXϤLRϠu <@f&@&% @f&@&% w-"uwN u Τf D Z_h6Ξ}-u }N u 7"7  Z%? 3  fe ʬe ʬe %S %  <| ^%&hJ e L7F B|5 5 ̛5%  c S A r f vf&A r tUSUS r f vf&v r tUSUS̜ r f vf&~ r tUSUSh7b ^ 7 |7 v  r7 l ) b7 \ |+ b#fQ BAT"  5u  , @e55 N& & fef e % ˊJ r f vf&l r t@a&50$ `StQ& fe& fe e%%#: 7 A r f vf&A r t@a&50_p;StQf 6%5fQ BA _0:%_0: _0:5 5 5 AfQ BADtQ& &fe fAe %_j8@ f& 5u DW @Sf ? @5 StQf 6%5% Sf ? StQf 6%5  _R7u-Çu-uuuf %fef ʬe 5N 8_R7}@fQ BA@@e tQP~@0 @e"p@0 A r f vf&A r tUSUSA r f vf&A r t@aUU x_R7niA r f vf&A r t@a&50C@ _4=Ae"@&5N@&f ^͖% A1`5 %%# @0 Sf ? @5 _R7@Ae"@%_@" fe& –% `ԕ -whw Tff 6%5uE & W & A@E?   %ww  f  ww ГD5 D v5 Nf t_&I_*IECe @@m5Q}e7  vE@L _F 4 4 4 4 EUUU <4 Z N& N%5`5 _Hf & Nff Ĭe _ I_ I <%    4 4 4 4 EU˵e= feff e5ށ` t5 t5C-ʇ%  0EU_B7 HEu5 5 5 @e5 fefef Le5 + (.f  f rf f fefef Le5 _Fu-_F @5Nefefe&fff *e 5_F`55`tmu- %% _`CN T5 fff Te%_F _*C <4Nfff jSe_*I EU%_BU _B _BNff& Oe5`5_B 5#Nfef +e5S@ 5CmuN <4_B @N 5 EU_B5 <4@5ff ˖%NNmf& & & fff& e5Neff f fffe e 5 N @  x` @ j@pn@pp} ο_&I_*I @5Nefeffe (e _:E x\ <4%_B _B _B _BN  5_B` t5 t5e t5ԸCmC-_B@  e f_*C@e 5@5fef ˖%@@me@5C 5 Nf @ 56 o5 @ @m5a@TNf % Ir-ENfe :˖% 9fef .P% & ffe ܚe5S_BCm v@  v@ u   %u N <4u-Nfe ˖%Cm_BNff I%@ XP@ 6 ww  N <5Nfe ܐe%Nff ܐe%wȋw N <5@e5uufef FƖ%Ae@ wp w XDWpTCef' % xh^X 3 s  7-6 57-"ww DQWpTef'u% 5u5 A >8@55   55%!@  f&vp 5u  x NQf ff ܚe  u5 wCCmu  v@  v@ sA@v5u@3A@v5u@3A@v@ ee  _ZN xnNQf &e ܚe  u5  v@= } Cm@NQf &e ܚe  u5 _RK v@= } Cm  &e N e5NQf f ܚe  u5 _RKC`% e@ u N ̀ 5`NQf f ܚe  u5 _RKC`% N ̀ 5`feN u5Nf ˖%Cm@e55  v@= } _FLe5f ˖%ee NQf f ܚe  u5 _RKC`@e55  v@= } _FL f_Lt- _RK&e ˖% v@= = m_FLw DS Ьe %  swnw Z 5 uSB6 fefe Le/",5  %  I +   & d,% d%%e N 5 Nefe ZŖ%5 fef % _XN 8е @p-(05 fe @t@m5*5,  Z%5.  fe ZŖ% @ R  %@ R@Br2B  B2 r @0 wP|fe& & & @&& e5B N 8 fe ZŖ%Nfef I% _W@e57 X % fe& TŖ% fff e55`5%   fe& TŖ% N 8_WN <5N 8@ R_Wff :%&^ e_Wu@e5 % fe& TŖ% fff e55`5%D @  fe& TŖ% @etA*P~@e5@@me5f  e5`Nf  5`Nffet ~u%@ 5 Iu E@ @$  @ppN 8 fe ZŖ%@ "_X@efQPPPP@efQPPPPNe@&" _X@e55 fT `%5 _]  f0 `%fe& & & @&& e5_.YNfef I% WN 8е N 8 __@p0p.@p4p2@p8p6@p<p:@p@ p>@  @0 R@f> `%N c_@Y@e5 % fe& TŖ% fff e55`5%   fe& TŖ% _`\N <5_`\5@e5@@me5 % fe& TŖ% fff e55`5%   fe& TŖ% _`\@e5@  Nf  e5`uNf  @m5& fffe e 5@@m@-_\\ @t 5u %h i feffefe eeNf  5`Nf  5` @t 55  A 5PuPA@v5u A 5PuPA@v5u A 5PuP _[feffefe eNefe ЬNffe ~u%u->u-@_`\5  f. `% f `%_Ww uDC@ @me5@e5*u @2! @ &@& `%@5 eu-҂wtw tDCB  ae5e5'u5 @5 @ @& `%@5 eu-Ղwt@   Nff 0S%5uuw s _bfe XÖ%"fe  5_bfQ BAfQ $f P̖%N t@5 Z P#H b5%3 %Nf P p& f jde qf P & f jde%N @  ֐N % fe lwrw r 5 Ne BAe,u @  % 5-5- %@wHrw 0r   5>fQ BAfQ f P̖%f P޼ f̼ jdef P f jdeN wqw qD< "Z"W&"  5M.& 5 fQ BA> fefe& Le  N f' rT&ff jdeN Ne&" t$t&wpw p5 @e5@ @m5u-_nCe_Nh _Jh5 _Bh%t-_@h 7- 7-~5_@h N f P̖% 5 ' f P N f P̖% % B  A@ ȕ 3@5&@ A@,@ % A@ EN@E&N  H5\Z W  f P̖%_g(& f&WpT@''4 t &&f eeH   ?  A@ ȕ 3@5&@ A@,@ % A@ EN@E&N  & / &f Pee  r y  J t55  5PuPA@v5u 5PuPA@v5u 5PuPff `c%5uff >-%f P̖%   &&f >de f P  ʋ f P̖% _d _d_deʋ f P  f P̖%   && f ce  u5vf f PeBm& f P  u5v f) f Pe1 f P  A@ ȕ @5*@ A@,"@ % A@ E_@hN@E& _"hN 4 f P̖% ̀ `8 f P̖% ̀ ` t55  5PuPA@v5u 5PuPA@v5u 5PuPff@ f ae t55  5PuPA@v5u 5PuPA@v5u 5PuPffF f ae t55  5PuPA@v5u 5PuPA@v5u 5PuPffK f ae t55  5PuPA@v5u 5PuPA@v5u 5PuPffP f `e t55  5PuPA@v5u 5PuPA@v5u 5PuPffU f `e_@h t55  5PuPff] f _ea _6h t55  5PuPA@v5u 5PuPA@v5u 5PuPff <^%5uff (%r f P̖% Lo5 v f P̖%5  55Nf o z f P̖% 5me ڇ~ _h f P̖% ̀ ` _6h _i _,h _,h _Bl "3 _h _Tg _,h _h !g _6h _Zh _,h _,h _l  !%_@h t55  5PuPA@v5u 5PuPA@v5u 5PuPffm _2l@5 wrf@e5@ @m5&Ce fe .P%Neff jde% u-ւ w e N l5_~oN >T XÖ%>Twe@w e Nf 0 & 5_oN FT XÖ%FTwe@w le5 5 fQ BA f  5 N  % 7  N7 N7  7 7 @5_t5 _tfe z%  fe Ьf'%_qG  %N  fe Ь fe Ь fe Ь Nfe z%Ne Ne  % т fe ЬN d_Jp fe ЬN w_Jp fe Ь $ fe ЬNfe z% _pNe 7V_pNeNf&  e_p% &WpT Def'  4  "" 4 "L4 (4 Nfe z% fe  e_Jp.5Ne 4Nfe z% f 4 4 4 4 @ . x Ne 4"Nfe z% *f  eN &&" x%     mm @ 4t  _Jp  t-_Jpt-_Jp55_JpNe 4"&&" x% 4 4 4 4 Ne f&(ta*,4 "(ta *,, (Nfe z% #Ne f&(ta*,(ta *,, Ne 4" 0u_4s (% ( (N fe  +fQ BAw- w-A@rp܀ 5u7 w  fe& TŖ%w`w `D " &&" x% X X w_w _DCeeN  `N  ` t4 4  4PtP  v4t  4PtP  v4t  4PtP t44  4PtPv4t 4PtPv4t 4PtPfQ BAmm@ 4t t44  4PtPv4t 4PtPv4t 4PtP t44  4PtPv4t 4PtPv4t 4PtP t44  4PtPv4t 4PtPv4t 4PtPw]w x]5 5 KNe P  5@"Ne Br2 W @@= .w&Ne  %}u5 Nfe z%  N w\w \T5 5 Nfe  f  5% N  %wd\%5 fQ BANe@ & JN  %,ؾ 5_ @ _z x Nfe z% _zNfe z% Nefe Nefe T N Nfefe x%5`_ Nefe Nfe z% `Nefe T _ Nfe z% INe 5 @@m.@@m0  fe Nefe Nefe 5Nfe z% '%_ Ne@f=  e _A@ E_De5 5 K5 5  ff Qe e`@ 5u %w- w umumu uuNfe z%  fe Ь(Nfe z%Nfe z% _z@ r y e % ˂ fe Ьe % Ne  e_zNe f& N%5uDetfe G%@4fe G%@4A@ G @ e5 Nfeffff e 5A f' rTA1@p%_ܢ_Ne 5  f  e uNfefe ˖%eu Nfe z% Ne 5%Ff  e@@mpN@@me&fe ˖%A 5`u`u N _|Nefe Nefe T Ne DaeNAe@& z% Ae@5 _|Ne& T  ̀ `%N %(_zN bf&@ @55 tfe pE%@4fe ZE%@4A@ E @ eN bf&@@55tfe D%@4fe D%@4A@ D @ e@@mAm@ f&@N bf&@@55tfe bD%@4fe LD%@4A@ D @ eN bf&@@55tfe C%@4fe C%@4A@ C @ eN bf&@@55tfe zC%@4fe dC%@4A@ C @ eAe@5 N %)_B~_z5 5 De ff ZKe e`@ 5u @e!_|_zNe f& DI%5uDetfe B%@4fe xB%@4A@ 0B @ eNf & 5 Nffef e_~Nefe Nefe T Ne ̀ _~&fe fe 9@efefe –%.fe 5@efefe T% Nefe fe ͬNefe ͣ5 5 De ff Ie e`@ 5u @e!_z%_z%_zDeA v@TNfe z% _|Ne& Ne& T  ̀ `_~ _N~ _z _z  "_~_z _| _z _X} !__z _z _z _z _ց _N~ !_~_znffffe e5N 5%% _{%  (N j5%_\yN @0 $0 &@p&p$@p p w@_xw OD Z  YNee Ь Nem ЬwO fe z% NeVt  e %%           $ . ; @  w ND A@ E%;+ A@ EN % D-_Z wlNN %%  % D-_N  #  A@ EN % N  D-%"?%\_B UA@ EO%"?% <%\  A@ EN %\%  Z@@m !Ԑ  A@ EN %% _ _̆N %\%  @@m !_̆Ԑ__چw L5 5 5 5 7A@ E4:%  !+  A@ EN %% %  N  ƀN %A@w>L%;2 %.  %    ff Ce5ue f& ff ^Ceee@ 5uw K  A@ EN %,"%   A@ EN %% %  %;wK  %w J . N 5%.=/@Nf# #@@m.@@m0@@mȕ.N@@m & wbJw NJD    %   w,J%w JNfe z%6Tfe 5%Ne fe ڣ% Nef  e@wIw IB5 @@m0 % 5 5 Nfe z%  =@575 3Ne ( )I5  A@ EN 5%% %  f 6  eA r 5fNmfe ˖%@@mwH4Tfe 5% Ne fe ڣ% Ne>f   e_ʋ% A r@aC r Ctpжu-_ʋu_ʋNf  w G5 5 zv/N _@B2, 2,2,2,u  4vw,v}u5 Nfe z% QNe J  5Ne Br 2 @ , = @  f& %Br2@  BB C @@Br2du N wFw F *4 5N A1@ A1@ z7 wAw A ,z    7z rzU LƖ%5# f  wv f 5=   f N  <7(7&TV7 &  ̥̋ ̥ %rV &   LVw@w @D CKw@ ˋ 5 Zw@hw?w v@D      + - ̥9 Wp @@`e̥0  w0@w @DeEE&E&E& tV Xe tVw?}wP?wJ?w ?w?w ?w?w ?w?w ?w?w ?@ r yw?"    *N&V XÖ%V    *    *   *     w >@  0V XÖ%Vwr>),w R>D xx < @EtEx4PE vEE CtP vEEWtEtP vEEWtEtPwE  EtE@4PwE  EE4PE4 4 4 4 Ce @e5}e= e@e556w0 -*.f "5w  %w=0wzf8fe Xe@e5@ p x4Nfeff ܚé`f ef e <4 > ; Nfeff ܚe` ef e& %e& e <4 @_B@e @-_>f ef e& %ef e  Nf ˖%Cm <4w V;5 C D@m 5YE?B ; 5%.` @-.ӕ\SD-': @ 5Et E@P@mD- D- e@@@-"C- C-ӕ.`@- 5`  @5@wn:w Z: CD@m5 @ e 5u e u5 _ @-@tUA r@@w9 Nf f Ve5Ӏ @ e@-=e= 5 %. %\ D- @ 5   %?} D-w 9Dw9`D- E?  @w 8B(@E? )w8 ̥\ Ԥ 5ˋ@@%.eB- ݃D @Et @PCm 5̋w H8D t Pw@8w ,8D 55 @v5u  5PuPA@v5u  5PuPA@v5u ӁPw7w 7DC3 v@ w7w 7Dtfe &%@4fe &%@4A@ |& @ wT7fw6w :75 7 @q7 >q2q5 <7(qq7Nq  _T_fe Ö% #Ce  ˥ ˥ ˋmz –%7q z Z X fe Ö% L%HCe  ˥ ˥ ˋ: f&@tLN@t L ,N@t0 L0 N@tH5 fej XÖ%CaejNe CAej@ `e`5 d d|Qd d ~dM XÖ%`5hd  P XÖ%` Pdӕ:ӕ Bej%_¯mo N "U XÖ%` 5 Nfej Ŗ%`Aej@55 c*@e`5^}^f@ej@A^1e^X^@^fe` FƖ%  zcUtc %fcNfejTc Ԗ%@-`R ffej0c Te O5"cK 5h%D 4 Z X͖%5gfej e>fej  NAej@f Ԗ%N 8  & fh "Ɩ%%%Zw$w $D wtbwlb 57bb%Tb<jV –%58b,  Z%7b%  X 7bb7a%a'a %%ahVa %%a 8a8w#w #a 8a7w#w #D~a 7vaw#bw#w #N  w#w x#D el&&&&Wpef WpetfV XeVw:#w &#5 5  AaAE f&A@vUU5u %w"w "D w"̥/ 55 &f > e %Nfe &fe fe ԥ.̋De &  & X %fe0 ^͖% 8 %,@e05e wxNe$ wjNe( w\%rR_n J_n% >_n%2_n*WpfWpeme, _n@e\5 N f&tVVe -Ԣ @ E3\ - *te^5.N f&@.e@.A Ep@.A Ep -\ s^^ -H3^^ 8\_n -( t-^_n - ^^7^7^te^5  e^^7^ -ҡ _r@e^^7^w  Nefe w 7 AWp@7¨ 7  f  ^^ ^^7:^74^ w 7 H7 7 7 (^^ ^^7^7^ww ب, ̋  X  X  2  wXw D  @55 w-w-  t ^ -  t5,V 5,V -f ܛ\ue^&&fe Xe3 e^^pe^^3ww z& f e/\3wfw R ^Q@f& e5uQ@f& e5uumumu _jeeQu  %QQ eu % ff et ff Xe5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 7ttw!w&\w w De LN 4e8e "  4e; Be v Nfe FƖ%w(w -Z@ PwN=^ XÖ%^ewbaw\w wX@7N% ?B@8wN f w DC_̥%_ 5 r y _ 9% 5afe & ˖%5@e5 5N _ 5N _ w _ _ _  (% _0 (% _0 r  r f (% _0 (% _  (% _  r  r f (% _R_0 (% _R_ _R_ _R_0 (% _R_  _R_ _R_0e r& (% _R_0e  @ r& (% _R_0 (% __R __R _R __R _Ժ _ں _ _R% _Rb_6fe & ˖%5@e5_B _ _X _ _ _| _ _ _ _. _0 el rdf (% __R _ _0 (% __R _̼ _ں _ __R _ _ h_ҽ _» _j Y% __ _$ G0 (% H_R _̼ _ - 2_R ! 0 el (% _R _h _ _ _R? ̋__Tw ^A r e0@ A r 5   %^ @  L %^  ww D w  ?w ~u@t5^5^@ 5N_Nefef ZŖ% (3A@u5Btr^2^@ AupN_ fef ZŖ% u-u-u-@ww  fe @w @pHA@tww j !,&   wf 1&_ –%7ŝ˕,_Nf  w D " !     +  we% - r<N r<&@&_ Xe_ ~ ~w j Nef wdw PD 5  =,& Ö% `5ȥ=  = @we  w  BuNefef n֖%=@@wЋ Ћ  Jҋ~ @@&wW f r @  W f r@  @ C& eJ   6v   6v   6vb"  E6P6 EP<w 2D% 5     |@w4- SwbnlwR e& 7 RZ7JZgw$w8ZB*ZI I7Iw r BuNeff n֖%=@@wHw 4Nff @ew(w  fff @ew wvywp&  4  b '     ` TW ~  s`K6!  w hD85U5_5P_ X mX@e4 ,5Ne & J  uN 4USt%5xW t5tW t5& & ^͖% 45@e-4  % U5EU  w: E w  D  +   r= wB w 5 a U5ff X͖%ށ̥a &  e 3     U̥r 33w 0 D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff e A f&A@vee@ 5u 5 @ W-@D Ae Bḁ.@e@- @D@pHe _̋@pHeA Be vC ̂ xuuff %5uw A@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BP  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef n֖% tU4 4  fef n֖%5 w    6v&  @ppC`p   6@Cw^wXw D t & & e 4E05Ew7, Ћ PPЋ w FD:5UE5Hw* _Z5uNfe & Ԗ% _ZbNe & J  uN )U5| m- 5 & Ԗ%St% O V U   & Ԗ% S U _ @_w DE%%"5   & Ԗ% U wv w ^D55@ t  8 3 4 4 4 4 4 ww~w  $5+ | &5e-d^e % & B    ww  5f 7 f 7NwX@ mڎ7؎Ύ%e w       e-ww D z5 e %wV  5 e-<w  Pww  N ww rDCDpC  wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  D_U76_U7,_*_"Ae vB7   % 55 a  a!PE -Ȍ%_ w$  `e vWt vw@ `e @  %nje U?XX `e 7F_U?: a7, $&?U ew dDE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `VmBK& E%4Km.K%w w7*'$!     J 7J& AJ& BF7!~JW-:7jJ& & e Ӌ  &74J& e "Jӕ-Jӕ0B~Jӕ.  ӕ0~ B~&7I & Le Iӕ-0 Iӕ.I B~ӕeI ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B V_:@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& z   5 , @ :% & f E  (˥-%0     ,:% &  8 5E& z   5 , @ :% & f E  w&w Nefef 5& be C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& eww  fff 5& eww  5 %O N  = _555Ne5& ,e56`55'0Ne5 B& ,e57C Be0" 5%6`55 5 B5@B e_ a=%_7F_w %6`5 B5Ne& ,e55e0%6`7K`Jʕ0%_ʕ1  %_˕0 ʥ9 6@~ @(#)named 4.8 #19: Sun Sep 10 01:43:36 PDT 1995 sms1@sms.sms.iipo.gtegsc.com:/usr/src/etc/named/named named 4.8 #19: Sun Sep 10 01:43:36 PDT 1995 sms1@sms.sms.iipo.gtegsc.com:/usr/src/etc/named/named ???@(#)db_reload.c 4.15 (Berkeley) 2/28/88reloading nameserver  qQK>savename: %msavedata: %msavehash: %msaveinv: %msavestr: %m@(#)db_update.c 4.16 (Berkeley) 2/28/88:,  8 L d %s has CNAME and other data (illegal) @(#)ns_forw.c 4.26 (Berkeley) 3/28/88forw: %mforw: %m@(#)ns_resp.c 4.50 (Berkeley) 4/7/883@3333333@333333@3@333333@z@GzXD #X#~#%%++++++++++++MAXQUERIES exceeded, possible data loop in resolving (%s)Malformed response from %s check_root: Can't find root! check_root: %d root servers after query to root server < minNo root nameservers for class %d @(#) Copyright (c) 1986 Regents of the University of California. All rights reserved. @(#)ns_main.c 4.30 (Berkeley) 3/7/88  /etc/named.boot/usr/tmp/named.run/etc/named.pid/dev/null/dev/ttynamedw%d restarted socket(SOCK_STREAM): %mbind(vs, %s[%d]): %mget interface configuration: %mget interface flags: %mget interface addr: %mmain: Out Of Memoryget netmask: %mget interface flags: %mget dst addr: %mmain: Out Of Memorysocket(SOCK_DGRAM): %mbind(dfd %d, %s[%d]): %mReturn from getdtablesize() > FD_SETSIZEselect: %mrecvfrom: %maccept: %mUsage: named [-d #] [-p port] [{-b} bootfile] /usr/tmpsqadd: Out Of Memory-%s [%s]getpeername: %m-%sgettimeofday failed: %m@(#)ns_req.c 4.32 (Berkeley) 3/31/88ED`FFFE&JJ6JNLZNZNKLNLKKZNZNKZNLM.ns_req: Out Of Memorydomain name too long: %s... Name_Too_Longwzone XFR to@(#)ns_sort.c 4.3 (Berkeley) 2/17/88@(#)ns_maint.c 4.23 (Berkeley) 2/28/88XVXVzoneref: socket: %mzoneref: res_mkquery failedno SOA from server %s, zone %s (len 0) zoneref: res_mkquery failedzoneref: Masters for secondary zone %s unreachable@(#)db_dump.c 4.20 (Berkeley) 2/17/88mmn/usr/tmp/named_dump.db%s.chkw; Dumped at %s%d root hints... (too low); ---- Root hint cache dump ---- ; ---- Cache dump ---- w; Dumped at %s; --- Cache & Data --- ; --- Hints --- w$ORIGIN %s. . .%s. %s %d %ld %ld %s %s %s ; %ld . %s. . %s. ; %ld??? "%.*s""" "%.*s"""%s. %s. ( %lu %lu %lu %lu %lu ) %lu %s. "%s" %lu %s %s %s %s. %s. ??? %d%d@(#)ns_init.c 4.23 (Berkeley) 2/28/88,ssrr%s: %mcacheprimarysecondarydirectorydirectory %s: %m sortlistforwardersslavedomain%s: line %d: unknown field '%s' too many zones (MAXZONES=%d) %s: line %d: missing origin %s: line %d: missing origin %s: line %d: cache refresh ignored '%s' (ignored, NOT dotted quad)@(#)db_load.c 4.26 (Berkeley) 2/28/88inchaosanscnamesoambmgmr null wks ptr hinfo minfomxuinfoduidegidf"T~zzz:ztyyzr%s: %m%s: %m.Line %d: Unknown type: %s. %s: line %d: CPU type too long%s: line %d: OS type too long%s: line %d: database format error (%s)includeoriginLine %d: Unknown $ option: $%s line %d: expected a numberline %d: unexpected EOF%d%s: line %d: unknown protocol: %s.%d%s: line %d: Unknown service '%s'%s: line %d: port no. (%d) too big %s: line %d: missing close paren @(#)ns_stats.c 4.3 (Berkeley) 2/17/88/etc/protocolsrr# /etc/servicesrr# ,/ %d.%d.%d.%d")19;=?ACKS\dmv~4PlQUERYIQUERYCQUERYMCQUERYU45678UPDATEAUPDATEDUPDATEDAUPDATEMUPDATEMAZONEINITZONEREFNOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSED67891011121314NOCHANGEANSCNAMESOAMBMGMXMRNULLWKSPTRHINFOMINFOAXFRMAILBMAILAANYUINFOUIDGID%dINANY%dd%s.%s/etc/resolv.confrdomaindomaindomainnameservernameservernameserverLOCALDOMAINШШ  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d"2JTn0?O^o*=Nd~)@Z|'Kl+>`s(:Nd~RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator4;BJT]dmu~ *Hf2`SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%yqu},h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02dnʔʾ ((((( AAAAAABBBBBB _6`6`fdLoXxf$egcs&l&LnurDPO\XU=(\0 slr : R0/R0/0T  *( e7cce7 /  7%  w @ d w<w (D* R ?E G ߮  -?% >& ߄ F  t݀5t>EZ -Z ?L%  >>& 2 F w5(> w bD LԋwZw FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%>   U   & % S U _n @_rw DE%%"5   & % U wv w ^D55@    3 ( 4 4 4 4 4 ww~w  $25+ v &5e-zXe %" & X     ww  5f  7 f  7wX@ m72%"e w        e-ww D 25 e %"wl  5 e-Rw . ww  N ww rDCDpC  V wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  ZHU7LFU7BH@F8Ae vB$7 &  % 55 a  a!PE -%F w$  `e vWt vw@ `e @  %e U?nn `e 7\FU?P a7B : fe eBe %e %e %e     %eӕ0Ae@5 | (5 fffff $e = ̕1 fffff $e $ ( "     f e _N  !  N P !wB"w ."Nfe   ̋&4 %Ne  &9 %Ne  &> %Ne  w!w !D   !w!w !  J7*w(" * %  "   @ E wT! 5% %f" 7i& 7" 7`w`w l&  7bo&  7Jr& 7@u&  \7"w x& _ \7 w {& 7~& 7& 7_:w 4 D  5 & & e5u A@w5 5 5@ 5`u`u w w- @m7ȥ- |> n-hb ^7%:f (@ 8 2  f <   <       ?w ̥:7 `*+L w-  f <   @m7   9 E5 @@l ww BDC E5<E@e33. @;E  5 , @;% & fE 8 5  U3 3  ww D      + - ̥9 Wp @@`e̥0  w:w "D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  wA@w D  7 - f s 3  33 a r w w>+& f ew D Lԋww DC f w5 7R@  55@- 7 &5!w zDe LN (4ee  (4e Be v Nfe $ %ww -@ wN$ %$ w  BuNefef %%=@@wЋ Ћ < wyw&  4  b '     ` TW ~  s`K6!  w D85U5_ 5P_  m@e4 ,5Ne & "  uN "4USt% 5v 5r 5& & % 45@e-4  % U5EU  wE w D z +   r= wB wd5 a U5ff %ށ̥a &  e 3     U̥r 33w 4$ " w5 4@E%@EU5N&e   &e  Nf&e %4 IN&e   &e  Nf&e %  (Ne& "  ff eee@ 4t@t"4 4t  $_ w nN @ N $w^w JDff %5u4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4tww D55ff %0 tlG5mR0R00Tf&& "eff&e e &e j 55 ww8 wF5 5 w (D5#5ff T %f&& eff&e *ew&e N'44  && ef&& e&e & $%%U w ZD5_"o5ff %f&& eff&e Ze L&e N8f f ff&e V e 744  && ef&& e&e & $%%UUwh @@m e%fe H"  &e j 55 3ff `%f&e@ &50c &e j 55 3   U44  && ef&& e&e & $%%&_fffffe e _&e % _R_e_R  mm@ e@ f& ef&& efe& $%%_ _Lw @0 0 @0 N 7D7@< ww xD85_Ne& "q fe Ve4-4-/44  &&  ef&& e&e & %%&e H" &e j 55 ew\wX@ w4 et 5-5-5 5 w bD4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4t4-4-/44  && ef&& e&e & %%&e H" ww |D4- 4-  wl & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& e&e$& %%&e$ H" `$BtA @@w rD4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& e&e$& %%&e$ H" `Btp$t t"  ff Nef&& e&e$& $%%Uw( w  D5#5 5 wwD w  @ a@ a@m5A a@5w D 5# aB- f a@m& % wn e aC-w B D@ A 5@u@e@ 5u   w uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l 5l u te%w 0 D5u-5 w @e@- @ a@ a@ a5@ a@@@m`&fNm % a@ `` e w p D a@@m e  wN e  aAm HN@`@m &f %  aN f`f %  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef %% U4 4  fef %%5 w>    6v&  @ppC`p   6@Cww7 Ћ PPЋ w FD:5UE5Hw* _5uNfe & $% _bNe & "  uN ")U5| m- 5 & $%St%  " U   & $% S U _` @_dw DE%%"5   & $% U wv w ^D55@   3 $ 4 4 4 4 4 ww~w  $ 5+ V &5e-8e % &     " ww  5f " 7B f " 7wX@ m7  % e w       " e-ww D  5 e % w  5 e-zw  !ww  N %ww rDCDpC " H" wZw FN $wJ ~5 & E        ~5>wlYwfw Net@f "e  w6w.w  b U7t` U7jb h` `Ae vBL7 N  D%> 55 a  a!PE -%`  w$ $ `e vWt vw@ `e @  $%e U? `e 7` U?x a7j bd?\XU ew dD8E wZw FD5 $ 5N "!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%m%w w7*'$!     J 7@& A0& BF7!W-)7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_'@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& 8 z   5 , @ :% & f E 8  (˥-%0     ,:% &  8 8 5E& z   5 , @ :% & f E 8  w@(#) Copyright (c) 1980, 1983 Regents of the University of California. All rights reserved. @(#)mkpasswd.c 5.4 (Berkeley) 2/22/89pvrmkpasswd: %s: can't open for reading. %s.origmkpasswd: %s: %s wmkpasswd: %s: fdopen failed. mkpasswd: %s: %s %ld%s:*:%d:%d:%s:%s:%s mkpasswd: dbm_store failed. .pag.dir.origusage: mkpasswd [-p] passwd_file : : : : : : : : : : : illegal option -- : option requires an argument -- : Unknown error: %d 0<N`r~%DSbz *Ifw (Xo-Ia"6IXl  8 Z o RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired H l l &d&o&xh'fv'eh&gB'cN'sx&lx&L&u&D&O&X&U0 uli 8 gikR0.R0.0S  (( e7cce7 /  7%  w @ d w<w (D* R ?E G ߬  -?% <& ߂ F  r݀5r<EX -X ?J%  <<& 0 F w5&< w bD LԋwZw FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%<   U   & % S U _n @_rw DE%%"5   & % U wv w ^D55@    3 ( 4 4 4 4 4 ww~w  $05+ t &5e-xVe %  & V     ww  5f  7 f  7wX@ m70% e w        e-ww D 05 e % wj  5 e-Pw . ww  N ww rDCDpC  V wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  XFU7JDU7@F>D6Ae vB"7 $  % 55 a  a!PE -%D w$  `e vWt vw@ `e @  %~e U?ll `e 7ZDU?N a7@ 8:?2.U ew dDE wZw FD5 ( 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `jm4& E%&m %w w7*'$!      7& A& BF7!pW-7\implog hasn't been implemented under 2.11BSD.,PP0 vl O=?ACER0|R0|0S @A:  e7cce7 /   7%  9w 6 X R N\ "w 6D Wp Cae   \ " \ & ! %dw5w 5) A vENfEf (4e h7 fe L"%5րwb5w N5  05 5 qt f |:eN ,8w&5 w4 w4w 4DC+ 5 7 a  r5 w: w4 U5ff 05%̥a &  ~5e 3     U̥r 33w 4w- @m7ȥ- > - 7>%:f \! (l d ^ t f x t  x t  @ t  @ ?wn3 ̥:7 *+ w- t f x t   @m7t+ j 9 E5 @@l wl+w 2DC E5<E@e33. @;E  5 , @;% & fE 5 5  h7U3 3  w2w 1"5  @ @ap t- 5N m& 5)%N,t (4% rNef R wr1@ @a0  m  w 81 n j\ J$ 7ZT <5w"1w 1 D> 77 6w1w 0DC  ̋̋w0w 0  l\ J$ 7 E x"%7:& 6 7:& 6  f7:& 6  & 6  %D,& 6 ̋ w20w 0 .  * L  w0  5 ff L% 50   8 Jw /  uN 55&f %5Jw/ 5  f 5  0   w 6/ p  @e5ff l%5Jw / 5  w-   4 w .  <5  &  2%%7w.~ 55f J$ 7h w D. wJ.w 6. t  w8.wVw . ,& ^&7    77 w-w -w&w-w -   @ E w- "5% %f x"%  f \!f T 7& T 7v& T  f7^0 vl  O=?ACER0|R0|0S& T  f7F& T 7<& T  7w& T  7 w & T 7& T 7& T 7_rw , ` w,  7  "+~ T+55 ff^ 0e55D ` Df4.N& n3%eP& n3%eR& n3%e^& n3%e7w +  _b 5__5 & f 05%5=` 5u fff ~5e5 #u 1ff 65%50ff :=fN ,8w*w *D      + - ̥9 Wp @@`e̥0  w~*w f*D5 5      + -! ̥9 f& ff !eee@ ee@ 5u̥0 A@  w)A@wJ)w )Nf  w)Pw*)w$)w )Nf  w)~w)w )4De _ t4 t t4 4t Ne&& !% _t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 * 55 Nefe "% & > %5u7  && !%  fe "%ff % fe& !%w*(A@E f& w (dw(w 'D Lԋw'w 'DC . w'5 7@  55@- 7 5!w v'N  wt'w `'D el&&&&Wpef WpefN !ew"'w '5 5  AaAE f&A@vUU5u %w&w &D vw&̥/ 55 5&f & e %Nfe 5 fe 5 fe 5 ԥ.̋De &  & 05 %fe0 65% ,8 %,@e05e wTNe$ wFNe( w8%r._z &_z% _z%2_zWpfWpeme, _z@e\5 N f&te - @ E3 - *te5.N f&@.e@.A Ep@.A Ep -8 sF -$3F _z - t-_z -F7>78te5  eF7 - _~@eF7w $ Nefe tw#7 jAWp@7 7  f  F 5 F77 w #7 $7 `7 ^7 ^F 5 F7d7^w#w n# ̋  d  d  2  w@#w ,# p @55 w-w-  t  -l  t5, 5, -B ܃ue&&fe Xe3 eFpeF3wv"w b"& f e2wN"w :" |Q@f& e5uQ@f& e5uumumu _veeQu  %QQ eu % ff et ff $e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( AJ 5 8u 4  AJ f&A@ 5u r  r   AJ @mAm@ 5u e4 tWpeu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw!w\ww De LN 54ee .  54e Be v Nfe r"%ww -&@ wN !%Fe& ;ew6w u@t55@ 5(Nefef "% (3A@u5Btr2@ Aup( fef "% u-u-u-@w w  fe t@w @pHA@tw6w  !,& \!   w 1&h h %7˕,hNf  w ND \  !     +  we% - r<N r<&@& h !eh ~ ~w  Nef ww D 5  =& z!% `5ȥ=  = @w2e  w  BuNefef l=%=@@wЋ Ћ  Jҋ~ @@&ww D% 5     |@wT4- Swmown "lw e& 7 7 gwfw Nff l"eww>yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_4$5P_4$  m@e4 ,5Ne & >:  uN :4USt%\ 5h h75t h75& & 65% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff 05%ށ̥a &  ~5e 3     U̥r 33w 4$ : Z w5 4@E%@EU5N&e 5 : &e 5 Nf&e 05%4 IN&e 5 ? &e 5 Nf&e 05%  (Ne& >:  ff eee@ 4t@t"4 4t ,8 ;_L%w N ,8@ ,8N ;ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  P- ve@ 4tw"w D55ff %f&& "eff&e e &e / 55 ww w5 5 w D5#5ff T %f&& eff&e *ew6&e 1'44  && ef&& ~5e&e & <%%U w D5_p)o5ff %f&& eff&e Ze L&e 18f f ff&e V e 744  && ef&& ~5e&e & <%%UU6w @@m e%fe 9  &e / 55 3ff `%f&e@ &50c &e / 55 3D t (4 U44  && ef&& ~5e&e & <%%&_\)fffffe e _\)&e % _)_\)e_)  mm@ e@ f& ef&& ~5efe& <%%_\) Z._(w @0 0 @0 N T+7X7Tww D85_`,Ne& >:q fe Ve4-4-/44  &&  ef&& ~5e&e & 65%%&e 9 &e / 55 ewpwlw4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  P- ve@ 4t4-4-/44  && ef&& ~5e&e & 65%%&e 9 ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& ~5e&e$& 65%%&e$ 9 `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& ~5e&e$& 65%%&e$ 9 `Btp$t t"  ff Nef&& ~5e&e$& <%%Uw w r D5#5 5 wwwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& 3% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l: 5l< u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm n3% a@ `` e w D a@@m e  w e  aAm HN@`@m &f n3%  aN f`f n3%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef l=% h7U4 4  fef l=%5 w    6v&  @ppC`p   6@Cwzwtw D h7 & & ~5e 4E05Ew7  Ћ P ы A@PЋ w FD:5UE5Hw* _N75uNfe & <% _N7bNe & >:  uN :)U5| m- 5 & <%St%h v J: U   & <% S U _ 6 @_6w DE%%"5   & <% U wv w ^D55@ h7  ,8 3 ; 4 4 4 4 4 ww~w  $\ 5+ T &5e-X6e %L & 6    9 ww  5f 9 7 f 9 7nwX@ m7\ %Le w       9 e-ww D n\ 5 e %LwJ  5 e-0w 7 D9ww  N wlYwfw Net@f |:e  w6w.w  8U7*U7 Ae vB7   % 55 a  a!PE -% w$ < `e vWt vw@ `e @  <%b^e U?LL `e 7:U?. a7  ?U ew dDE wZw FD5 ; 5N :!w5A vBB-  }ee@ !ۃ `!ւ ` `Jm& E%ѷmч%w w7*'$!     6 7,& A& BF7!W-,A7w 8uDAB %u f& & e w5 5  W- W00~u5  .luTBw* J@B |_8?@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& 5 z   5 , @ :% & f E 5  (˥-%0     ,:% &  5 8 5E& z   5 , @ :% & f E 5  w6/usr/lib/crontab/usr/lib/crontab.local@(#)cron.c 4.12 (Berkeley) 5/27/86d:w//r/r%d: cannot find %s /r%d: executing %s/bin/shsh-c%d: cannot execute sh r%d: child exits with signal %d status %d /dev/tty: illegal option -- : option requires an argument -- initgroups: %s is in too many groups setgroups/etc/grouprrr/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwdSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecnrmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d^fp (:LXnz-<Taw#@Qp2Ihx#;\~ # 2 F \ ~  4 I RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator , h     TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired d>dJ>oV>x?f"?e>g>c>s$>l$>Ll>up>DN>OZ>X>U0 wl.#%')+R0_R0_0R !  e7cce7  / 4  7%  w v        u55uNe& Ne  8  , l%%    j  e   &  l% j  e  fe %!fe r%% P f jX  e L  5. j"  e LNe b     LNe b u-u-    LN xN   l   n  x|    L X  3   L& & %( & fe %e5W &Kfe %e5fc %fh % & fe l%  Nefe fm %fr %Nefe fw %}fe 8 6  ww n fe 8_ Nfe R%  w:fe _  & & _ h 5u   _ W-  ek& \ h 5u W & &  & & & & # ʋ N   5  ;& _>  T % _$w  B 5 fxoa e Ne *5@-%%  wHw . { p5/f V 5 u55 5 ff ve jf e Ne *5@-%%  ww p         ߺ % %   % %n ww  % N ww Nef  ww   p5/f 8@Nevf& %@ 6    w\v@ev5xt%t t@t @aAt AmpxNev   %ч Nfev       w DCB̥:̋ ҕ/Ҕˋ ̋ w 2 ;ew ww R  Z7e@w<w (  7   7 7 w w  7ww 4  7   7 |  $ 2Ne & b %N 7FA r&  7(",    7 +˥/ˋ ˥#˥#ˋ˥#ˋ   R%   ww D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  whA@www >D  F7 -   s 3  33 a r w w+& f ew  fef %5 "w `www v4De _@  t4 t t4 4t Ne&& % _@ t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 Z 55 Nefe % & %5u7  && %  fe %ff % fe& %wA@E f& dw ww D Lԋww DC v w5 7b@  55@- 7 65!w jDe LN 4ee j  4e Be v Nfe L%ww -X@ &wN % je& ;eww u@t5( 5* @ 5 Nefef % (3A@u5Btr* 2( @ Aup  fef % u-u-u-@w w Nef  w w D 5  =V& % `5ȥ= 0 = @wv e0 wl.#%')+R0_R0_0R  w V BuNefef %=@@w* Ћ Ћ   Ћ Ћ  Jҋ~ @@< w" Sw mow nlw e& 7 7gw BI I7Iw $  & f Few w yw &  4  b '     ` TW ~  s`K6!  w z D85U5_5P_  m@e4 ,5Ne & b  uN 4USt% 5V 5R 5& & r% 45@e-4  % U5EU  wL E w * D " +   r= wB w 5 a U5ff l%ށ̥a &  e 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef % U4 4  fef %5 w"   @ppC`pwbw\w D  & & e 4E05Ew7F  ы A@PЋ w FD:5UE5Hw* _r5uNfe & % _rbNe & b  uN )U5| m- 5 & %St%  n U   & % S U _0 @_4w DE%%"5   & % U wv w ^D55@   P 3  4 4 4 4 4 ww~w  $ 5+ &5e-tte % & R     ww  5f  7 f  7wX@ m7 % e w        e-ww D  5 e % wf  5 e-Lw  hww  N ww rDCDpC   wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  TU7FU7<:2Ae vB7   % 55 a  a!PE -% w$  `e vWt vw@ `e @  %~ze U?hh `e 7VU?J a7< 46?.*U ew dD E wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `fm& E%m%w w7.*'$!      7x& Ah& BF7!JW-P!76w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_\@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w@(#) Copyright (c) 1987 Regents of the University of California. All rights reserved. @(#)vipw.c 5.9 (Berkeley) 4/22/89/etc/ptmpvipw: password file busy. vipw: %s: %s /etc/master.passwdvipw: %s: %s vipw: %s: %s; rvipw: %s: %s; vipw: edit failed; vipw: no changes made; vipw: can't fork; vipw: mkpasswd failed; /etc/passwd/etc/passwd.dir.dir.pag.pag.orig/etc/passwdvipw: line too long: root: : vipw: root uid should be 0vipw: %s > max uid value (%d): vipw: %s > max gid value (%d): : : : : : vipw: warning, unknown root shell. : vipw: corrupted entry; line #%d. /etc/mkpasswdmkpasswd-pEDITORvivipw: %s: %s re-edit the password file? [y]: %s unchanged. /bin/shPATH:/bin:/usr/binsh/bin/sh/bin/csh/etc/shellsr: Unknown error: %d *DVhx%4EYm$:Tr0Rp!B[u  6 I V j ~  $ : T g RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB  dnozx8fFe8gcsHlHLuDrO~XU0 xl rR0R00R @"  e7cce7 / p  7%  w 8 &  |  5 5 @eAePPPP fe& t%   & %f& %w  ww    xw     qt & e  !  # # %% &  &  &  %   w| wnZwfw D Lԋw$w De LN 4e.e  J  4e1 Be v Nfe %wNw :-@ Fw4N3& 4%& w u@t5: 5< @ 5 Nefef % (3A@u5Btr< 2: @ Aup  fef % u-u-u-@wdw P BuNefef %=@@w$Swmowlwv e& 7 47,gwHyw@w:Ћ w$w N ww w6w7*'$!     t 7j& AZ& BF7!<W-07(w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   ww D:5UE5Hw _ 5uNfe & *% _ bNe &   uN  )U5| m- 5 & *%St%8  U   & *% S U _ @_w zDE%%"5   & *% U w. w D55@    3 H 4 4 4 4 4 ww 8$,5+ 4 &5e- e % &     @ wVw B 5f @ 7 f @ 7w@ m7,v% e w ` R    @ e-6ww D ",5 e % w  5 e-w Tn wXw DDCDpC   | w,w N Hw ~5 & E        ~5>w>Yw8w Net@f e  ww  U7 U7  Ae vB7   % 55 a  a!PE -%  w  `e vWt vwX@ `e @  %0,e U? `e 7 U? a7 ?U ew D d  d   d   d 33ww D       ww N ^5uN ( N  w` N %  /f    5  fe % 2 "P~ ʋD% eD  5 rDWpDN f %eD% N %w w hD̥: ̋̋wZw F C Wp De` ˋˋ =K ˋˋ ww  4%w = @0 @0 :&fe % &fe %w d H $  707 * wL w 2  7 w( w     5%% w w p  N& w w B  N& w pw ~   N& wl @w N D LԋwF $w . De LN 4ee d  4e  Be v Nfe .%w w -X@  w N  % w v BuNefef N%=@@wJ   Ћ Ћ  Jҋ~ @@wd yw^ &  4  b '     ` TW ~  s`K6!  w V D85U5_5P_  m@e4 ,5Ne &   uN d4USt% 5n J 5j J 5& & r % 45@e-4  % U5EU  w( E w  D  +   r= wB w5 a U5ff l %ށ̥a &  x e 3     U̥r 33w D5"E@e44fef N% J U4 4  fef N%5 w w w7`  ы A@PЋ w FD:5UE5Hw* _0 5uNfe & % _0 bNe &   uN d)U5| m- 5 & %St%  , U   & % S U _ @_ w DE%%"5   & % U wv w ^D55@ J    3  4 4 4 4 4 ww~w  $ 5+ &5e-e % &      ww  5f  7p f  7wX@ mF7D :% e w  $      e-ww D  5 e % w  5 e-w  &ww  N ww rDCDpC d  wZw FN wJ ~5 & E        ~5>wlYwfw Net@f ^e  w6w.w  U7U7Ae vBz7 |  r%l 55 a  a!PE -40 yl- N!R0R00Q% w$ d `e vWt vw@ `e @  d%e U? `e 7U? a7 ?U ew dDfE wZw FD5  5N d!w5A vBB-  }ee@ !ۃ `!ւ ` `mJ& E%Pbr~.?Sg 4Nl*Lj<Uo0CPdx 4NazRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB ((Fd,o8xfegcslLNuRD0O<XdU0 zl R#R0R00N   e7cce7  /   7%  .w h   5 f  %%9 ̋ eD%  .) r _%_r   < _ n .r . e%@& 0 @& 0 @& 0  @& 0  @& 0 +@& 0 @& 0  @& 0  @@&f P% 5 .%C "  n .@ 52@& 0 @& 0  @& 0 @@&f P% .% b  .N@&@& P%w"w D&e   &%&e@ 0  &%&e@ 0 ( & ^ X P L5J< -< ?.% V & V  n wxw d M7f 0  ff % -N:b %   x~ANfdb ewRN nlf 0 o f   //f  5 Ne 0 eD%  ˋeD% fe &%3?f &%3Ne@ L   D% "r  5 rD WpDN f 2%N _ˋw:)w4w D̥: ̋̋ww  C Wp De` ˋI ˋ =K ˋˋ wNw :0 %w,= @0 @0 :&fe (% &fe (%w j $~ 7R7 L w w x 82 V7 *wn w Z   & z5%%& w6 w " p  N& 0 w w B  N& 0 w pw   N& 0 w @w w V fef %5 wz w b D LԋwZ w F De LN ^ 4eev   ^ 4e Be v Nfe %w w -L@ w N2 N%2 ~ ~w f BuNefef %=@@w: Ћ Ћ   Ћ Ћ yw^ &  4  b '     ` TW ~  s`K6!  w V D85U5_ 5P_  m@e4 ,5Ne &   uN 4USt%J 5JV 5Fb 5& &  % 45@e-4  % U5EU  w( E w  D  +   r= wB w5 a U5ff  %ށ̥a &  e 3     U̥r 33w D5"E@e44fef % U4 4  fef %5 w w w7  ы A@PЋ w FD:5UE5Hw* _ 5uNfe & 2% _ bNe &   uN )U5| m- 5 & 2%St%V   U   & 2% S U _ @_ w DE%%"5   & 2% U wv w ^D55@    3 P 4 4 4 4 4 ww~w  $J 5+ F &5e-j(e %: & H    B ww  5f B 7  f B 7wX@ m7J %: e w       B e-ww D J 5 e 0 zl R#R0R00N%: w\  5 e-Bw V ww  N 8ww rDCDpC  ~ wZw FN PwJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  J`U7<^U72`0^(Ae vB7   % 55 a  a!PE -%^ w$  `e vWt vw@ `e @  %tpe U?^^ `e 7L^U?@ a72 *,?$ U ew dDE wZw FD5 P 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `\m&& E%m%w w7*'$!      7& A& BF7!bW-7Nw 8uDAB %u f& & e w5 5  W- W00~u5  .luB Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& n z   5 , @ :% & f E n  (˥-%0     ,:% &  n 8 5E& z   5 , @ :% & f E n  w@(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)mount.c 5.2 (Berkeley) 11/21/85rw/etc/mtab-a-rro-f-v/etc/fstab/rorwrq/etc/fstabrorwrqusage: mount [ -a ] [ -r ] [ -f ] [ -v ] [ special dir ] [ dir ] %s on %sro (read-only)rq (with quotas)ro%s on Mount table fullBogus super block%s: %s rqrw/etc/mtab/etc/fstabr: Unknown error: %dJR\v&8DZfr (@Mcr~,=\}5Td{'Hj2Hj| 5 RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB FjjdoxfegxcslLuDOX U0# {l R0R00N R < e7cce7.  / L  7%  w " %' T=@b=a@ 5+@ 5"@t@]f@& N% 22  @  : Tw @c!w n 5 %0%9w\ AWp Ameu@ 5@ww  &fef %5 w w D Lԋww De LN 4e^ex "  4ea Be v Nfe %w`w L-@ vwFNcV T%V w  BuNefef %=@@wywZw D5"E@e44fef % U4 4  fef %5 wn Ћ w FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%&   U   & % S U _P @_Tw DE%%"5   & % U wv w ^D55@   p 3 4 4 4 4 4 ww~w  $5+  &5e-e % &      ww  5f  7t f  7wX@ mJ7H>% e w  (      e-ww D 5 e % w  5 e-w  ww  N ww rDCDpC  8 wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w   U7 U7  Ae vB~7   v%p 55 a  a!PE -8%  w$  `e vWt vw@ `e @  %e U? `e 7 U? a7 ?U ew dDjE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m<& E%.m(%w w7X*'$!      7& A& BF7!xW-p7dw 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_| @  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& ( z   5 , @ :% & f E (  (˥-%0     ,:% &  ( 8 5E& z   5 , @ :% & f E (  w@(#)mknod.c 4.2 (Berkeley) 8/28/85arg count mknod: usage: mknod name b/c major minor : Unknown error: %d$.HXpz ,8DVeu5DPct.Of&6Mq<Qd<N`tRError 0Not ownerNo such file or directoryNo such processInterrupted system call0( {l R0R00NI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorj d o xX ff eX g2 c> sh lh L u D O X U0+ |l R0R00M ~  e7cce7& / `  7%  w  % h  @@&  7h @ h   @& : 76 @ h  5 5  )%0%9  h  e f& ff eee@ 5u aw w  ( h _ W- 2 ff e5u   % %5 @e7$ & ff ef&K ne%"@ 7@ 7% -T P W h % -  e| v d h e 7 7 7    ff %e eu w-   &   & % w w         e Efef %e%t A   R7` w^ V P % P2 AV R   7H B 7 w   % Pw w D5 7AWpFa@AWpFaAe EpAWpFaNfAWpFaf %AWpFaulAWpFau @ @-AWpFaqAWpFaAe ENfAWpFaf %w& w    t5 5  v h  !ff % tf&t  %2A@w w v   ff (ef&8 F ef$ @ %5%ff te w w   ff ef& F ef %5%ff e w w  ew %2r&ld5 @t  Btr2 %2ff %7 $ t p p w* w  2fe    @a 7rD @a p@am 7rD -Nfe  & %ztee@ 5ud ff Vev>eu  * AaA f&A@ 5u7 w  w-ff V% - 5u  Ne Pww D B e v@55 7  h <Neff %Ce eEt`3 3e4PPPPPPe4eBPPPPPPNeff %w ww D      + - ̥9 Wp @@`e̥0  ww fef R%5 Jw w |D Lԋwtw ` fe @wR @pHA@tw ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5b   6v&  @ppC`p   6@CwVwP7 w  $5+  &5e-e % &     wZw F 5f 7x f 7w@ mN7LB%e w  ,     e-ww D 5 e %w  5 e-w X h w\w H N wHw 4DCDpC h   ww N w  ~5 & E        ~5Yw.w  hU7fU7hfAe vB7   % 55 a  a!PE -z%f w$ h `e vWt vwH@ `e @  h% e U?   `e 7fU? a7 ?U ew dDE wZw FD5  5N h !w5A vBB-  }ee@ !ۃ `!ւ ` `m<& E%.m(%w w7*'$!     00 |l R0R00M 7& A& BF7!xW-7dw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   ww D:5UE5Hw _|5uNfe & % _|bNe & `  uN h )U5| m- 5 & %St%  f U   & % S U _: @_>w zDE%%"5   & % U w. w D55@   Z 3  4 4 4 4 4 ww6>w0w Net@f e  w6wdF.F..F lost+foundF.F..@(#)mkfs.c 2.8 1995/06/12usage: mkfs filsys proto/size [ m n ] %s: cannot create %s: cannot open %s: size has nondigit Can't make zero length filesystem isize = %D m/n = %d %d %D/%D: bad ratio out of free space read error: %ld write error: %D ilist too small NrrJd0o<xfegcs l LRuVD4O@XhU04 }lꨅ iR0,R0,0M Rn  e7cce7R / j'  7%  Ew H  w e@  ` t+ 7 ' E$v j 8/ t+ 7`: ' ECF  ZQ t+ 70\ ' Ee j  % 5 V N EwG@ȥ-' c l n@&  7*e_^@&  7wv % _bd ' E_bw XGHs @% EwJGw 6G  D ̥,i ̋5 @i 0%  @%wF @mf   N @e E 5w FN A  pF5Nf A  pF5}@0 @wNFw :FD ie ̋@w$Fw F @ _ xB2 @ @f& %f& e @ N 6 N 6 N 6 N 6 wE  x @%C&& %f&V \e f6 @%  @ ȕ 35& @,@ % @ EE& A  GD&& %f& x%   35 D&&& %5u &&fff e 5 5@p N X _v5D8&& .%5uff % $ff (% fff e&&fff e  @f&t 2eB fP @% !4 @ C_n&& T%f& >% `&& e-B f @%0   @ ȕ 35& @,@ % x@ Ed`E&P A  GN4 @%_nw &B J @ ff %5 NO @% ff eN f &R @ewAw Aqf t+ %N ' ENs @%fe e Nfe e Cw W- Nf @%D%% NA@  Eff @e# NA@ T EfA@ < Eff @ewT>w @> DeEE&E&E&fe r(e Nef @%w=w =C G Gw=w =C Gw=w = 5  u  w=  w r= pF  @  E 8?27*7(ttt t t%4w=w = t5 u w< -R  w < t5 u w< -  w <5 nre a t [ 4! t 22& %2-& &  e5N f @%@5  @   5 %  w;w ;Nx  @ew;w t;8 7 7 Bee@e  wF;e$  5%, D 7:7 4m0%@ D5 - C   5%,  `77 8e%@ e -@5  H C xT fb% e5% D %@ D_  5@e ֆ_ _ _ @ r D@ r 5@7u@ 5F@ 2b 5%  D A p @ 2 D@ _ x09 }l{ iR0,R0,0M\ & & &&& e _  & &&&& &&&&& &&&&&&&&&&7_ 07_  pF75=@0@0@0V0 _ 07 @_ w >8 K x D w68 L  @%L 7L 7.:,/L*  @% *5 N>  w ~7w7w r7  Le @<77 vpeL57b% % 5_%_%Շ @ E $*7 %  % 5= %_nB Bm-_Wpe!_Wpe%W @7% _t_x: _b= _f7 _f | _fn _:` &  %_:%_:@7 %   WpDe_%P e5@ `-Wpe!Wpe% @7% UV@h Bm-Wpe!Wpe% @7<% 12%_f @7% @7^@L 70Lew4@7%   %__%d ^Z  @ E $*7t%  &f% X7X7__ @ ȝ_5' @,@% d@ E_NJE&:E A _w 3  @eH-wv3 w Z3%> 84 @ E $*7N%  @% w30w 2 @ H5~5&r l@,@x% N@ E:6E&&fE A w2w t2w%  JF Bwd2w P2DC+ 5 C a  r5 w: w 2 U5ff A%̥a &  lAe 3     U̥r 33w f1DC AupB5 S  "̥ ;  & ӄ A %;  7  & \?%bb& ӄ A % ₎& \?%`@ @m A D&@w0  w 0D   3!,,  wj0w V0D  A Ae  b l 6w0w 0 H d T t+ 74. *Aw]4w/w /  C7 7 w/w / f T t+ 7 mz )%5#h f b  wk f b  ̥ ̥ n & b 5=  7|wzp7f D ̥̋ ̥ %q & b   |w.w .D CKw. ˋ 5 w .DC E5<E@e33. @;E  5 , @;% & fE A 5  VCU3 3  w-w -ff %5uE A@E W A@A@E?  A@E , wZ-w F-D @e55 5  ̥0 ̥x̥X. 'Ae f&ffff z$e A f&A@vee@ 5u 5 @i W-@Di Ae Biḁ.@e@-3i-@pHe _̋@pHeA Be v@5  @w+5 5  A@v5uWtAaAE 5PuP  5 u ߇A@w +D      + - ̥9 Wp @@`e̥0  w<+w $+DC AupB 4  & \?%b $*5% 傎& \?%`@ @m A F &@w*  w *Nef %w*w z*Neff %wr*w ^*D A555  ԋuNeffe %w(*w *DC 5 5 _F %%_h 5 %*e5  AWp `eui 0u%l5  %h%[ $ie  _ Neffff e   * O  A@ EN $*5% % % %Nf L) &    %_  A@ E%Nf L) @w(N $*5 w f(N%c%s%[Nf ff f& #ew0(5 5 5 5 %e%f %o%xDe5 5 A @ EN $*% % % %- Ԑ A @ EN $* _"%+_"  _"%a%f %A_"%F_" % A@vN $*O% A@v@mAm@ vA@v5ui0 %a%fW7 5`u`u C% S P Ԑ A @ E =i%%.%e%E- *% ' $ ! Ԑ A @ EN $*%+%-%0%9 A@  5u% N  L) =   @e! @e! _ @t@]   xt Ne %A _ Ne %A @H@pHw $%DC = 5%c%0u5 %s    $*%rt %c5 %[rt       $*%%   L) =  D- %cw<$ w $$D ̥^  t t t % %]%-+ t $%-̥]4  t ̠ t  t t %]  w#w l#D*\5% %-%+ 5 55 55  B5eA5 i%.55  B5eA5 i %E%e$%+%-  Wp B`ei  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& z'e5 55w!6 m 7"vw z!D Lԋwr!w ^!De LN A4e e @(  A4e  Be v Nfe )%w w -@  w N  r(%w BuNefef PJ%=@@wz W f r @  W f r@  @   6v   6v   6vb"w D% 5     |@w4- yw&  4  b '     ` TW ~  s`K6!  w D85U5_^+5P_^+ B m8@e4 ,5Ne & ,F  uN pF4USt%5 VC5 VC5& & $A% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff A%ށ̥a &  lAe 3     U̥r 33w   uff e55 DBfe& \?%e   & \?%e& \?%e@A@ 7r5%  & \?%mm  ww D@et5r%=r D l 1 7; L 0  w|e =r r̋i=rNet A Net Ae  @et5Net A5&f 4% F( L27 ,w DC .  1 7% L N 2!f ?%    wpu5&f %  L27 x w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @i W-@Di Ae Biḁ.@e@- @Di@pHe _/̋@pHeA Be vC ̂ x`uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ pF w5 4@E%@EU5N&e A &e |A Nf&e A%4 IN&e A &e |A Nf&e A%  (Ne& ,F  ff eee@ 4t@t"4 4t D G_:1w N D@ DN Gww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  >9 ve@ 4tw"w D55ff %f&& "eff&e e &e ; 55 ww&w5 5 w D5#d5ff T %f&& eff&e *ew6&e ='44  && ef&& lAe&e & H%%U w D5_^5o5ff %f&& eff&e Ze L&e =8f f ff&e V e 744  && ef&& lAe&e & H%%UUw @@m e%fe E  &e ; 55 3ff `%f&e@ &50c &e ; 55 3 @ U44  && ef&& lAe&e & H%%&_J5fffffe e _J5&e % _5_J5e_5  mm@ e@ f& ef&& lAefe& H%%_J5 H:_4w @0 0 @0 N B777*ww D85_N8Ne& ,Fq fe Ve4-4-/44  &&  ef&& lAe&e & $A%%&e E &e ; 55 eww .w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  >9 ve@ 4t4-4-/44  && ef&& lAe&e & $A%%&e E ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& lAe&e$& $A%%&e$ E `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& lAe&e$& $A%%&e$ E `Btp$t t"  ff Nef&& lAe&e$& H%%Uw w r D5#5 5 wlwh2wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& ?% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5lj@Et5l5lu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm \?% a@ `` e w D a@@m e  w e  aAm HN@`@m &f \?%  aN f`f \?%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef PJ% VCU4 4  fef PJ%5 w    6v&  @ppC`p   6@Cwzwtw D VC & & lAe 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _wlYwfw Net@f jFe  w6w.w  PU7NU7PNAe vB7   % 55 a  a!PE -Z%N w$ pH `e vWt vw(@ `e @  pH%e U? `e 7NU?ה a7 ׸?U ew dDE wZw FD5 G 5N pF!w5A vBB-  }ee@ !ۃ `!ւ ` `m$& E%ηm·%w w7n*'$!      7& A~& BF7!`W-R7L& & "e Ӌ  &7& \e ӕ-ӕ0B~ӕ.  ӕ0~ B~&7 & e ӕ-0 ӕ. B~ӕe~ ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & ze w5 5  W- W00~u5  .luBw* J@B V_L@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff e w5  @ 0   Wp `e0w b\ *Aw]ww | F@ C7 8  L27 7 w`w L   t+ 7 lZ )%5#f M  f M N .f&҈ ̥ ̥ 7 7& M  ̥̋ ̥ %0 & M    w`w LwwRw >D CKw4 ˋ 5 w DCB P  5 , :% & E& A z   5 , @ :% & f E A  (˥-%0     ,:% &  A 8 5E& z   5 , @ :% & f E A  ww Nefef 5& Pe C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @w^w Jfff 5& Qew8w $ fff 5& Qeww  5 %O N  = 2 555Ne5& Re5 55'0Ne5 B& Re57^ Be0" 5% 55 5 B5@B e2 a=%2 7&2 w % 5 B5Ne& Re55e0% 7+`Jʕ0%2 ʕ1  %2 ˕0 ʥ9 6@~ ((stdin)rhostswhostslocalhostsgatewayswgatewayslocalgatewaysnetworkswnetworkslocalnetworksusage: %s [ -c connected-nets ] [-l local-nets ] [ input-file ] %s: Too many networks in list %s: %s: unknown network htable: net missing names. %-16.16s %s %s%s %s # gateway %s %sUnknown keyword: %d. net %s gateway %s metric %d passive rWarning, no %s file. rWarning, no %s file. %s %s gateway %s metric %d %snet%d%d.%d%d.%d.%d%d.%d.%d.%d%-16.16shtable: out of memory %s %s # gateway @(#)parse.y 5.2 (Berkeley) 6/21/85#&  *'(! ) $  %+"&    &%$#!   ::,.:,.:.:::,   J&>V pxppppp"%s", line %d: %s yacc stack overflowsyntax error@(#)scan.l 5.4 (Berkeley) 4/19/86x $$6HNTZxxx`f                                !                                                                                                                      "(.~4:@FLPTX\`dhlptx~  ---0000000000AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Warning: nonstandard name "%s" Illegal char: '%s' bad switch yylook %d/etc/networksrr# ###################: Unknown error: %d` h r  * < N Z p |  />Vcy%BSr4Kjz %=^%4H^6KRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorT0z000 ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 6 HKd.Ko:KxKfLeJgKcKsKlKLPKuTKD2KO>KXfKU/etc/hostsr# =(\0Q ~l tR0mR0m0L @ $ < e7cce7  / Z  7%  w %@ (   w3wHw D Lԋww De LN 4e0e< 0  4e3 Be v Nfe %w4w -@ HwN5( b%( w BuNefef %=@@wyw.Ћ w N ww w7H*'$!      7& A& BF7!rW- 7^w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_^@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& R z   5 , @ :% & f E R  (˥-%0     ,:% &  R 8 5E& z   5 , @ :% & f E R  ww D:5UE5Hw _5uNfe &  % _bNe &   uN )U5| m- 5 &  %St%:  U   &  % S U _z @_~w zDE%%"5   &  % U w. w D55@    3 4 4 4 4 4 ww6w $.5+ d &5e-|Fe % & Z     wPw < 5f  7 f  7w@ m7.% e w       e-ww D .5 e % wn  5 e-Tw N: wRw >DCDpC  N w&w N w ~5 & E        ~5>w8Yw2w Net@f e  w6ww t pV U7bT U7XV VT NAe vB:7 <  2%, 55 a  a!PE -%T  w  `e vWt vw@ `e @  %e U? `e 7rT U?f a7X PR?JFU ew 0D&E w&w D5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m:& E%,m&%ww@(#)accton.c 4.1 (Berkeley) 10/1/80accton: Unknown error: %d*BLfx (7GVg{"5F\v!8RtCd}#6Xkx 2F\vRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceTe0V ~l tR0mR0m0Lxt file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatordpo|x:fHe:gc sJlJLuDtOXU< ` ` 0Y l$ X0f0f0Kconsolesms10f0[ l i 000K# # name getty type status comments # console "/etc/getty std.9600" vt100 on secure #special ttyS0 "/etc/getty std.9600" vt100 off secure ttyS1 "/etc/getty std.9600" vt100 off secure ttyS2 "/etc/getty std.9600" vt100 off secure ttyS3 "/etc/getty std.9600" vt100 off secure ttyS4 "/etc/getty std.9600" vt100 off secure ttyS5 "/etc/getty std.9600" vt100 off secure #printer ttyS6 "/etc/getty std.9600" vt100 off secure ttyS7 "/etc/getty std.9600" vt100 off secure ttyl1 "/etc/getty std.9600" vt100 off secure # 2nd DL11 ttyp0 none network secure ttyp1 none network secure ttyp2 none network secure ttyp3 none network secure ttyp4 none network secure ttyp5 none network ttyp6 none network ttyp7 none network ttyp8 none network ttyp9 none network ttypa none network ttypb none network ttypc none network ttypd none network ttype none network ttypf none network 0] lR0!R0!0K @R7 e7cce7? / h[  7%  Ҏw   _%Ne7& VI% N \% ҎNeR7& W% N \% Ҏx6 W  W7x67 6w<e @ A@l7__2@ȥ-_2 5 @ T5 d l t u7 v@6 V% MF6@6 N 0V77 ~:7x7 N 0V7f7 `,7Z)5 09@tA@`e5 6 V w e _ 6' fH%4 o  o x o) \ fe& @Ye 4 \ o@3& h%%C \ 7 4444474@7 W "7V e7 X (w $ 4p \  Jww N   5  H  JNf @w̎w N :Qw < < < < < ; ? P~ X7; X7; X7; X7; X7;?w & 3 3   _ 7 t3f Ԋf Ԋ 7B3 @37KN %_N 73_5 xDN& Ԋ D NN % 2 N08- \e7 2TNfe u% 1 fe r  Nfe ԊN[ % H2N08rYK v 5N NK %6 66 RYww x zX 1 ? Z@%7 17 17 1wZw F 1 N6   _f7 66 1B 1z15Nf F 5 ^1 X1f Ԋ  7 015 5%]08 \% ҎP7 51 dX00 L jk? Zr%080? Z@%0 0(0 D  HH /&  0|0 e zw`0 HH  HH D  60 zX i &0#x  N08p8 Zrep8 ! //N08"/ %/08p8 Zrep8 ! / /08 \e/7$4 tw : f v 55 5 'Nffe Zr%@e5fe A 5C  3_ N& H _ Ne@ & l@E% N& %h :3 63=%.)(3  2 A@ EN u%N& H :%   22@ & e -fff | e5ffff eN - N wVw B: Nef t N b5_ ,2 (2/Nf v 5 N) H _ 1 1J%<-61 ! A@ EN u%N& H Z%   & f Ne  l1f1@ & e Ӂ3f | e5&Nf   N5 %^  N ,N wΆw  +N+ W [  \i%5O zXfef @Ye 1\+L+Z+H+V+%0V0 % N RY b7f P% ~+ zXNfh+ zXN Z ww ܅85 wR+wN+7 L+7 J+%%ffqfe ee~fe N\Nefe6 W%5   Z wJ ZwNef%* eN Nef} eN * W  * r77P~pN 5#-.. *!) I &z)t) >I%& e@ 7) - RYmr7f) `% %0*./ H N 8)_ Nef%X)u{K e@_ w  0)7 X 7 )_) _ x6N u%_(e(w (% G@5 _  A@ ȕ 3@5&@ A@,@ % A@ EN@E&N  ?A@ '@ A@,5@8% A@ E N@E&  0b lR0!R0!0K _A@ E_@5N&EN 7 '@5 a@5 E \N 7 t'M@ 5@ 5f ֑%  7`:'w`8'w 2'N f d%7 ' 7 '7 &&& % 7 &' H wTw @5 &7 X _7 &_ x>fe@ & d%5fe@ & ֑%@-_A 7`L&w`J&w D& _7 .&_)  N u%_Re&w &% d a@5 _  A@ EN u% D  A@ ȕ 3@5&@ A@,@ % A@ EN@E&N  8%5%  ?A@ '@ A@,5@8% A@ E N@E&  _A@ E_@5N&EN @5 /@5 47 h$ N& %X 8X w~6$ _D$$& %_87 $ H _<7 $w p~Nfe Zr%fe A 5N %_6% R5 ! H N C J@5  N' H N C_| v! p! h! d!5b!T! -T! ?F!% 5& 4!5  ! ! ! !!5 ! - @? % 5& 5fE  A@ EN u5%_.N C  w|w |"7 e"& 8X 080 8X p"3 !! `A%E 8X K 8X ! !N!k 8X  b& 8X!  8X %!%! !   8X %x! 8X j! ^! & 8X%%!Y% 8X7  rH. 8Xr7@e5@e5EE @E&@EE&@EE&@EE& @E&8 8Xe O 8Xi  w {w zNw %   Jwzw zN 8X Nfff f ff 8Xe  8X5 N \%Nfff f ff \ewRzw >zN 8X Nfff f ff 8Xe  8X5 lN \%Nfff f ff \ewyw yN %wyw yN %wyw y  |< r 5=|<  %w`yw Ly4Nef t@E%@ N t ' w yN W N& H w xN HH N& H , wxw xf NN& H0   wxw xN W N& H H wxxw dxNe J NeL &NeP  %w:xw &x4Nef t N& H w xk ^  @w wNf |W & H  www wfe y%5@f@@f& J<%&08 q%08 p8 Zr%p8 !  rp5uNe `08  \ew"ww w z  zX  ? Z@%N ܑwvw v \h75f P"%     JN d( f Ԋ7      7 X * f Ԋ%%%1  Ze V  @ewvw v   \i%7 t  H wu7R7P~7  zX7~ P%  zXd ZZ  zXNe74 W% " Wف77EE&E&E&E&E&  ew t8/f r 55 _=Ne f t N ) H wt /N? ? e?5. N f Zr%Ne? t? %d  w t-p $  *f  f f ewsw s<5 5 5 $ f f[7 N j6  &  _! N& HwZF7 X _8!7 _!N& H _!N 7 _!@E%M ? 5 | e5_! n%`G I A f Ve   7`@w`>w 8_8!Ne t˥-  * Z_@E%@_8! .s5_!_8!@.%_!@. .%_!NeJ fe Zre Nefe tV@E%O Z P | e5_! 2./%b d fe\ %k m fee f VeNe   7`w`w N ns5_ N s_ n &@5 ~ & H   7 b N wpw pN ffffe Zrenԕ-Ne \e Ne@`0Ce   Tԕ -wFpw 2pD f Ԋw(pe  w pDB Ҝ7 7 ^ N \%7^@wo 7N 7     u%YE%L    u%=E Ղ x    u  8Xe5     u Ґ % %B-  @_"N \%_"w nl %Ne rp Ne `>  \e JwZnw Fn _X( x # o  ND5|< P"%     J ND+|< [% |<p80 !% |< r ԕ 7|< f[ |<7  5|<0|<|< d(|< &" p|< M    7 X N_& |<_P&e|<:& f[ |<7~z5|<0|< d( &" Xp|<  7 F7 @ 7 6 7 X _$  ||<3.( |<_% %|<3 e|< |<35|<0|< 0V7^p|<|<  r y           _%    _% _T&     _%   _% _%    _%   _%= b_%w iD 3e ̋wiw i N   5W bNf @wiw i % jp  D  5  e eE _d*fq eL r5Am 5r55 $ 8X5 AupAmWp AmD " ! u- 8X u-5 7 %_**& 8X%Wp AmfAWp a%҃  5   5  -  ? % 5& ߰ 5  N d(Nf &" N &f e&f e wgw g:  _, xNef t@E% N& %wHgff4 Xe8f v 5N& H Ne@ & l@E%N:& %N 5 5 % eu eu A@ EN u%N ffP vT_+w :fl 7 7 Be>e@e | w fe 5%, @ 767 0m,%M@ 5 - C   ,5%,  77  e%@ e -@5  H| C x  b^% e5%M  %@ _B, 5@e ֆ_X, _X,_n,@  D@  5@7~u@ 5h@ Hb 5%M   A p @ H @ H_B, x7 7 7 _B, 2 _B, 7  Zx  _B, _B, _B, x%  _B,  _B,% .R9 ]v  & Z _._B,   &  % _._B,   &  % _._B, _B, _B,    _._B, _B, Z_.   Z _._B,    _._B, _B,    _._B,  t  7 _.  _._. _B, h_B,   h _._B,  (_.5f [% e5  N  _.    _._B,    _._B, _B, _B, _B,  _B, t5 tN  %_B, _B,%%0 _. t5&@  e_B, " %] & D& H   _._B,:4 %-$ 7  ND!  *!&  % _._B,,!   * _._B, M JNe& tK!& HN!& %.@E%Ne e5N@&@&@&@ &@& d! e _._B,!   J_B,7 r_B,7 7  _B, _B, 27 _B, _._B,7  V7w!!^ e_B, 7 _B,v7=@0@0@0t7=@0N_B,T _B,J _B,@ _B,  _B, 7 _B,x p h _B,^ \ _B,N 7N _B, ,  !& r%  j67  &  7 _.7_B,55 A r u%wd_B,Aupu`@t5A r 5 ~_(5!  7 _B,w [D 5J5 L7 p >feJ >>^    5JfJ NeJ ?w[7 @e7 7 ?  e7 NeN *77  L7 5  r?7  ?7 w .[= w w 7  w [w [D!& Ԋ!& Ԋ !& = : 7wZw ZDV Z Z ?V 7 V  8 >  wZw Z * m" 5.  & ԊeC-e@e!ww\Zw HZ4D̥~_9-_9~ >  > $ ? ̥-̥̋/M -?| @ !h  >R H @7B$̋ <", = >Ne t5"  = + >& ?̥/ D-̥/ ?ʥ{ & 9  Z9?wYw X6 .s5 Nef l @E%@ N s"wXN ns N&e @;e = N sw fX 5 @e5} { D  [ {  }  ̋5 C#    ̥̋]E , [U { }  !  wW     f  fe K  Ne 8w?  Nef ; ˋ˥]ˋ w W .. w WwNf ; ~@7tw VDC>Zf ?a [ { [ wV  9 5  G  B   5%] %-@5 ˋ˥/  ̋% > & ;ԋ  E5  * / / >NeR t@E%@ˋ 1"0 = $ 8w?_;w rUDC@E  wbU #     E5 5 *! ?2 [5 5%] %-@5 ˋ & < ̋  w TDC && 8M e -%T2"  m & ?  m1wTTw @T-E"R ?w.Tw TD "%>˥~UW" ԊY" Ԋ@ wSw SR@& ? {7P2@wSw SazAZ_ wrSw XS09 wRSw 8SDCˋ!w.S w SD  wSw RDC@wRw RD wRw RDC && ^K e  \" b  wRw RD B?  j" b Z? wdRw PRD ̋wNRw :RN :Q  @m-w$Rf w Q` @   " ^%7*CNe l:ffe q%ffe q%ffe q%Ne rp,fe ֑%%, ff PewdQw PQrw@ _C  8N7  7  " Ne P ݁N @m5J5 D "& \ A Aa1"u"R55!@ @a" j65@ @a5"N5 PNeN ?5uL; @ @a "@ @a0 R5 L25 _4C x"}-L}-JLNL   NL& =LeL L@ @ap" %@ @apReN ZN Z`r%f P f P N ZN  f P N ZN ZNeRfR NH  ܑr Nf W 5N Nf W 5N Z@ mH@ @a" r?@ @a" @ @a "@wNw N 4 @  m" wNN & "0%5uNe t5 m@"%ff /% m %@w N De t4 tt 4 4 Ne&& t% wM  eu @w M=wMw M  #@m4A#@m4"A %   5 AA %w 5 #A"A %w #  Wp0`@#pA>AWp0`@#pAVA % % 4$>D %0wLw L #@m3nD %@5 u `3D %  AWp0`A>A@>DmrA@x3D %0 WpDtDWt@`DWt@`DWt@`D @`D@`DWt@`4$utE4DtE4D E4DE4D % nD4&AD@x` %  DnD %  %_E ĜnD`3nD` %  @`L#HmD %@wrKw ^K  4E %B   tE4E % B%@E D 4E %B B `E%Z%9.  t5Wp`A>DuWp`e>DfWp`^VDWp`qVD % %  E E %   Wp`AEBP %e.%9e%ZebE % 4bE)"!`Ew$J wIb ;ewzIw IDC+ 5  a  r5 w: wI U5ff ^%̥a &  e 3     U̥r 33wHwHw H  Z7e@wHw H  7  7 7 wHw H 7wHw H4  7  7 {&o& v 2Ne & l %N 7JA r& 7,&,   7 V&+˥/ˋ ˥#˥#ˋ˥#ˋ 3 u%   wGw Gx@e5@e57 =Ne~& t &f wZGuu&f eNefe tp&Nef l u-$u- N s_rL&_vLN ns5N s&}-(N ns5N s&Nef Nefe N u-u-N sNfe L & L 5u-u-uu&f eNe .s5_LK&_KNf @_Kw EDC  ̋`%# wEw E"5  @ @ap t- 5N m& Ԋ)%N&6 V% rNef X' hwE@ @a0  m  w D 6'(' v 7 jwDw D  7 |wDw DDC  ̋̋wDw vD J 8'(' v 76 E,vE u%7Z:& M 7J:& M  0V74F0:& M  & M F %H,& M ̋ xFwC(wFCw@Cw CDE5_@P% _O _O5`uu '& & e5u%%w@C @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & e5u %%    u%%%_$O5 5 5 E4N ff & e W _$O%_O%_O_$OZw&A*J wAhwAw A .  * L  wtA  5 ff L% 50   8 Hw A  uN 5&f %5Hw@ 5  f Ԋ  0   w @ p  @e5ff l%5Hwn@ 5  w-   4 w @  j  &  `z%7w?J' ԊV'5i'f v 7h w ? Rw?w ? t  w?wVw |? ,& {7    7 wb?w N?w(wT?w @?  @ E w,? u5% %0H u%  0H rk'0H [ 7n'& [ 7vq'& [  0V7^t'& [  0V7Fw'& [ 7<z'& [  V7w}'& [  V7 w '& [ 7'& [ 7'& [ 7_ _%0Nfej ֑%@-`R ffej Vie O5K |5h%D 4 &) ^%53)fej e>fej r  NAej@f ֑%N Z ܑ & fh t%%%w2w 2D w>w6 57,%<6)~I q%5,  \i%7% ( ^ 7j7%' h%%>|I `%%z Zpw1w 1\ ZR7w1w 1DH 7@w1bw41w 1N d `w1w 1D el&&&&WpeV)f Wpe@)f)I ZreIwZ1w F15 5  AaAE f&A@vUU5u %w1w 0D )w0̥/ 55) &f ^) e %Nfe )fe fe ԥ.̋De & h & ^ %fe0 d% Z %,@e05e awNNe$ aw@Ne( aw2%r(_pa _pa% _pa%2_paWpfWpeme, _pa@e\5 N af&tIIe - @ E3tO - *teP5.N af&@.e@.A Ep@.A Ep -2 s6Q -36Q tO_pa - t-P_pa -6Q77teP5  e6Q7Ń - _ta@e6Q7bw >. Nefe pw..7 dAWp@7 7  f q 6Q 6Q77 w -7 7 Z7 X7 X)6Q 6Q77w-w -) q̋  Za  Za  2  wx-w d- j @55 w-w-  t P -f  t5,I 5,I -< sOueP&&fe Xe3 e6Qpz)e6Q3w,w ,& f e))w,w r, lQQ@f& #e5uQ@f& #e5uumumu _lfeeQu  %QQ eu % ff "#et ff \#e5u< ff "et< ff $#eL A@e@ f& #et e  =  r  rd > r 8 8 rd ( A) 5 8u 4  A) f&A@ 5u r  r   A) @mAm@ 5u e4 tWpe~)u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 *ttw)!wF)\w@)w )De LN 4e*e $i  4e* Be v Nfe u%wH)w 4)-@ *w.)N *Q Zr%Qew(aw|(w (w.@7$% ?@w(N f iw (DC_o̥%_o 5 r y1 _o 9% 5afe &1 %5@e5 51N o _o 51N o _o w(2 i_o2 i_o2 i_o  *o% _o0 *o% _o0 r  r f *o% _o0 *o% _o  *o% _o  r  r f *o% _Tj_o0 *o% _Tj_o2 o _Tj_o2 i_Tj_o0 *o% _Tj_o2 i_Tj_o2 o _Tj_o0e r& *o% _Tj_o0e  @ r& *o% _Tj_o0 *o% _o_Tj2 i_o_Tj _Tj o _o_Tj _i _i _o _Tj% _Tjb_8jfe &1 %5@e5_Dj _o _Zj _j _o _~j _k _o _k _0k _o0 el rdf *o% _o_Tj _k _o0 *o% _o_Tj _k _i _o2 o _o_Tj _j _k h_l _j _lj Y% _k2_k _&l G0 *o% H_Tj _k _j -2 i2_Tj ! 0 el *o% _Tj _jk _l _k _Tj? ̋_ir_Vjw .#QA r e0@ A r 5   %Q @  L %Q  ow"w "D w" ?w "u@t5Q5Q@ 5&RNefef .t% (3A@u5BtrQ2Q@ Aup&R fef .t% u-u-u-@w!w ! fe p@w! @pHA@tw&!w !63 q!,& r   w! 1&fR q%7˕,fRNf q w >!D 2 !     +  w !e% - r<N r<&@&3fR ZrefR ~ ~w Nef q w w p D 5  =& r% `5ȥ= | = @w" e  w  BuNefef %=@@wЋ Ћ   Ћ Ћ  Jҋ~ @@w ND Z4 4  w>w * f ^ %  ZP 4 4 ww D 4-&4-!4 4   &e & d%4    wme   s lt  &w< wSwmownBtlw e& 7 7~gwrr"BdI I7Iw  BuNeff %=@@ww  & f ueww l fff uewbwyw&  4  b '     ` TW ~  s`K6!  w D85U5_v5P_v  m@e4 ,5Ne & l  uN 4USt%555 56 5& & d% 45@e-4  % U5EU  wE w pD h +   r= wB wR5 a U5ff ^%ށ̥a &  e 3     U̥r 33w   uff Xe55 DRfe& %eS  SPR& %eR& %eS(@A@ 7r5%  S& %mm  Rww D@et5r%=r D 6 `z 7; Ԕ   wHe =r r̋3=rNet Ԋ Net Ԋe  @et5Net 5&f 4%  {7 Űw DC ع. T `z 7ƹ% Ԕ . 2!f @%    ŀw<u5&f % fX {7 P w 4$  w5 4@E%@EU5N&e 5&e Nf&e ^%4 IN&e 5&e Nf&e ^%  (Ne& l  ff eee@ 4t@t"4 4t Z _zzw N Z@ ZN ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  ~ ve@ 4tw"w D55ff %f&& "eff&e e &e 55 w&w"Sw5 5 w D5#5ff T %f&& eff&e *ew6&e ʆ'44  && ef&& e&e & ֑%%U w D5_~o5ff %f&& eff&e Ze L&e ʆ8f f ff&e V e 744  && ef&& e&e & ֑%%UUؽw @@m e%fe "  &e 55 3ff `%f&e@ &50c &e 55 356 V U44  && ef&& e&e & ֑%%&_~fffffe e _~&e % _~_~e_~  mm@ e@ f& ef&& efe& ֑%%_~ _}w @0 0 @0 N 7p7lSww D85_Ne& lq fe Ve4-4-/44  &&  ef&& e&e & d%%&e " &e 55 ewwSw4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  ~ ve@ 4t4-4-/44  && ef&& e&e & d%%&e " ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& e&e$& d%%&e$ " `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& e&e$& d%%&e$ " `Btp$t t"  ff Nef&& e&e$& ֑%%Uw w r D5#5 5 wwSwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& @% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l4@Et5l45l4u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm % a@ `` e w D a@@m e  w e  aAm HN@`@m &f %  aN f`f %  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef % U4 4  fef %5 w    6v&  @ppC`p   6@Cwzwtw D  & & e 4E05Ew7± Ћ P ы A@PЋ w FD:5UE5Hw* _|5uNfe & ֑% _|bNe & l  uN )U5| m- 5 & ֑%St%5 ܩ x U   & ֑% S U _: @_>w DE%%"5   & ֑% U wv w ^D55@   Z 3 4 4 4 4 4 ww~w  $55+ &5e-pخe %6 & N    ww  5f 7 f 7ԨwX@ m75%6e w       e-ww D 55 e %6wb  5 e-Hw  rww  N ܑww rDCDpC  " wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  P TU7BTU78 T6T.Ae vB7   % 55 a  a!PE -%T w$  `e vWt vw@ `e @  %zve U?dd `e 7RTU?FÔ a78 02?*&U ew dDE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `bm(& E%m%w w7*'$!      7& A& BF7!dW-7Pw 8uDAB %u f& & e w5 5  W- W00~u5  .lu6Bw* J@B |_f@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w LF jw]ƪw|w h 0* 7 "  {7 7 wLw 8 ;7 v 7 lT u%5#=7f .  @7f . *70N ^f&   ̥ ̥ 7T7C7& .  ̥̋ ̥ %TF7& .   TwLw 8ww>w *D CKw ˋ 5 w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff .e A f&A@vee@ 5u 5 @3 W-@D3 Ae B3ḁ.@e@- @D3@pHe _t̋@pHeA Be vC ̂ xJ7uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   wTJLRY_egpw ZZZJJ# 0ASCIIEBCDICImageLocal0NonprintTelnetCarriage-control0FileRecordPage0StreamBlockCompressedftpdgetpeername (%s): %mgetsockname (%s): %mftpd: Bad value for -u ftpd: Unknown flag -%c ignored. /dev/nullwsignal: %msetsockopt: %mfcntl F_SETOWN: %m%s FTP server (%s) ready.lost connectionLocal resource failure: mallocCan't change user from guest login.ftpanonymousftpGuest login ok, send ident as password.User %s unknown./bin/shUser %s access denied.FTP LOGIN REFUSED FROM %s, %s/etc/ftpusersrUser %s access denied.FTP LOGIN REFUSED FROM %s, %sPassword required for %s.Login with USER first.xxLogin incorrect.repeated login failures from %sftp%d/Can't set guest privileges./User %s: can't change directory to %s.No directory! Logging in with home=/Can't set uid.Guest login ok, access restrictions apply.%s: anonymous/%.*s: anonymous/ANONYMOUS FTP LOGIN FROM %s, %sUser %s logged in.%s: %sFTP LOGIN FROM %s, %srr%s: not a plain file.wr+wrTransfer complete (unique file name:%s).Transfer complete. (%ld bytes)Can't open data connection.Opening %s mode data connection for %s%s.ASCIIBINARYUsing existing data connection for %s%s.Can't create data socket (%s,%d): %s.unknown errorCan't build data connectionOpening %s mode data connection for %s%s.ASCIIBINARYTransfer complete.Local resource failure: mallocTransfer complete.Unimplemented TYPE %d in send_dataData connectionError on input fileTYPE E not implemented.WARNING! %d bare linefeeds received in ASCII mode File may not have transferred correctly. Unimplemented TYPE %d in receive_dataData ConnectionError writing file/bin/ls -lgA %srstatus of %s:control connectionEnd of Status%s FTP server status: %s Connected to %s (%s) Logged in anonymously Logged in as %s Waiting for password Waiting for user name TYPE: %s, FORM: %s %d; STRUcture: %s; transfer MODE: %s Data connection open in Passive mode PORT (%d,%d,%d,%d,%d,%d) No data connection End of statusError in server: %s Closing connection due to server error.%d <--- %d %d- <--- %d- %s command successful.%s command not implemented.'%s': command not understood.DELECWDMKD command successful.RMD%s."%s" is current directory.File exists, ready for destination namerenameRNTO%s: connectedconnection from %s at %sYou could at least say goodbye.ABOR Transfer aborted. Data connection closed.Abort successfulSTAT Status: %lu of %lu bytes transferredStatus: %lu bytes transferredCan't open passive connectionEntering Passive Mode (%d,%d,%d,%d,%d,%d)Can't open passive connection..%dUnique file name cannot be created.%s: %s.%s: unknown error %d.~{[*?/bin/ls %sfile listw%s%s %s/%sfile listw%s%s %s%s No files found.Data connectionTransfer complete.@(#)ftpcmd.y 5.20 (Berkeley) 2/28/89lq89>UZsx !"6#;_$d%&'()*+',+C,H`-ex.}/9012  33"145D4IX5\w5|667:;<,=1L>Rk1p##@#@#j#'''((B(.$&&%%&%:%D&>+,**"oprq[gM! wjKI $# {ihba`_98|zyexnmEDA:63(~}vutslkdc^]\YZG?5,+*)X'T&%VUO-PQRfWSNLJH./01247;<=>@BCFih~g@f}edc|yxw>=                JJJJJJJJJJJJJJJJ2*-.139;=>ABCDEFGH !JJ@4 "'0:678<? $)+,/#I(% &5X-d-d--.//8/l.B,|.....F/b/v/////0080R0z000001"1D1R111111122D2222,3X3j33:4R4Z44B,4B,B,4(525<5F5V5d5l5t5~555(525<5(525<55B,5J6USER usernamePASS passwordACCT(specify account)SMNT(structure mount)REIN(reinitialize server state)QUIT(terminate service)PORT b0, b1, b2, b3, b4PASV(set server in passive mode)TYPE [ A | E | I | L ]STRU(specify file structure)MODE(specify transfer mode)RETR file-nameSTOR file-nameAPPE file-nameMLFL(mail file)MAIL(mail to user)MSND(mail send to terminal)MSOM(mail send to terminal or mailbox)MSAM(mail send to terminal and mailbox)MRSQ(mail recipient scheme question)MRCP(mail recipient)ALLOallocate storage (vacuously)REST(restart command)RNFR file-nameRNTO file-nameABOR(abort operation)DELE file-nameCWD[ directory-name ]XCWD[ directory-name ]LIST[ path-name ]NLST[ path-name ]SITEsite-cmd [ arguments ]SYST(get type of operating system)STAT[ path-name ]HELP[ ]NOOPMKD path-nameXMKD path-nameRMD path-nameXRMD path-namePWD(return current directory)XPWD(return current directory)CDUP(change to parent directory)XCUP(change to parent directory)STOU file-nameSIZE path-nameMDTM path-nameUMASK[ umask ]IDLE[ maximum-idle-time ]CHMOD mode file-nameHELP[ ]command: %s%c%c%c%c%c%ccommand: %sTimeout (%d seconds): closing control connection.User %s timed out after %d seconds at %sunknownYou could at least say goodbye.PASS%s: %s Unknown state in scanner.Ran out of memory.SITE The following %scommands are recognized %s.(* =>'s unimplemented) %s%c Direct comments to ftp-bugs@%s.Unknown command %s.Syntax: %s%s %s%s%-*s %s; unimplemented.%s: not a plain file.%lur%s: not a plain file.%ldSIZE not implemented for Type %c.?AEILyacc stack overflowsyntax errorPORT command successful.Type set to A.Form must be N.Type E not implemented.Type set to I.Type set to L (byte size 8).Byte size must be 8.STRU F ok.Unimplemented STRU type.MODE S ok.Unimplemented MODE type.ALLO command ignored.ALLO command ignored.wa./bin/ls -lgA/bin/ls -lgA %sBad sequence of commands.ABOR command successful.SITENOOP command successful...Current UMASK is %03oBad UMASK valueUMASK set to %03o (was %03o)CHMOD: Mode value must be between 0 and 0777CHMOD command successful.Current IDLE time limit is %d seconds; max %dMaximum IDLE time must be between 30 and %d secondsMaximum IDLE time set to %d secondswUNIX Type: L%d Version: BSD-%d%s%s: not a plain file.19%02d%02d%02d%02d%02d%02dGoodbye.Restarting at %ld. %sSend STORE or RETRIEVE to initiate transfer.~Please login with USER and PASS.!`{[*?{{}Unknown user name after ~Bad directory componentsArguments too longPathname too long{{}Out of memoryOut of memory@(#)logwtmp.c based on 5.5 (Berkeley) 4/2/89/usr/adm/wtmp@(#)popen.c 5.7 (Berkeley) 2/14/89BB Version 5.79 Sat Sep 9 03:03:24 PDT 1995:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     D^&f&/bin/sh/bin/csh/etc/shellsr/getwd: can't stat /./getwd: can't stat .../getwd: can't open ..getwd: read error in ..getwd: read error in ..//initgroups: %s is in too many groups setgroups/etc/grouprr>'/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd%d.%d.%d.%dlongjmp botch longjmp botch   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec))mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d*****+ +:+L+^+n+z+++++++++ ,,*,;,O,c,,,,,,,,, --0-J-h------ .&.H.f....../8/Q/k////// 0,0?0L0`0t00000001101J1]1v111RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator2222 2)20292A2J2P2V2Z2_2d2k2u2}22l"m,mJmhmmmn4nbnnnnSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y=3A3I3M3U3Y3,]3a3he3i3m3q3u3y3}333333 3TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired STTdxoxBfPeBgc(sRlRLuD|OXUT07/etc/hostsr# ƗF0 lpE *ބ*ބ0I# List of acceptable shells for chsh/passwd -s # Ftpd will not allow users to connect who do not have one of these shells # /bin/sh /bin/csh /bin/tcsh 0 lG F0^0^0I# @(#)services 1.16 (Berkeley) 86/04/20 # # Network services, Internet style # echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp 21/tcp telnet 23/tcp smtp 25/tcp mail time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated tftp 69/udp rje 77/tcp netrjs finger 79/tcp link 87/tcp ttylink supdup 95/tcp hostnames 101/tcp hostname # usually from sri-nic #csnet-cs 105/? pop 109/tcp postoffice sunrpc 111/tcp sunrpc 111/udp auth 113/tcp authentication sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/udp ntpd ntp # network time protocol (exp) # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp cmd # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp efs 520/tcp # for LucasFilm route 520/udp router routed timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem ingreslock 1524/tcp # local definitions follow 0 lI 05050I# # General dialer definitions used below # dial9600|9600 Baud Hayes attributes:\ :br#9600:at=hayes:du: dial1200|1200 Baud DN11 attributes:\ :dv=/dev/ttyi8:br#1200:cu=/dev/dn1:at=dn11:du: dial300|300 Ventel attributes:\ :dv=/dev/cul0:br#300:cu=/dev/cul0:at=ventel:du: # # UNIX system definitions # UNIX-1200|1200 Baud dial-out to another UNIX system:\ :el=^U^C^R^O^D^S^Q@:ie=#%$:oe=^D:tc=dial1200: UNIX-300|300 Baud dial-out to another UNIX system:\ :el=^U^C^R^O^D^S^Q@:ie=#%$:oe=^D:tc=dial300: tip0|tip1200:tc=UNIX-1200: tip300:tc=UNIX-300: cu0|cu300:tc=UNIX-300: cu1200:tc=UNIX-1200: dialer:dv=/dev/cul0:br#1200: #-------------------------------------------------------------------- #The attributes are: # #dv device to use for the tty #el EOL marks (default is NULL) #du make a call flag (dial up) #pn phone numbers (@ =>'s search phones file; possibly taken from # PHONES environment variable) #at ACU type #ie input EOF marks (default is NULL) #oe output EOF string (default is NULL) #cu call unit (default is dv) #br baud rate (defaults to 300) #fs frame size (default is BUFSIZ) -- used in buffering writes # on receive operations #tc to continue a capability 0 lT X0$0$0H#! /bin/sh - # site-specific startup actions, daemons strings /vmunix | grep UNIX >/tmp/t1 tail +2 /etc/motd >>/tmp/t1 mv /tmp/t1 /etc/motd chmod 666 /etc/motd echo -n starting local daemons: >/dev/console 2>&1 #if [ $INET = YES -a -f /etc/timed ]; then # timed & echo -n ' timed' >/dev/console 2>&1 #fi if [ -f /usr/lib/sendmail ]; then (cd /usr/spool/mqueue; rm -f lf*) if [ $INET = YES ]; then /usr/lib/sendmail -bd -q1h; echo -n ' sendmail'>/dev/console 2>&1 else /usr/lib/sendmail -q1h; echo -n ' sendmail' >/dev/console 2>&1 fi fi echo '.' >/dev/console 2>&1 # /etc/ntpd 0 lꪭ 3/83/80HHOME=/; export HOME PATH=/etc:/bin:/usr/ucb:/usr/bin; export PATH # If you have a ram disk configured into your system which is listed in # /etc/fstab, you'll have to do a mkfs on it here and probably change the # ownership and modes below after the standard file systems have been # mounted. # RAMSIZE=0 RAMFS=/tmp RAMOWNER=root RAMGROUP=wheel RAMMODE=1777 if [ ${RAMSIZE} != 0 ] then /etc/mkfs /dev/ram ${RAMSIZE} 1 2 fi if [ "$2" = powerfail ] then echo REBOOTING AFTER POWER FAILURE >/dev/console 2>&1 fi if [ "$1" = fastboot ] then echo '' echo Fast boot ... skipping disk checks >/dev/console 2>&1 elif [ "$1" = autoboot ] then echo Automatic reboot in progress... >/dev/console 2>&1 date >/dev/console 2>&1 # this will *only* work if fsck can do your root file system # without a temporary file, and if the root file system is # checked alone in a pass by itself -- be careful! This can # *seriously* mess you up. fsck -p -t /_FSCK_TMP_FILE >/dev/console 2>&1 case $? in 0) date >/dev/console 2>&1 ;; 2) exit 1 ;; 4) reboot -n ;; 8) echo "Automatic reboot failed... help!" >/dev/console 2>&1 exit 1 ;; 12) echo "Reboot interrupted" >/dev/console 2>&1 exit 1 ;; *) echo "Unknown error in reboot" >/dev/console 2>&1 exit 1 ;; esac else date >/dev/console 2>&1 fi # attempt to rationally recover the passwd file if needed if [ -s /etc/ptmp ] then echo 'password file may be incorrect' > /dev/console fi umount -a cp /dev/null /etc/mtab mount -a >/dev/console 2>&1 if [ ${RAMSIZE} != 0 ] then chown ${RAMOWNER}.${RAMGROUP} ${RAMFS} chmod ${RAMMODE} ${RAMFS} fi echo -n 'checking quotas:' >/dev/console 2>&1 /etc/quotacheck -a -p >/dev/console 2>&1 echo ' done.' >/dev/console 2>&1 /etc/quotaon -a /etc/dev_mkdb ps -U >/dev/console 2>&1 rm -f /etc/nologin rm -f /usr/spool/uucp/LCK.* rm -f /usr/spool/uucp/STST/* chmod 666 /dev/tty[pqrs]* # set hostname and INET, turn on network . /etc/netstart if [ $INET = YES ]; then echo 'starting system logger' >/dev/console 2>&1 rm -f /dev/log /etc/syslogd fi # /etc/crash should be a symbolic link to the crash directory # if core dumps are to be saved. if [ -d /etc/crash ]; then echo 'checking for core dump... ' >/dev/console 2>&1 /etc/savecore /etc/crash >/dev/console 2>&1 fi echo preserving editor files >/dev/console 2>&1 (cd /tmp; /usr/lib/ex3.7preserve -a) echo clearing /tmp >/dev/console 2>&1 (cd /tmp; find . ! -name . ! -name lost+found ! -name quotas -exec rm -r {} \; ) echo -n standard daemons: >/dev/console 2>&1 /etc/update; echo -n ' update' >/dev/console 2>&1 /etc/cron; echo -n ' cron' >/dev/console 2>&1 /etc/accton /usr/adm/acct; echo -n ' accounting' >/dev/console 2>&1 echo '.' >/dev/console 2>&1 if [ $INET = YES ]; then echo -n starting network daemons: >/dev/console 2>&1 # $routedflags is imported from /etc/netstart; # if $routedflags == NO, routed isn't run. if [ "${routedflags-NO}" != NO ]; then /etc/routed $routedflags; echo -n ' routed' >/dev/console 2>&1 fi # $named is imported from /etc/netstart; # if $named is set to something other than NO, named is run. if [ "${named-NO}" != NO ]; then /etc/named; echo -n ' named'>/dev/console 2>&1 fi /etc/inetd; echo -n ' inetd' >/dev/console 2>&1 # $rwhod is imported from /etc/netstart; # if $rwhod is set to something other than NO, rwhod is run. if [ "${rwhod}" != NO ]; then /etc/rwhod; echo -n ' rwhod' >/dev/console 2>&1 fi rm -f /dev/printer /usr/lib/lpd; echo -n ' printer' >/dev/console 2>&1 echo '.' >/dev/console 2>&1 else # lpd will run even with out networking. echo starting lpd >/dev/console 2>&1 /usr/lib/lpd fi /etc/rc.local date >/dev/console 2>&1 exit 0 0 l : Jp: Jp0H# # Internet (IP) protocols # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol ggp 3 GGP # gateway-gateway protocol tcp 6 TCP # transmission control protocol egp 8 EGP # exterior gateway protocol pup 12 PUP # PARC universal packet protocol udp 17 UDP # user datagram protocol hmp 20 HMP # host monitoring protocol xns-idp 22 XNS-IDP # Xerox NS IDP rdp 27 RDP # "reliable datagram" protocol 0 l A *~8+8+0H# # Copyright (c) 1983 Regents of the University of California. # All rights reserved. The Berkeley software License Agreement # specifies the terms and conditions for redistribution. # # @(#)etc.printcap 5.1 (Berkeley) 6/7/85 # # This is a sample of printcap entries used by various printers/plotters # # DecWriter over a tty line. lp|B300:\ :lp=/dev/ttyS5:\ :sd=/usr/spool/lpd:\ :lf=/usr/spool/lpd/errs:\ :af=/usr/spool/lpd/acct:\ :of=/usr/lib/lpf:\ :if=/usr/lib/lpf:\ :br#9600:xc#0:xs#040040:fc#077777:fs#06320:\ :pw#132:\ :pl#66 # :tr=\f:\ 0 lV |000Hroot:*:0:1:The Man:/:/bin/csh daemon:*:1:1:The devil himself:/:/bin/sh operator:*:2:5:System &:/usr/guest/operator:/bin/csh bin:*:3:20:Binaries Commands and Source:/:/bin/csh nobody:*:32767:31:Nobody:/nonexistent:/bin/sh uucp:*:66:1:UNIX-to-UNIX Copy:/usr/spool/uucppublic:/usr/lib/uucp/uucico sms1:*:10:10:Steven M. Schultz:/user/sms1:/bin/csh ingres:*:39:74:INGRES Owner:/usr/ingres:/bin/csh 0 lIˤ zS0cS0c0Glocalnet 127 0 l x0♕0♚0G/userra0crw/usrra0erw/xxxra0frw0 lc w:<>@BR0R00G @_| e7cce7 / D<  7% > Sw V  wVNe <4w V |G L| L 57 t|7 n| S f  L|F|@|N Q4|*| S 7"|| | m|  w.Vw V {7 \7 Z0{ D {'&f I% {7-$7- 777h{  m{-{wUw U <{_*{7 7  Z{&f I% {  m2{-({"{ m {& Q% {f& *G%zXTz L 5 z  V z f   mz-zN Q %Dz& %wTw TNe <@&f5f pNewjTw VT7 0zNfe J%Ae@ w8T zNef 8 ymA % w SNexfef|f 1eNex &Br2@ wS w Se^yw Xy @ ee@ f& *Ke5u7`$yw`"yw y &W-! & A@ee@ f& Je5u7`xw`xw xwSw R  @m  % exw xe v@ 7`xw`xw zxwRw R5 Xx~ E7 Nx7 Lx&x"x0x% N pN  eDe_h r yW  S%f  wwe _f%T  N &7&  NN pN% S?\w e_f_fNefe & *h n eu_f   6N pN%_b  7v_f  Nefe&  B n e7vwv_f   x& fefe&  s ef& He7XvwVvb  _<  fefe d ef& Gewu6 3  _ u( _ _ _ u _ _ _w  S ̋_% EN pN  Sw@ue %%fN pN NeN pN%@  N pN  S  t N pN  St O tt t t  tt Fef& Fe7twt# t  d7nt lt ht  67HtwFt:t nIt: nI 7s?s sN pN  S " :D >E % >E X >E % >E l >E % >E  >E % >E  >E % >E  >E % >E  >E % >E "r L+ r 7rr +r l +  F@ %r& %*$ %|r %\r * Z 6r0 Z%&rB Z  r xO 7r rI     S  < S  \ S 7 q7 qqe@- 7qY  2"  { 7 q<#  q 2\ 2 hqe xqw rqpqjq z e_ vq rq  7Hq w`qT @ w&q&@ B wq7%qq5@ wp&@ B wpu&@p& V& pp Bef& 57p pp Ae v Vp @ 7`bpw``pw Zp^pe 7`Lpw`Jpw Dp5& " ] J wIw I Nf  @e5D5& ̋N p-5u5 u    u- u-A@NffnN pNe Sw(Iw INfN pNe SwIw H  |wHw H  hwHw H  TwHw H  @wHw H  .wHw H,  wHw tHF  wtHw `H n`   N nQB nQ  Sw6Hw "H /f I 5 wH=N8 O / 8 O N8 O 8w GNX O /X I  _ wG Xw GD L 5  wBm7 @BR0R00G0fe O fe O5 '  zN?fe J% fe O fe O ) >E % >E N Q@wFw F nl Zbl   >E x ):lw^Fw JF. C    >E w0Fw F k^ +7k  k g  7 kwEw E8 ,5  xNe J@-_h k k S E5uNe @7vk L 5G Ofef I%  Ofe I% Nfe l eN,fe .e%j5 @5N Q wDw D6N O5fe O Nfe O fe L _Ne : XjPj& pNeDCO5% (   5 ,  :% &  O )z   ,@:% &  O   QwC5fEw |C Ne Ew-_ w-_ A@e,@ 7w i_ -i_ hhd hh :ef& :eee@ 5uffA@hh f& :e5ud ff f:e5u<  ff :ef& 6:eN ff :ef 7(hC@ wh& fe .IeNe w4Bw B/N pN Nf f fffN pNe B nQN nQwAw ANf f fffN pNe wAw A Ne E hghg .ew8RB pN ~ 8g_f I% ]e <50 l + Q 8ef&A@ 2 r  5w N& &  w> B pNe  m\f-Rfw@w l@ ff I%5"@B2,2, 2,  w4@@B2,@w @(e 2%qe@`7 (}e w?ee<7ee7ew ?(Wpme@ 0 Wpmevef M%efe ew %  wh?w T?  "Wpm.e@pHWpme ejw d%  w?w > d d    Rdx dd 6ef& e J   + Y   $ , wx>w d>  wd>w P> :d8d5.dt &dV e@- D  L%F7 @ce<7c7 lm0cw ce cw c c -cc -cc | E 5 .5N >E 5 NQ    h >E Nffw eNe J5@-5  Nf %@5  x  N   ?a xO%a     P a7xa 7 a7 a a na  %va Lala+ %w;w ;  r-- ,  S  w^;w J;N SwN;w :;p fe O Ne Hfe |) A1  Ne D b fe xO =  Ne D 8Ne zJw:w : ,7 >E  >E 4 >E Ne  uu uuf . %Ne uuNe ,  `  1j    D f pd j!  d 2R ! >E Nefef % N 2R N 2RN 2R %N 2RN 2R7 7 wj9w V9  j   &j , %w<9w (9DCB5 ^ 2R ^ xO 7^_ D `_^7 T@  I@t 4t m^&@f& (&e@7l AWpu`% @ `& . (P^^ V%5%(>%%' D)@%t m^&&~O e%  t(f- % , & *+%5x@@ `& . <]&~O e5%<_N P D w7w t7u uumNff %5 @w@7@ @w "7 zv (&eBet57 \E55  w-\:5\  ue d\5  4ff (&e5 5 te4  %@ew- \wd6w P6fe   t@m  %t@m f& % %w6efft@m f& j!ew 5feff (&e )fe  t@a55  ff % %w^5  t@a55  N f fff j!e %ނw 4DE_#Z v @Z EBtpP%@pZ v @\Z EBtpP<7-87-: 7-<37->. ,Z2E%$Z v @Z EBtpP\% %@ %eYw Y w,4w 4Y v A\Y Et0N7 Y7 Y &N%f % Y~Y v lY EtP\N  ^Y VY$JY v A\4Y Et0$Y v Y Et@E  !% $ & , w2.w . De t4 tt 4 4 Ne&& J% w-  eu @w4- w&-w -D̥: ̋̋w-w |- C Wp De` ˋ5ˋ =K ˋˋ w>-w *- J%w-= )@0 )@0 ):&fe )% &fe )%w ,  $  L 77 w,w h,  Q7 w^,w J,   x *5%%xw&,w , p  N& Ow, w + B  N& Ow+ pw +   N& Ow+ @w +D "  O 4wn+w V+   L 7 |w@+w ,+  Q7 w&+w +DC  ̋̋w+w * v   L 7b EX J%7:& , 7:& ,  -7܌:& ,  & ,  %,& , ̋ wP*%w)*J w)w *D      + - ̥9 Wp @@`e̥0  w)w )D5 5      + -! ̥9 f& ff P!eee@ ee@ 5u̥0 A@  wB)A@w(w )DC AupB 4  & M%b ~K5% 傎& M%`@ @m A Z&@w(  w (%Vwjw b`t7ZTWpwPAwpDAmu% Nf / @m"5uBm B-"C-Dm5TD-umԋ@5@- w' ӁNf mu-Bm B-т̒jC-Lw n' @@5@B  vwp2AmDu-(6B @5  N ԊC! Ɗ5ԒS DCUC-f m5D-/+D-!Cm`@5&@5%3-Df / 5u0B555R DD-N& m-މN& / -Ɖ_/w%w %Nef6 1%w%w %Neff 1%w%w %D A555  ԋuNeffe 1%wZ%w F%DC 5 5 _,3%%_N35 %*e5  AWp `eu5 0u%l5  %h%[ 75e  _3Neffff 3e   * O  A@ EN ~K5% % % %Nf *J &    %_2 A@ E%Nf *J @w#N ~K5 w #N%c%s%[Nf ff f& 6ewb#5 5 5 5 %e%f %o%xDe5 5 A @ EN ~K% % % %- Ԑ A @ EN ~K _5%+_5  _5%a%f %A_5%F_5 % A@vN ~KO% A@v@mAm@ vA@v5u50 %a%fW7 5`u`u C% S P Ԑ A @ E =5%%.%e%E- *% ' $ ! Ԑ A @ EN ~K%+%-%0%9 A@  5u% N  *J =   @e! @e! _3@t@]   x Ne 8A _3Ne 8A @H@pHw V DC = 5%c%0u5 %s    ~K%r %c5 %[r       ~K%%   *J =  D- %cwn w VD ̥^     % %]%-+  $%-̥]4   ̠     %]  ww D*\5% %-%+ 5 55 55  B5eA5 5%.55  B5eA5 5 %E%e$%+%-  Wp B`e5  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& `:e5 55w6 m 7v"|w D 3 UEtU4 4 wxw dNf : wb~ww H4De _P< t4 t t4 4t Ne&& J% _P r 8 8 rd ( Ad 5 8u 4  Ad f&A@ 5u r  r   Ad @mAm@ 5u e4 tWpe4 u4  AmA f&A@ 5u  AmA 5 u ܃@ 44  ttw!w0w De LN O4e epr E  O4e  Be v Nfe J%w8w $-b@  wN  .I% w u@t5456@ 5Nefef J% (3A@u5Btr624@ Aup fef J% u-u-u-@wNw : fe 6F@w, @pHA@twzw  RG!,& nI   w 1& *G%7}˕,Nf F w D v !     +  w^e% - r<N r<&@&% .Ie ~ ~w  Nef lG ww D 5  =o& I% `5ȥ= zo = @wve  w V Nef H@wJw 0 f H@w* w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef I,5@ 'Ne2 I %ʕ/  f xO% %Zn%Jn wRNef Iҕaʋʥz5ʕaw  BuNefef hX%=@@w Ћ Ћ   Ћ Ћ  Jҋ~ @@&w W f r @  W f r@  @ w  D% 5     |@w 4-  w6 Sw0 mow( nJlw e& 7 f7^gw w \  & f JewT w yw &  4  b '     ` TW ~  s`K6!  w D85U5_L5P_L r mh@e4 ,5Ne & DT  uN T4USt%65B nQ5N nQ5& & ~O% 45@e-4  % U5EU  w E w b D Z +   r= wB wD 5 a U5ff xO%ށ̥a &  Oe 3     U̥r 33 ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef hX% nQU4 4  fef hX%5 wZ    6v&  @ppC`p   6@Cw8w27g Ћ P ы A@PЋ w FD:5UE5Hw* _TQ5uNfe & V% _TQbNe & DT  uN T)U5| m- 5 & V%St%B J PT U   & V% S U _P @_Pw DE%%"5   & V% U wv w ^D55@ nQ  2R 3 U 4 4 4 4 4 ww~w  q$65+ d &5e-qde %& & q    S ww  5f S 7nq f S 7BwX@ mDq7Bq68q%&e w  "q q    S e-pww D p65 e %&wp  5 e-pw Q JSww  N Vww rDCDpC T S wZw FN UwJ ~5 & E        ~5>wlYwfw Net@f Te  w6w.w  o@U7o>U7o@Ĕo>ČoAe vBxo7 zo  po%jo 55 a  a!PE -2o%> w$ V `e vWt vwo@ `e @  V%nne U?nn `e 7n>U?n a7n nn?nnU ew dDdnE wZw FD5 U 5N T!w5A vBB-  }ee@ !ۃ `!ւ ` `mm& E%m%w w7x`*'$!       7& A& BF7!W-4_7& & e Ӌ .2 &7& e vӕ-pӕ0B~\ӕ.  ӕ0~ B~.2&70 & Le ӕ-0 ӕ. B~ӕe ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .lu4Bw* J@B V_4Z@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& O z   5 , @ :% & f E O  (˥-%0     ,:% &  O 8 5E& z   5 , @ :% & f E O  w&w Nefef 5& \]e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& ]eww  fff 5& ]eww  5 %O N  = J555Ne5& &_e555'0Ne5 B& &_e578 Be0" 5%55 5 B5@B eJ a=%J7eJw %5 B5Ne& &_e55e0%7e`Jʕ0%Jʕ1  %J˕0 ʥ9 6@~ the epochrwCannot open %s level %c dump on %s %-16s %c %sUnknown intermediate format in %s, line %d /etc/dumpdates%16s %c %[^ ] N:wBzG/dev/rmt8/etc/dumpdatesMust specify a key. output filedensitysizetime of last dumpbad time "%s" number of blocks per filehonor levelbad key '%c%' Must specify disk or filesystem Unknown arguments to dump: %s You cannot use the T and u flags together. -standard outputremote dump not enabled Date of this level %c dump: %s Date of last level %c dump: %s Dumping %s (%s) to %s on host %s to %s Cannot open %s mapping (Pass I) [regular files] mapping (Pass II) [directories] estimated %ld tape blocks. estimated %ld tape blocks on %3.2f tape(s). dumping (Pass III) [directories] dumping (Pass IV) [regular files] DUMP: %ld tape blocks on %d tape(s) DUMP IS DONE DUMP IS DONE! bad '%c' (%s) value "%s" The '%c' flag (%s) requires an argument SIGHUP() try rewriting SIGTRAP() try rewriting SIGFPE() try rewriting SIGBUS() try rewriting SIGSEGV() ABORTING! SIGALRM() try rewriting SIGTERM() try rewriting Unknown signal, cannot recover Rewriting attempted as response to unknown signal. /rh~/dev/ttyrfopen on /dev/tty fails yes Yes no No "Yes" or "No"? NEEDS ATTENTION: %s: ("yes" or "no") Interrupt received. Do you want to abort dump?operatorNo entry in /etc/group for %s. operator/etc/utmprCannot open /etc/utmp ttydttyd/dev/w Message from the dump program to all operators at %d:%02d ... %3.2f%%%% done, finished in %d:%02d DUMP: Dump these file systems: Last dump(s) done (Dump '>' file systems): ??%c %8s (%6s) Last dump: Level %c, Date %s VTape write error on %s Cannot recover Tape write error %ld feet into tape %d TAPE ERROR! Do you want to restart?This tape will rewind. After it is rewound, replace the faulty tape with a new one; this dump volume will be rewritten. Broken pipe DUMP: error writing command pipeClosing %s Change Tapes: Mount tape #%d CHANGE TAPES! Is the new tape mounted and ready to go?Do you want to abort?Context save fork fails in parent %d Parent %d waiting for child %d has another child %d return Child %d returns LOB status %o Bad return code from dump: %d Cannot open output "%s". Do you want to retry the open?Tape %d begins with blocks from ino %d The ENTIRE dump is aborted. /tmp/dumplockXXXXXXCould not create lockfile Could not reopen lockfile too many slaves, %d (recompile smaller) DUMP: slave couldn't reopen diskMaster/slave protocol botched. writeshort write: got %d instead of %d DUMP: error reading command pipecorrupted directory, inumber %u bread: lseek fails (This should not happen)bread from %s [block %ld]: c=0x%x, regc=0x%x, &c=0x%x, n=0x%x More than %d block read errors from %d DUMP IS AILING! This is an unrecoverable error. Do you want to attempt to continue?JanFebMarAprMayJunJulAugSepOctNovDec/etc/fstabr/etc/grouprr6666666666666666666SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %dx$0BTfr8GVn{=ZkLc!=Uv*=L`v,NcRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator,h  !TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d. ((((( AAAAAABBBBBB &ĚĚ`YdFYoRYxZfZeYgYcYs Yl YLhYulYDJYOVYX~YU=(\0 l 8 468R0AR0A0F  (( e7cce7 /  7%  w @ d w<w (D* R ?E G ߬  -?% <& ߂ F  r݀5r<EX -X ?J%  <<& 0 F w5&< w bD LԋwZw FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%<   U   & % S U _n @_rw DE%%"5   & % U wv w ^D55@    3 ( 4 4 4 4 4 ww~w  $05+ t &5e-xVe %  & V     ww  5f  7 f  7wX@ m70% e w        e-ww D 05 e % wj  5 e-Pw . ww  N ww rDCDpC  V wZw FN (wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  XFU7JDU7@F>D6Ae vB"7 $  % 55 a  a!PE -%D w$  `e vWt vw@ `e @  %~e U?ll `e 7ZDU?N a7@ 8:?2.U ew dDE wZw FD5 ( 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `jm4& E%&m %w w7*'$!      7& A& BF7!pW-7\config hasn't been implemented under 2.11BSD.,PP0 lje$ 2000Fwheel:*:0:root,sms1,sms daemon:*:1:daemon kmem:*:2: sys:*:3: tty:*:4: operator:*:5:sms1 staff:*:10: bin:*:20: guest:*:31: unify:*:40: ingres:*:74: 0 lt FY R0R00^ J6  e7cce7 / l  7%  RBw E$5 /f F( 5 uf T> f T>f T>5 @e5- =ff %5%h r y5 @fe ((} UUU@UUUU8f'  - 7 %:f (( ( f f   f  .  . ?w.A ̥:7 p 8*+0*\  w- f f  @m7 A   9 E5 @@l w,9w r@DC E5<E@e33. @;E  5 , @;% & fE > 5  @U3 3  w?%w,?w ?   L  w?  5 ff L% 50  8 Bw B?  uN >5&f %5Bw? d5  Vf T> X 0   w > p  @e5ff l%5Bw> 5  w-   4 w B>  =  &  -%7xtw>Rf T>Z^5qf , 7: w = w=w = t  w=w(w =  /7    z@7 w=w r=wwx=w d=   @ E wP= +5% %^ &+%  ^ ((s^  7Vv&  7Hy&   70|&   7&  7&   7w&   7w&  7&  7&  7_w "<|  w<  h7 bZ 3P 455 ff0 %e55 D^F& <%eH& <%eJ& <%eV& <%e7w ;  _ f T>_ V_ 5 & f =%5=2 5u fff ,>e5 #u 1^f =%50^^ :=^N @w`:w L:D      + - ̥9 Wp @@`e̥0  w:w 9D5 5      + -! ̥9 f& ff <1eee@ ee@ 5u̥0 A@  wp9A@w87w8w B9  3  =  Wp,f&  ,>e, =%%, @ @ ҥ "w8w 84De _x t4 t t4 4t Ne&& F*% _xt 4     6t-t- t-t- t- t- 55 eAePPPP 5 5  55 Nefe Z*% & $%5u7  && F*% v fe Z*%ff % fe& F*%wp7A@E f& w F7 wL7w 87D Lԋw07w 7DC  w75 7@  55@- 7 5!$w 6 @e5ff D%w6w 6D5 N# %EAEt =8_ 5]Ne "Nfej $%CaejNe |Aej@ 0 lt FY R0R00^e`5    $%`5   $%` xӕ:ӕ Bej%_Lmo N  $%` 5 Nfej *%`Aej@55 *@e`5^}^f@ej@A^1e^ ^@^fe` +%  U %Nfej| VE%@-`R ffejX e O5JK 5h%D 4   =%5fej <> e>fej ((  NAej@f VE%N @ \E & fh *%%%,w3w 3D ww 57%|<| .$%5`,  %7F%  = 7.*(7%' %% ,%% @w2w 2 @7w2w 2D 7w2bw,2w 2N | Hw2w 2D el&&&&Wpe<f Wpe&f $ewR2w >25 5  AaAE f&A@vUU5u %w 2w 1D w1̥/ 55 >&f V* e %Nfe p> fe <> fe <> ԥ.̋De &  & = %fe0 =% @ %,@e05e w Ne$ wNe( w%r_ _% _%2_WpfWpeme, _@e\5 N f&te -h @ E3 -L *te,5.N f&@.e@.A Ep@.A Ep - s| -3| _ - t-2_ -|7 7te,5  e|7 -f _@e|7w 6/ Nefe :#w&/7 "AWp@7V P7 R f # | p> |7b7\ w .7 7 7 7 | p> |707*w.w .l V$̋      2  wp.w \. ( @55 L w-Jw-B  t 0 -$  t5, 5, - ܹue,&&fe Xe3 e|p`e|3w-w -& f ew~-w j- Q@f& $e5uQ@f& $e5uumumu _eeQu  %QQ eu % ff $et ff T$e5u< ff #et< ff $eL A@e@ f& #et e  =  r  rd > r 8 8 rd ( A 5 8u 4  A f&A@ 5u r  r   A @mAm@ 5u e4 tWpedu4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw*!w>*\w8*w *De LN >4ee   >4e Be v Nfe +%w@*w ,*-@ w&*N $%ewz)awt)w )w@7% ?@w)N f (w )DC_!̥%_! 5 r y _! 9% 5afe & <%5@e5 5 N " _! 5 N " _! w )u (_! (_! (_!  !% _!0 !% _!0 r  r f !% _!0 !% _!  !% _!  r  r f !% __!0 !% __! " __! (__!0 !% __! (__! " __!0e r& !% __!0e  @ r& !% __!0 !% _!_ (_!_ _ " _!_ _^ _d _! _% _b_fe & <%5@e5_ _! _ _ _! _ _ _! _$ _ _!0 el rdf !% _!_ _: _!0 !% _!_ _V _d _! " _!_ _2 _ h_\ _L _ Y% _ _ _ G0 !% H_ _V _ - (2_ ! 0 el !% _ _ _" _lR N _?D @ ̋_<0_w &$A r e0@ A r 5   % @  L %  "w#w #D w# ?w #u@t55@ 5lNefef Z*% (3A@u5Btr2@ Aupl fef Z*% u-u-u-@w"w " fe :#@w" @pHA@tw"w " V$!,& ((   w~" 1& .$%7Y˕,Nf # w 6"D   !     +  w"e% - r<N r<&@&  $e ~ ~w ! Nef p$ w|!w h!D 5  =& p(% `5ȥ= | = @w!e  w BuNefef F%=@@w w  ( (  ( w / F(  ,5   & T> 6@ ,w B   , 7 =w, w   z@7 w w D 5 %" 5x@ #w%̥\" %%# % % % % % %  w lD=& ((  wb w H    , 7 _$( &+% % % %  %#77 %7 %7 %7 7 _' & p(% % % % UK % % N & p(% % % % EP( & p(% % % % U & p(%  l&7 %̋#̥#7̋7  & ((  wЋ Ћ   Ћ Ћ  Jҋ~ @@w @hN B HNef B?@E% 8 d)2 )*L-  p> e <> Ne @*u-u- @)w @) w D @4 4  tDww t f = %  @P 0C4 4 wHw 4D 4-&4-!4 4   &e & =%4    wme   s lt  &wSwmow nn*lw e& 7 h7`gwTjB`FI I7~Iw  BuNeff F%=@@ww  fff +eww>yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_,5P_,  m@e4 ,5Ne & B  uN 0C4USt% 5  @5 @5& & =% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff =%ށ̥a &  ,>e 3     U̥r 33w 4$ 0C < w5 4@E%@EU5N&e p>  &e <> Nf&e =%4 IN&e p>  &e <> Nf&e =%  (Ne& B  ff eee@ 4t@t"4 4t @ tD_-w N @@ @N tDww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  5 ve@ 4tw"w D55ff %f&& "eff&e e &e f8 55 www5 5 w D5#5ff T %f&& eff&e *ew6&e J:'44  && ef&& ,>e&e & VE%%U w D5_2o5ff %f&& eff&e Ze L&e J:8f f ff&e V e 744  && ef&& ,>e&e & VE%%UUw @@m e%fe B  &e f8 55 3ff `%f&e@ &50c &e f8 55 3  < U44  && ef&& ,>e&e & VE%%&_ 2fffffe e _ 2&e % _N2_ 2e_N2  mm@ e@ f& ef&& ,>efe& VE%%_ 2 7_H1w @0 0 @0 N 477ww D85_5Ne& Bq fe Ve4-4-/44  &&  ef&& ,>e&e & =%%&e B &e f8 55 ew6w2w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  5 ve@ 4t4-4-/44  && ef&& ,>e&e & =%%&e B ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& ,>e&e$& =%%&e$ B `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& ,>e&e$& =%%&e$ B `Btp$t t"  ff Nef&& ,>e&e$& VE%%Uw w r D5#5 5 wwwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& ;% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l 5l u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm <% a@ `` e w D a@@m e  w e  aAm HN@`@m &f <%  aN f`f <%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef F% @U4 4  fef F%5 w    6v&  @ppC`p   6@Cwzwtw D @ & & ,>e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _?5uNfe & VE% _?bNe & B  uN 0C)U5| m- 5 & VE%St%  j B U   & VE% S U _> @_>w DE%%"5   & VE% U wv w ^D55@ @  @ 3 tD 4 4 4 4 4 ww~w  J$ 5+ 6 &5e-e % &     fB ww  5f fB 7 f fB 7bwX@ m7 %e w  r d    fB e-Hww D 4 5 e %w  5 e-w z@ Aww  N \Eww rDCDpC 0C B wZw FN tDwJ ~5 & E        ~5>wlYwfw Net@f *Ce  w6w.w  8U76U786Ae vB7   % 55 a  a!PE -%6 w$ 0E `e vWt vwP@ `e @  0E%($e U? `e 76U?֔ a7 ?U ew dDE wZw FD5 tD 5N 0C!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%ɷmɇ%w w7*'$!     * 7 & A& BF7!W-I7w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_G@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& > z   5 , @ :% & f E >  (˥-%0     ,:% &  > 8 5E& z   5 , @ :% & f E >  whaltfasthaltfastbootlqnhdarsfusage: %s [-%s] lqnhdarsf%s: no sync and no fsck are a dangerous combination; no fsck ignored. root%s; %s by %shaltedrebooted%s: can't idle init CAUTION: some process(es) wouldn't die /usr/adm/wtmp~shutdown: illegal option -- : option requires an argument -- F/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd/etc/utmp/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %d 2DT`r!5Ihw0Nm .L|7Qm % 2 F Z m |  0 C \ ~ RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator     ' 0 6 < @ E J Q [ c l @8 l !@!j!SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y# ' / 3 ; ? ,C G hK O S W [ _ c g o s w {  TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d/etc/ttysrronoffsecurewindow=/dev/=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired BBGdFoGxGfGeFgGcGsFlFLGuGDFOGX0GU0 l}$ p5R09R090E# ------------------------ # # Termcap source file @(#)termcap.src 5.40 (Berkeley) 8/22/88 # John Kunze, Berkeley # Craig Leres, Berkeley # # Please mail changes to (arpanet): termcap@berkeley # See DESCRIPTION section for information about contents. # sa|network:\ :tc=unknown: sb|arpanet:\ :tc=unknown: sc|bussiplexer:\ :tc=unknown: sd|du|dialup:\ :tc=unknown: se|ethernet:\ :tc=unknown: sl|lpr|printer|print|printing|line printer:\ :do=^J:le=^H:bs:co#132:hc:os: sp|plugboard|patch|patchboard:\ :tc=unknown: su|dumb|un|unknown:\ :am:co#80:do=^J: sw|switch|intelligent switch:\ :tc=unknown: sx|ansi|any ansi terminal with pessimistic assumptions:\ :co#80:li#24:cl=50\E[;H\E[2J:bs:am:cm=\E[%i%d;%dH:\ :nd=\E[C:up=\E[A:ce=\E[K:ho=\E[H:pt: TD|dmd|5620|ttydmd|tty5620|5620 terminal 88 columns:\ :co#88:li#70:am:bs:pt:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :cl=\E[H\E[J:cd=\E[J:ce=\E[K:al=\E[L:dl=\E[M:do=^J:\ :im=:ei=:ic=\E[@:dc=\E[P:sr=\E[T:sf=\E[S:le=^H:kb=^H:\ :kl=\E[D:kr=\E[C:ku=\E[A:kd=\E[B:kh=\E[H:ho=\E[H:ll=\E[70;1H:\ :AL=\E[%dL:DL=\E[%dM:IC=\E[%d@:DC=\E[%dP:rc=\E8:rs=\Ec:sc=\E7:\ :so=\E[7m:se=\E[0m:us=\E[4m:ue=\E[0m:ms:me=\E[0m:mr=\E[7m: kg|h19-g|h19g|heathkit w/block cursor:\ :ve=\Ex4:tc=h19-b: ke|h19-e|h19e|h19 for emacs:ip=1.5:tc=h19-us: kU|h19-us|h19us|heathkit w/keypad shifted/underscore cursor:\ :ks=\Et:ke=\Eu:tc=h19-u: ku|h19-u|h19u|heathkit with underscore cursor:\ :vs@:ve@:tc=h19-b: kb|h19|heath|h19-b|h19b|heathkit|heath-19|z19|zenith|heathkit h19:\ :al=1*\EL:am:le=^H:bs:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :co#80:dc=\EN:\ :dl=1*\EM:do=\EB:ei=\EO:ho=\EH:im=\E@:li#24:mi:nd=\EC:as=\EF:ae=\EG:\ :ms:pt:sr=\EI:se=\Eq:so=\Ep:up=\EA:vs=\Ex4:ve=\Ey4:\ :kb=^h:ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\EH:kn#8:ke=\E>:ks=\E=:\ :k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:\ :l6=blue:l7=red:l8=white:k6=\EP:k7=\EQ:k8=\ER:\ :es:hs:ts=\Ej\Ex5\Ex1\EY8%+ \Eo:fs=\Ek\Ey5:ds=\Ey1: kC|h29|heath-29|z29|zenith-29:\ :am:bc=\ED:bt=\E-:do=^J:\ :al=\EL:le=^H:bs:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :co#80:dc=\EN:\ :dl=1*\EM:do=\EB:ei=\EO:ho=\EH:im=\E@:li#24:mi:nd=\EC:as=\EF:ae=\EG:\ :ms:pt:sr=\EI:se=\Eq:so=\Ep:up=\EA:vs=\Ex4:ve=\Ey4:\ :kb=^H:ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\EH:kn#1:k0=\E~:l0=HOME:\ :k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:k8=\ER:k9=\E0I:\ :es:hs:ts=\Ej\Ex5\Ex1\EY8%+ \Eo:fs=\Ek\Ey5:ds=\Ey1:us=\Es8:ue=\Es0: h2|2621|hp2621|hp2621a|hp2621p|2621a|2621p|2621-pb|hp2621-fl|hp 2621:\ :is=\E&j@\r:bt=\Ei:cm=\E&a%r%dc%dY:dc=2\EP:ip=2:pb#19200:\ :so=\E&dD:se=\E&d@:us=\E&dD:ue=\E&d@:me=\E&d@:\ :kh=\Ep\r:ku=\Et\r:kl=\Eu\r:kr=\Ev\r:kd=\Ew\r:\ :kn#8:k1=\Ep\r:k2=\Eq\r:k3=\Er\r:k4=\Es\r:k5=\Et\r:k6=\Eu\r:k7=\Ev\r:\ :k8=\Ew\r:ks=\E&jB:ke=\E&j@:ta=2^I:tc=hp: hn|2621-nl|hp2621nl|2621nl|hp2621-nl|hp 2621 with no labels:\ :ks@:ke@:kh@:ku@:kl@:kr@:kd@:tc=hp2621-fl: h4|hp2645|2645|hp45:\ :mh=\E&dH:mr=\E&dB:us=\E&dD:mb=\E&dA:me=\E&d@:\ :ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\Eh:ks=\E&s1A:ke=\E&s0A:tc=hp: dl|vt200|vt220|vt200-js|vt220-js|dec vt200 series with jump scroll:\ :im=\E[4h:ei=\E[4l:mi:dc=\E[P:dm=:ed=:al=\E[L:dl=\E[M:\ :cs=\E[%i%d;%dr:sf=\ED:sr=\EM:sb=\EM:\ :ce=\E[K:cl=\E[H\E[J:cd=\E[J:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :so=\E[7m:se=\E[27m:us=\E[4m:ue=\E[24m:\ :md=\E[1m:mr=\E[7m:mb=\E[5m:me=\E[m:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :tc=vt100: d0|vt100|vt100-am|vt100am|dec vt100:\ :do=^J:co#80:li#24:cl=50\E[;H\E[2J:sf=2*\ED:\ :le=^H:bs:am:cm=5\E[%i%d;%dH:nd=2\E[C:up=2\E[A:\ :ce=3\E[K:cd=50\E[J:so=2\E[7m:se=2\E[m:us=2\E[4m:ue=2\E[m:\ :md=2\E[1m:mr=2\E[7m:mb=2\E[5m:me=2\E[m:is=\E[1;24r\E[24;1H:\ :rf=/usr/lib/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:ks=\E[?1h\E=:ke=\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:kb=^H:\ :ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:pt:sr=2*\EM:vt#3:xn:\ :sc=\E7:rc=\E8:cs=\E[%i%d;%dr: la|adm3a|3a|lsi adm3a:\ :am:do=^J:le=^H:bs:cm=\E=%+ %+ :cl=1^Z:co#80:ho=^^:\ :li#24:ma=^K^P:nd=^L:up=^K: l1|adm31|31|lsi adm31:\ :is=\Eu\E0:do=^J:al=\EE:am:le=^H:bs:ce=\ET:cm=\E=%+ %+ :\ :cl=\E*:cd=\EY:co#80:dc=\EW:dl=\ER:ei=\Er:ho=^^:im=\Eq:\ :k0=^0 l?w$ p5R09R090EA0\r:k1=^A1\r:k2=^A2\r:k3=^A3\r:k4=^A4\r:\ :k5=^A5\r:k6=^A6\r:k7=^A7\r:k8=^A8\r:k9=^A9\r:kd=^J:kl=^H:kr=^L:ku=^K:\ :li#24:ma=j^Jk^P^K^Pl ^R^L^L :mi:nd=^L:\ :se=\EG0:so=\EG1:up=^K:us=\EG1:ue=\EG0: l3|adm3|3|lsi adm3:\ :do=^J:am:le=^H:bs:cl=^Z:li#24:ma=^K^P:co#80: vs|xterm|vs100|xterm terminal emulator (X window system):\ :do=^J:le=^H:ho=\E[H:\ :co#80:li#65:cl=\E[H\E[2J:bs:am:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :md=\E[1m:mr=\E[7m:me=\E[m:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:kb=^H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:pt:sf=\n:sr=\EM:\ :al=\E[L:dl=\E[M:im=\E[4h:ei=\E[4l:mi:dc=\E[P:\ :MT:ks=\E[?1h\E=:ke=\E[?1l\E>:xn:\ :AL=\E[%dL:DL=\E[%dM:IC=\E[%d@:DC=\E[%dP:\ :hs:ts=\E[?E\E[?%i%dT:fs=\E[?F:es:ds=\E[?E:\ :is=\E\E[m\E[?7h\E[?1;4l:cs=\E[%i%d;%dr:\ :rs=\E[r\E<\E[m\E[H\E[2J\E[?7h\E[?1;3;4;6l: v2|xterms|vs100s|xterm terminal emulator (small)(X window system):\ :co#80:li#24:tc=xterm: Mu|sun|Sun Microsystems Workstation console:\ :li#34:co#80:cl=^L:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :am:bs:mi:ms:pt:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:\ :kd=\E[B:kl=\E[D:ku=\E[A:kr=\E[C:kh=\E[H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :al=\E[L:dl=\E[M:im=:ei=:ic=\E[@:dc=\E[P:\ :AL=\E[%dL:DL=\E[%dM: M6|sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ic@:im@:ei@:tc=sun: Mu|sun-s|Sun Microsystems Workstation window with status line:\ :hs:ts=\E]l:fs=\E\\:ds=\E]l\E\\:tc=sun: Mu|sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:ts=\E]l:fs=\E\\:ds=\E]l\E\\:tc=sun-e: M0|sun-48|Sun 48-line window:\ :li#48:co#80:tc=sun: M1|sun-34|Sun 34-line window:\ :li#34:co#80:tc=sun: M2|sun-24|Sun 24-line window:\ :li#24:co#80:tc=sun: M3|sun-17|Sun 17-line window:\ :li#17:co#80:tc=sun: cB|avt-8p-s|concept avt w/8 pages & 80 cols running sysline:\ :is=\E[1*q\E[2!t\E[7!t\E[=4;101;103;119l\E[=107;118;207h\E)1\E[1Q\EW\E[0!y\E[0\0720\07232!r\E[2!w\E[192w\E[2*w\E[!w\E[1;191w\E2\r\n:\ :hs:es:ts=\E[2!w\E[H\E[J\E[%i%dG:fs=\E[!w:\ :ds=\E[2!w\E[2J\E[!w\E[*w:te=\E[1;191w\E2\n:tc=avt: cC|avt-4p-s|concept avt w/4 pages & 80 cols running sysline:\ :is=\E[1*q\E[2!t\E[7!t\E[=4;101;103;119l\E[=107;118;207h\E)1\E[1Q\EW\E[0!y\E[0\0720\07232!r\E[2!w\E[96w\E[2*w\E[!w\E[1;95w\E2\r\n:\ :hs:es:ts=\E[2!w\E[H\E[J\E[%i%dG:fs=\E[!w:\ :ds=\E[2!w\E[2J\E[!w\E[*w:te=\E[1;95w\E2\n:tc=avt: cD|avt-rv|HDS concept avt w/4 or 8 pages, 80 columns, reverse video:\ :is=\E[1*q\E[2!t\E[7!t\E[=4;101;103;119l\E[=107;118;205;207h\E)1\E[1Q\EW\E[0!y\E[0\0720\07232!r\E[w\E2\r\n:\ :ve=\E[4l:vs=\E[4l:tc=avt cE|avt|HDS concept avt w/4 or 8 pages, 80 columns:\ :is=\E[1*q\E[2!t\E[7!t\E[=4;101;103;119;205l\E[=107;118;207h\E)1\E[1Q\EW\E[0!y\E[0\0720\07232!r\E[w\E2\r\n\E[*w:\ :ae=^O:al=\E[L:am:as=^N:bs:bt=\E[Z:cd=\E[J:ce=\E[K:\ :ch=\E[%i%2G:cl=\E[H\E[J:cm=\E[%i%2;%2H:co#80:cv=\E[%i%2d:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E1:eo:ho=\E[H:im=\E1:kb=^H:kd=\E[B:\ :kh=\E[H:kl=\E[D:ko=do,ho,nd,up:kr=\E[C:\ :ks=\E[1;4!z\E[1;8!z\E[1;10!z\E[1;11!z\E[1;12!z\E[1;14!z\E[3;7!z\E[3;9!z:\ :ke=\E[;4!z\E[;8!z\E[;10!z\E[;11!z\E[;12!z\E[3;14!z\E[;7!z\E[;9!z:\ :ku=\E[A:li#24:mi:nd=\E[C:pt:se=\E[7!{:so=\E[7m:\ :te=\E[w\E2\n:ti=\E[1;24w\E2\n:ue=\E[4!{:\ :up=\E[A:us=\E[4m:ve=\E[=4;119l:vs=\E[4l\E[=119h:xn: c4|c108-rv-8p|concept108-rv-8p|concept 108 w/8 pages, in reverse video:\ :vb=\EK\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ek:\ :is=\EU\E F\Ef\E7\E5\E8\El\ENH\Ek\E\200\Eo&\200\Eo\47\E\E!\E^G!\E^HA@ :\ :ts=\E z"\E?\E^C\EE\Ea %+ :fs=\Ee\E z :tc=c108-8p: c2|c108|c108-8p|concept108-8p|concept 108 w/8 pages:\ :i2=\EU\E z"\Ev^A\177 !p\E ;"\E z \Ev ^A\177p\Ep\n:\ :te=\Ev ^A\177p\Ep\r\n:tc=c108-4p: c5|c108-rv-4p|concept108-rv-4p|concept 108 w/4 pages, in reverse video:\ :vb=\EK\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ek:\ :is=\EU\E F\Ef\E7\E5\E8\El\ENH\Ek\E\200\Eo&\200\Eo\47\E\E!\E^G!\E^HA@ :\ :ts=\E z"\E?\E^C\EE\Ea %+ :fs=\Ee\E z :tc=c108-4p: c3|c108-4p|concept108-4p|concept 108 w/4 pages:\ :es:hs:ts=\E z"\E?\E^C\Ea %+ :fs=\E z :ds=\E ;\177:\ :i2=\EU\E z"\Ev\177 !p\E ;"\E z \Ev \177p\Ep\n:do=^J:pt:\ :is=\EU\E F\Ef\E7\E5\E8\El\ENH\EK\E\200\Eo&\200\Eo\47\E\E!\E^G!\E^HA@ :\ :ti=\EU\Ev 8p\Ep\r:te=\Ev \177p\Ep\r\n:\ :al=\E^R:le=^H:bs:cd=\E^C:ce=\E^S:cl=\E?\E^E:cm=\Ea%+ %+ :co#80:\ :dc=\E^Q:dl=\E^B:ei=\E\200:eo:im=\E^P:li#24:mi:nd=\E=:\ :kb=^h:up=\E;:db:us=\EG:ue=\Eg:vs=\EW:ve=\Ew:am:xn:\ :vb=\Ek\200\200\200\200\200\200\200\200\200\200\200\200\200\200\EK:\ :ks=\EX:ke=\Ex:ku=\E;:kd=\E<:kl=\E>:kr=\E=:kh=\E?:\ :k1=\E5:k2=\E6:k3=\E7:k4=\E8:k5=\E9:k6=\E\72:\ :so=\ED:se=\Ed:mh=\EE:md=\ED:mr=\ED:me=\Ee\Ed\Eg\Ec: cb|c100-rv-pp|c100-rv-4p-pp|concept100-rv-pp|c100rv4ppp|w/ printer port:\ :is=\EU\Ef\E7\200\200\E5\E8\200\200\El\ENH\Ek\E\200\Eo&\200\Eo\041\200\EQ"\EY(^W\Eo\47\E\E^G\041\E^HA@ :\ :tc=c100-rv: cd|c100-rv|c100-rv-4p|concept100-rv|c100rv4p|c100rv|c100 rev video:\ :is=\EU\Ef\E7\200\200\E5\E8\200\200\El\ENH\Ek\E\200\Eo&\200\Eo\47\E\E^G\041\E^HA@ :\ :vb=\EK\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ek:\ :so=\EE:se=\Ee:tc=c100: ca|c100|concept|c1004p|c100-4p|concept100|concept 100:\ :is=\EU\Ef\E7\200\200\E5\E8\200\200\El\ENH\EK\E\200\Eo&\200\Eo\47\E\E^G\041\E^HA@ :\ :ti=\EU\Ev 8p\Ep\r:te=\Ev \200\200\200\200\200\200\Ep\r\n:\ :al=3*\E^R:am:le=^H:bs:cd=16*\E^C:ce=16\E^U:cl=2*^L:cm=\Ea%+ %+ :co#80:\ :dc=16\E^Q:dl=3*\E^B:ei=\E\200:eo:im=\E^P:ip=16*:li#24:mi:nd=\E=:\ :pt:kb=^h:ta=8\t:up=\E;:db:us=\EG:ue=\Eg:xn:\ :vb=\Ek\200\200\200\200\200\200\200\200\200\200\200\200\200\200\EK:\ :.dN#9:dC#9:pb#9600:vt#8:us=\EG:ue=\Eg:so=\EE\ED:se=\Ed\Ee:\ :mh=\EE:mr=\ED:mb=\EC:mp=\EI:mk=\EH:me=\EN\200:do=^J:\ :ks=\EX:ke=\Ex:ku=\E;:kd=\E<:kl=\E>:kr=\E=:kh=\E?:k1=\E5:k2=\E6:k3=\E7: # Copyright (c) 1980 Regents of the University of California. # All rights reserved. The Berkeley software License Agreement # specifies the terms and conditions for redistribution. # # DESCRIPTION: # This file describes capabilities of various terminals, as needed by # software such as screen editors. It does not attempt to describe # printing terminals very well, nor graphics terminals. Someday. # See termcap(5) in the Unix Programmers Manual for documentation. # # Conventions: First entry is two chars, first char is manufacturer, # second char is canonical name for model or mode. # Third entry is the one the editor will print with "set" command. # Last entry is verbose description. # Others are mnemonic synonyms for the terminal. # # Terminal naming conventions: # Terminal names look like - # Certain abbreviations (e.g. c100 for concept100) are also allowed # for upward compatibility. The part to the left of the dash, if a # dash is present, describes the particular hardware of the terminal. # The part to the right can be used for flags indicating special ROM's, # extra memory, particular terminal modes, or user preferences. # All names are always in lower case, for consistency in typing. # # The following are conventionally used flags: # rv Terminal in reverse video mode (black on white) # 2p Has two pages of memory. Likewise 4p, 8p, etc. # w Wide - in 132 column mode. # pp Has a printer port which is used. # na No arrow keys - termcap ignores arrow keys which are # actually there on the terminal, so the user can use # the arrow keys locally. # # There are some cases where the same name is used for two different # terminals, e.g. "teleray" or "2621" or "vt100". In these cases, # if a site has one of these, they should choose a local default and # bring that terminal to the front in the reorder script. This works # because tgetent picks the first match in /etc/termcap. # The list of names intentionally duplicated is: # 2621, c108, dtc, hp2621, teleray, tvi, vt100. # # To easily test a new terminal description, put it in $HOME/.termcap # and programs will look there before looking in /etc/termcap. # You can also setenv TERMPATH to a list of full pathnames (separated # by spaces or colons) to be searched by tgetent() in the order listed. # The TERMCAP environment variable is usually set to the termcap # entry itself to avoid reading files when starting up a program. # # If you absolutely MUST check for a specific terminal (this is discouraged) # check for the 2nd entry (the canonical form) since all other codes are # subject to change. The two letter codes are there for version 6 and are # EXTREMELY subject to change, or even to go away if version 6 becomes for # all practical purposes obsolete. We would much rather put in special # capabilities to describe your terminal rather than having you key on the # name. # # Special manufacturer codes: # A: hardcopy daisy wheel terminals # M: Misc. (with only a few terminals) # q: Homemade # s: special (dialup, etc.) # # Comments in this file begin with # - they cannot appear in the middle # of a termcap entry. Individual entries are commented out by # placing a period between the colon and the capability name. # # This file is to be installed with an editor script (reorder) # that moves the most common terminals to the front of the file. # If the source is not available, it can be constructed by sorting # the above entries by the 2 char initial code. # # -------------------------------- # # A: DAISY WHEEL PRINTERS # # The A manufacturer represents Diablo, DTC, Xerox, Qume, and other Daisy # wheel terminals until such time as termcap distinguishes between them # enough to justify separate codes. # This is an "experimental" entry for the SRI Agiles. # It has been tried in a minimal way -- the Agile did not blow up! # However, it has not been exhaustively tested. # Anyone who tries it and finds it wanting should get in touch with: # Ralph Keirstead (ralph@sri-unix); # EK352; SRI International; 333 Ravenswood Avenue; Menlo Park, CA 94025 Aa|agile|agiles|sri agiles:\ :bs:hc:os:pl:co#132:do=^J:kb=^H:up=\E\n:\ :hu=\E0:hd=\E9:if=/usr/lib/tabset/std:is=\EE\EF\EJ: A6|1620|1720|450|ipsi|diablo 1620:\ :do=^J:ct=\E2:st=\E1:ch=\E\t%i%.:\ :if=/usr/lib/tabset/xerox1720:\ :kb=^H:le=^H:bs:co#132:hc:hu=\EU:hd=\ED:os:pt:up=\E\n: A7|1620-m8|1640-m8|diablo 1620 w/8 column left margin:\ :do=^J:co#124:is=\r \E9:tc=1620: A8|1640|1740|630|1730|x1700|diablo|xerox|diablo 1640:\ :if=/usr/lib/tabset/xerox1730:\ :us=\EE:ue=\ER:so=\EW:se=\E&:tc=1620: Am|1640-lm|1740-lm|630-lm|1730-lm|x1700-lm|diablo-lm|xerox-lm|\ diablo 1640 with idented left margin:\ :if=/usr/lib/tabset/xerox1730-lm:\ :co#124:us=\EE:ue=\ER:so=\EW:se=\E&:tc=1620: # DTC 382 with VDU. Has no cd so we fake it with ce. Standout works but # won't go away without dynamite. The terminal has tabs, but I'm getting # tired of fighting the braindamage. If no tab is set or the terminal's # in a bad mood, it glitches the screen around all of memory. Note that # return puts a blank ("a return character") in the space the cursor was # at, so we use ^P return (and thus ^P newline for newline). Note also # that if you turn off pt and let Unix expand tabs, curses won't work # (current version) because it doesn't turn off this bit, and cursor # addressing sends a tab for row/column 9. What a losing terminal! I # have been unable to get tabs set in all 96 lines - it always leaves at # least one line with no tabs in it, and once you tab through that line, # it completely weirds out. Ac|dtc|ps|dtc382|382:\ :do=^J:al=^P^Z:am:le=^H:\ :bs:co#80:ce=^P^U:cl=20^P^]:cm=%r^P^Q%.%.:dc=^X:\ :dl=^P^S:ei=^Pi:ho=^P^R:im=^PI:ve=^Pb:vs=^PB:pc=\177:te=20^P^]:\ :li#24:nd=^PR:.se=^P \200:.so=^P \002^PF:us=^P \020:ue=^P \200:\ :up=^P^L:nc:xr:xs:da:db:.pt:cr=^P^M:cd=^P^U^P^S^P^S:\ :if=/usr/lib/tabset/dtc382: Ad|dtc300s|300|300s|dtc 300s:\ :ct=\E3:st=\E1:do=^J:\ :kb=^h:le=^H:bs:co#132:hc:hu=\EH:hd=\Eh:os:pt:up=^Z: Ag|gsi:\ :le=^H:bs:co#132:hc:hd=\Eh:hu=\EH:os:pt:up=^Z:do=^J: # This used to have :pl: - maybe they meant :pt:? Aj|aj830|aj832|aj|anderson jacobson:\ :do=^J:le=^H:bs:hc:hd=\E9:hu=\E8:os:up=\E7: # From Chris Torek Thu, 7 Nov 85 18:21:58 EST AJ|aj510|AJ510|Anderson-Jacobson model 510:\ :ic=:ip=.1*:so=\E"I:us=\E"U:cd=\E'P:ce=\E'L:cl=^L:cm=\E#%+ %+ :\ :dl=2*\E&D:ue=\E"U:co#80:li#24:se=\E"I:al=2*\E&I:im=\E'I:ei=\E'J:\ :dc=.1*\E'D:up=\EY:nd=\EX:bs:am:mi:ti=\E"N:te=\E"N:\ :ku=\EY:kd=\EZ:kl=\EW:kr=\EX:pc=\177: # From cbosg!ucbvax!pur-ee!cincy!chris Thu Aug 20 09:09:18 1981 # This is incomplete, but it's a start. An|5520|nec|spinwriter|nec 5520:\ :ct=\E3:st=\E1:do=^J:kb=^h:le=^H:bs:co#132:hc:hu=\E]s\E9\E]W:\ :hd=\E]s\n\E]W:os:pt:up=\E9: Aq|qume5|qume|Qume Sprint 5:\ :ct=\E3:st=\E1:do=^J:\ :kb=^h:le=^H:bs:co#80:hc:hu=\EH:hd=\Eh:os:pt:up=^Z: Ar|q102|qume102|Qume 102:\ :al=\EE:am:bs:bt=\EI:\ :cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :co#80:ct=\E3:\ :dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:im=:\ :k0=^A@\r:k1=^AA\r:k2=^AB\r:k3=^AC\r:kd=^J:kl=^H:kr=^L:ku=^K:\ :le=^H:li#24:ma=^K^P^L :nd=^L:\ :se=\EG0:sg#1:so=\EG4:st=\E1:\ :ue=\EG0:ug#1:up=^K:us=\EG8: # From ucbvax!mtxinu!sybase!tim (Tim Wood) Fri Sep 27 10:25:24 PDT 1985 # This entry supports line and character insert and delete, scroll up and # down and the arrow keys. To use it, perform the following on your qvt-101 # 1) enter SET-UP mode, select the SET 3 line; # 2) move the cursor to the EMULATION item and hit SPACE # until QVT-101B appears # 3) enter SHIFT-S # 4) exit SET-UP - the terminal is now configured Aq|q101|qvt101|qvt-101|Qume 101 $310 special:\ :al=\EE:am:bt=\EI:ce=\Et:cl=\E*:dc=\EW:\ :dl=\ER:do=^J:ic=\EQ:ei=:im=:md=\E(:me=\EG0:mh=\E):\ :le=^H:bs:cm=\E=%+ %+ :cl=1^Z:co#80:ho=^^:li#24:ma=^K^P:nd=^L:ku=^K:\ :vs=\EM4\040\200\200\200:mr=\EG4:ms:so=\EG4:se=\EG1: # I suspect the xerox1720 is the same as the diablo 1620. Ax|x1720|x1700|1700|x1750|xerox 1720:\ :co#132:le=^H:bs:hc:os:pt:do=^J:ct=\E2:st=\E1: # # -------------------------------- # # B: AT&T ATT # # AT&T Teletype 5410 Terminal (a.k.a. 4410) # From: carvalho%kepler@Berkeley.EDU (Marcio de Carvalho) # Date: Thu, 26 Feb 87 09:16:50 PST # # Although the 5410 supports labels, it blanks the screen after # each label is programmed creating to much visual activity. # To use the labels, use FL=\E[%d;00q%-16s # Ba|5410|4410|tty5410|att4410|AT&T Teletype 5410 terminal with 80 columns:\ :al=\E[L:am:bs:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=5\E[%i%2;%2H:co#80:dc=\E[P:dl=\E[M:im=:ei=:ic=\E[@:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :li#24:nd=\E[C:se=\E[m:so=\E[2;7m:sr=\EM:\ :ue=\E[m:up=\E[A:us=\E[4m:EE=\E[m:BO=\E[0;7m:DS=\E[2m:\ :KM=/usr/lib/ua/kmap.5410:is=\E[0m^O\E[?6l:kn#8:\ :k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k4=\EOg:k6=\EOh:\ :k7=\EOi:k8=\EOj:ko=nd,up,ho: # AT&T Teletype 5420 Terminal (a.k.a. 4415) June 5, 1985 Bb|5420|4415|tty5420|att4415|AT&T Teletype 5420 terminal:\ :al=\E[L:am:bs:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%2;%2H:co#80:dc=\E[P:dl=\E[M:im=\E[4h:ei=\E[4l:\ :kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:\ :li#24:nd=\E[C:se=\E[m:so=\E[2;7m:sr=\EM:\ :ue=\E[m:up=\E[A:us=\E[4m:EE=\E[m:BO=\E[0;7m:DS=\E[2m:\ :KM=/usr/lib/ua/kmap.5420:\ :is=\E[0m^O\E[1;2;3;4;6l\E[12;13;14;20l\E[?6;97;99l\E[?7h\E[4i\Ex\E[25;1j\212\E[8;0j\E[9;0j\E[10;0j\E[19;1j:\ :db:mi:pt:kn#8:k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:\ :k7=\EOi:k8=\EOj:ve=\E[11;0j:\ :vs=\E[11;1j:ko=bt,nd,up,dc,dl,ho,im,al: # AT&T Teletype 5425 Terminal (a.k.a 4425) June 5, 1985 Bc|5425|4425|tty5425|att4425|AT&T Teletype 5425:\ :FL=\E[%d;00q%-16s\E~:FE=\E|:KM=/usr/lib/ua/kmap.5425:\ :is=\E[0m^O\E[1;2;3;4;6l\E[12;13;14;20l\E[?6l\E[?7h\E[4i\E[9;0j\E[10;0j\E[11;0j\E[21;1j\E[25;1j\212:\ :ve=\E[12;0j:vs=\E[12;1j:tc=5420: Bd|t4|4420|tty4420|Teletype 4420:\ :vs=\ER:ve=\ER:am:da:db:mi:cr=\EG:\ :im=:ei=:dm=:ed=:nl=\EG\EB:li#23:\ :co#80:cl=\EH\EJ:cd=\EJ:cm=\EY%+ %+ :\ :bs:up=\E7:do=\EB:nd=\EC:al=\EL:\ :dl=\EM:dc=\EP:ic=\E\136:sf=\EH\EM\EY5 :sr=\ET:kb=^H: Be|pc6300plus|6300|6300plus:\ :al=\E[1L:am:bs:cd=\E[0J:ce=\E[0K:cl=\E[2J\E[H:cm=\E[%i%2;%2H:co#80:\ :dc=\E[1P:dl=\E[1M:do=\E[B:ei=:ho=\E[H:\ :ic=\E[1@:im=:kb=\10:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:li#24:\ :k1=\EOc:k2=\EOd:k3=\EOe:k4=\EOf:k5=\EOg:k6=\EOh:k7=\EOi:k8=\EOj:\ :k9=\EOk:k10=\EOu:nd=\E[C:se=\E[m:so=\E[7m:ue=\E[m:up=\E[A:us=\E[4m:\ :EE=\E[m:BO=\E[0;7m:CV=\E[=C:CI=\E[=1C:KM=/usr/lib/ua/kmap.s5: Bf|s4|PC7300|unixpc|pc7300|7300|3b1|Safari 4:\ :so=\E[2;7m:DS=\E[2m:XS=\E[9m:KM=/usr/lib/ua/kmap.s4:tc=pc6300plus: # AT&T Teletype 610 Terminal Bg|b610|610|610bct|tty610:\ :CV=\E[25h:CI=\E[25l:KM=/usr/lib/ua/kmap.s4:\ :FL=\E[%d;00q%-16s\E[0p:FE=\E[2p:cl=\E[1;1H\E[J:\ :is=\E[0m^O\E[25;1|^J\E[8;0|\E[4;13;20l\E[?5l\E[12h\E[?7h\E[?4i:\ :ve=\E[?12l:vs=\E[?12h:tc=5420: # # -------------------------------- # # C: CONTROL DATA # Ca|cdc456|cdc:\ :do=^J:li#24:co#80:cl=^Y^X:nd=^L:up=^Z:le=^H:bs:\ :cm=\E1%+ %+ :ho=^Y:al=\E\114:dl=\E\112:ce=^V:cd=^X:am: Cc|cdc456tst:\ :do=^J:li#24:co#80:cl=^y^x:le=^H:bs:cm=\E1%+ %+ :am: # # -------------------------------- # # D: DATAMEDIA # D0|dm1520|dm1521|1521|1520|datamedia 1520:\ :do=^J:am:le=^H:bs:cd=^K:ce=^]:cl=^L:cm=^^%r%+ %+ :co#80:ho=^Y:\ :ku=^_:kd=^J:kl=^H:kr=^\:kh=^Y:\ :li#24:nd=^\:up=^_:xn:ma=^\ ^_^P^YH:pt: D2|dm2500|datamedia2500|2500|datamedia 2500:\ :do=^J:al=15^P\n^X^]^X^]:le=^H:bs:ce=^W:cl=^^^^\177:\ :cm=^L%r%n%.%.:co#80:dc=10*^P\b^X^]:dl=10*^P^Z^X^]:\ :dm=^P:ed=^X^]:ei=10\377\377^X^]:ho=^B:ic=10*^P^\^X^]:\ :im=^P:li#24:nc:nd=^\:pc=\377:so@=^N:se=^X^]:up=^Z: D3|dm3025|datamedia 3025a:\ :MT:is=\EQ\EU\EV:do=^J:\ :al=130\EP\n\EQ:le=^H:bs:cd=2\EJ:ce=\EK:cl=2\EM:cm=\EY%r%+ %+ :\ :co#80:dc=6\b:dl=130\EP\EA\EQ:dm=\EP:ed=\EQ:ei=\EQ:ho=\EH:\ :im=\EP:ip=6:li#24:nd=\EC:pt:so=\EO1:se=\EO0:up=\EA: D4|3045|dm3045|datamedia 3045a:\ :is=\EU\EV:do=^J:\ :am:le=^H:bs:cd=2\EJ:ce=\EK:cl=2\EM:cm=\EY%r%+ %+ :co#80:\ :dc=6\EB:dm=:ed=:ei=\EP:ho=\EH:ic=:im=\EP:ip=6:\ :k0=\Ey\r:k1=\Ep\r:k2=\Eq\r:k3=\Er\r:k4=\Es\r:\ :k5=\Et\r:k6=\Eu\r:k7=\Ev\r:k8=\Ew\r:k9=\Ex\r:\ :kh=\EH:ku=\EA:kr=\EC:li#24:nd=\EC:pc=\177:pt:eo:ul:up=\EA:xn: # dt80/1 is a vt100 lookalike, but it doesn't seem to need any padding. D5|dt80|dmdt80|dm80|datamedia dt80/1:\ :do=^J:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:cm=%i\E[%d;%dH:ho=\E[H:\ :nd=\E[C:sr=\EM:so=\E[7m:se=\E[m:up=\E[A:us=\E[4m:ue=\E[m:tc=vt100: # except in 132 column mode, where it needs a little padding. # This is still less padding than the vt100, and you can always turn on # the ^S/^Q handshaking, so you can use vt100 flavors for things like # reverse video. D6|dt80w|dmdt80w|dm80w|datamedia dt80/1 in 132 char mode:\ :do=^J:cd=20\E[0J:co#132:ce=20\E[0K:\ :cm=5\E[%i%d;%dH:cl=50\E[H\E[2J:up=5\E[A:tc=dmdt80: # # -------------------------------- # # H: HAZELTINE # # Since nd is blank, when you want to erase something you # are out of luck. You will have to do ^L's a lot to # redraw the screen. h1000 is untested. It doesn't work in # vi - this terminal is too dumb for even vi. (The code is # there but it isn't debugged for this case.) H1|h1000|hazeltine 1000:\ :le=^H:bs:ho=^K:cl=^L:nd= :co#80:li#12:do=^J: # Note: the h1552 appears to be the first Hazeltine terminal which # is not braindamaged. It has tildes and backprimes and everything! # Be sure the auto lf/cr switch is set to cr. H2|h1552|hazeltine 1552:\ :do=^J:al=\EE:dl=\EO:k1=\EP:l1=blue:k2=\EQ:\ :l2=red:k3=\ER:l3=green:tc=vt52: H3|h1552rv|hazeltine 1552 reverse video:\ :do=^J:so=\ES:se=\ET:tc=h1552: # From cbosg!ucbvax!pur-ee!cincy!chris Thu Aug 20 09:09:18 1981 H4|h1420|hazeltine 1420:\ :do=^J:le=^H:bs:am:li#24:co#80:al=\E^Z:dl=\E^S:cd=\E^X:cl=\E\034:\ :up=\E^L:nd=^P:ce=\E^O:ta=^N:cm=\E^Q%r%.%+ :so=\E\037:se=\E^Y: H5|h1500|hazeltine 1500:\ :do=^J:al=40~^Z:am:le=^H:bs:cd=10~^X:ce=~^O:cl=~^\:cm=~^Q%r%.%.:\ :co#80:dl=40~^S:do=~^K:hz:li#24:nd=^P:.se=~^_:.so=~^Y:up=~^L: # h1510 assumed to be in sane escape mode. Else use h1500. H6|h1510|hazeltine 1510:\ :do=^J:al=\E^Z:am:le=^H:bs:cd=\E^X:ce=\E^O:cl=\E^\:cm=\E^Q%r%.%.:\ :co#80:dl=\E^S:do=\E^K:hz:li#24:nd=^P:.se=\E^_:.so=\E^Y:up=\E^L: H8|h1520|hazeltine 1520:\ :do=^J:al=~^Z:am:le=^H:bs:cd=~^X:ce=~^O:cl=~\034:cm=~^Q%r%.%.\200:\ :co#80:dl=~^S:do=~^K:hz:li#24:nd=^P:se=~^Y:so=~\037:up=~^L:ho=~^R: # Note: h2000 won't work well because of a clash between upper case and ~'s. H7|h2000|hazeltine 2000:\ :do=^J:al=6~^z:am:le=^H:bs:cl=6~^\:cm=~^q%r%.%.:co#74:\ :dl=6~^s:ho=~^r:li#27:nc:pc=\177: # Hazeltine esprit entries from Univ of Utah Tue Feb 1 06:39:37 1983 # J.Lepreau, lepreau@utah-cs, harpo!utah-cs!lepreau HE|esprit|hazeltine esprit:\ :al=40\E^Z:bs:cd=5\E^X:ce=\E^O:cl=\E^\:cm=\E^Q%r%>^^ %+`%+`:co#80:\ :dl=40\E^S:do=\E^K:ho=\E^R:li#24:nd=^P:se=\E^Y:so=\E^_:up=\E^L: HF|esprit-am|hazeltine esprit auto-margin:\ :am:tc=esprit: # # -------------------------------- # # I: IBM # # ibm61 and ibm63 from Warren Gish (cswarren@violet.berkeley.edu). # installed 12-17-86. # 3161 only opens a new line if a null line exists on the screen. # To ensure a null line exists, an SBA is performed, positioning the # Buffer Address in column 0 of the last line. The last line is then # cleared to nulls, BA mode is cancelled, and the new line is opened # at the cursor position. I1|ibm61|ibm3161|3161|IBM 3161-11:\ :am:bs:bw:cl=\EL:li#24:co#80:cd=\EJ:al=\EX7 \EI\E Z\EN:\ :ce=\EI:cm=\EY%+\040%+\040:nd=\EC:up=\EA:do=\EB:\ :dl=\EO:dc=\EQ:kd=\EB:ku=\EA:kl=\ED:kr=\EC:kh=\EH:\ :us=\E4\102:ue=\E4\100:so=\E4\110:se=\E4\100: I3|ibm63|ibm3163|3163|i3163|IBM 3163:\ :tc=ibm61: I4|ibm|ibm3101|3101|i3101|IBM 3101-10:\ :do=^J:ct=\EH:st=\E0:\ :if=/usr/lib/tabset/ibm3101:\ :am:le=^H:bs:cl=\EK:li#24:co#80:nd=\EC:up=\EA:cd=\EJ:ce=\EI:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:ho=\EH:cm=\EY%+\40%+\40:pt: Ia|ibm-apl|apl|IBM apl terminal simulator:\ :li#25:tc=dm1520: # ibmapa* and ibmmono entries come from ACIS 4.3 distribution Ib|rtpc|ibmapa16|ibm6155|IBM 6155 Extended Monochrome Graphics Display:\ :ts=\Ej\EY@%+ \Eo:ds=\Ej\EY@\40\EI\Ek:li#32:tc=ibmconsole: # Advanced Monochrome (6153) and Color (6154) Graphics Display: Ic|ibmapa8c|ibmapa8|ibm6154|ibm6153|IBM 6153/4 Advanced Graphics Display:\ :ts=\Ej\EY?%+ \Eo:ds=\Ej\EY?\40\EI\Ek:li#31:tc=ibmconsole: Id|ibmapa8c-c|ibm6154-c|IBM 6154 Advanced Color Graphics Display color termcap:\ :ts=\Ej\EY?%+ \Eo:ds=\Ej\EY?\40\EI\Ek:li#31:mh=\EF\Ef7;:tc=ibmega-c: Ie|ibmmono|ibmconsole|ibm5151|IBM workstation monochrome:\ :se=\Ez:so=\EZ:sr=\EA:al=\EL:dl=\EM:\ :kb=^H:us=\EW:ue=\Ew:\ :k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:k6=\EP:k7=\EQ:k8=\ER:k9=\EY:\ :k0=\E<:I0=f10:kI=\000:kh=\EH:kR=\EG:kP=\Eg:kF=\EE:kN=\EE:\ :md=\EZ:me=\Ew\Eq\Ez\EB:mk=\EF\Ef0;\Eb0;:mr=\Ep:\ :ts=\Ej\EY8%+ \Eo:fs=\Ek:ds=\Ej\EY8\40\EI\Ek:es:hs:sb:tc=ibm3101: If|ibmega-c|ibm5154-c|IBM Enhanced Color Display color termcap:\ :se=\EB:so=\EF\Ef3;:ue=\EB:us=\EF\Ef2;:tc=ibmconsole: # # -------------------------------- # # M: MISCELLANEOUS TERMINALS # # The tab 132 uses xon/xoff, so no padding needed. # ks/ke have nothing to do with arrow keys. # is sets 80 col mode, normal video, autowrap on (for am). # Seems to be no way to get rid of status line. M0|abm80|amtek business machines 80:\ :do=^J:al=\E^Z:am:le=^H:bs:cd=\E^X:ce=\E^O:cl=\E^\:cm=\E^Q%r%+ %+ :\ :co#80:dl=\E^S:do=\E^K:li#24:nd=^P:.so=\E^_:.se=\E^Y:up=\E^L:\ :bw:bt=^T:ho=\E^R: M1|tab132|tab|tab132/15|tab 132/15:\ :is=\E[?7h\E[?3l\E[?5l:dN@:ks@:ke@:do=^J:\ :da:db:al=\E[L:dl=\E[M:dc=\E[P:ei=\E[4l:im=\E[4h:cm=\E[%i%d;%dH:\ :ku=\E[A:kd=\E[B:kl=\E[D:tc=vt100: M2|tab132w:\ :co#132:is=\E[?7h\E[?3h\E[?5l:tc=tab132: M3|tab132rv:\ :is=\E[?7h\E[?3l\E[?5h:tc=tab132: M4|tab132wrv:\ :is=\E[?7h\E[?3h\E[?5h:tc=tab132w: # This used to say "de#001202" which presumably refers to the stty bits # that need to be set for some version of Unix. We need the real delay # requirements in MS. M5|mw2|Multiwriter 2:\ :do=^J:co#132:hc:os: M6|trs80|trs-80|radio shack trs-80 Model I:\ :do=^J:am:le=^H:bs:co#64:li#16: M7|d800|Direct 800/A:\ :do=^J:co#80:li#24:am:cl=\E[1;1H\E[2J:le=^H:bs:cm=\E[%i%d;%dH:\ :nd=\E[C:up=\E[A:ce=\E[K:cd=\E[J:\ :so=\E[7m:se=\E[0m:us=\E[4m:ue=\E[0m:xs:vs=\E[>12l:ve=\E[>12h:\ :sf=\ED:sr=\EM:da:db:as=\E[1m:ae=\E[0m:ms:pt:\ :kl=\E[D:kr=\E[C:ku=\E[A:kd=\E[B:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\EOT:k6=\EOU:k7=\EOV:k8=\EOW: M8|vc404|volker-craig 404:\ :do=^J:am:le=^H:bs:cd=40^W:ce=20^V:cl=40^X:cm=^P%+ %+ :co#80:\ :ho=40^Y:kd=^J:kl=^H:kr=^U:ku=^Z:li#24:ma=^Z^P^U :nd=^U:up=^Z: M9|vc404-s|volker-craig 404 w/standout mode:\ :do=^J:se=^O:so=^N:tc=vc404: MA|vc404-na|volker-craig 404 w/no arrow keys:\ :ma@:kr@:ku@:tc=vc404: MB|vc404-s-na|volker-craig 404 w/standout mode and no arrow keys:\ :se=^O:so=^N:tc=vc404-na: # missing in vc303a and vc303 descriptions: they scroll 2 lines at a time MC|vc303a|vc403a|volker-craig 303a:\ :do=^J:am:le=^H:bs:ce=20^V:cl=40^X:co#80:ho=40^Y:kd=^J:kl=^H::kr=^U:\ :ku=^Z:li#24:ll=^P^@W:nd=^U:ns:up=^Z: MD|vc303|vc103|vc203|volker-craig 303:\ :do=^J:am:le=^H:bs:cl=40^L:co#80:ho=40^K:kd=^J:kl=^H:\ :kr=^I:ku=^N:li#24:ll=^O\200W:nd=^I:ns:up=^N: # Test version for Falco ts-1. See "arpavax.hickman@ucb" for info ME|falco|ts1|ts-1|falco ts-1:is=\Eu\E3:\ :do=^J:al=\EE:am:bs:ce=\ET\EG0^h:cm=\E=%+ %+ :cl=\E*:cd=\EY:co#80:\ :dc=\EW:dl=\ER:ei=\Er:ho=^^:im=\Eq:k0=^A0\r:kd=^J:kl=^H:pt:\ :kr=^L:ku=^K:li#24:nd=^L:se=\Eg0:so=\Eg1:up=^K:us=\Eg1:ue=\Eg0: MF|falco-p|falco ts-1sp|falco with paging option:\ :is=\EZ\E3\E_c:\ :al=\EE:am:bs:ce=\ET\EG0^H\Eg0:cl=\E*:cd=\EY:co#80:dc=\EW:\ :dl=\ER:kd=\E[B:kl=\E[D:ei=\Er:im=\Eq:pt:db:\ :kr=\E[C:ku=\E[A:li#24:nd=\E[C:se=\Eg0:so=\Eg4:\ :up=\E[A:us=\Eg1:ti=\E_d:te=\E_b:\ :ue=\Eg0:do=\E[B:cm=\E=%+ %+ :ms:kh=\E[H:da:mi:bt=\EI: #NOTE: bg can scroll, it just would rather not (ns) - rwells 3/13/81. # (Shouldn't you take out ns and put in an nl instead? - mrh) MG|bg|bitgraph|BBN BitGraph terminal:\ :do=^J:al=2*\E[L:bs:cd=150\E[J:ce=2\E[K:\ :cl=150\E[H\E[J:cm=%i\E[%d;%dH:co#85:\ :dl=2*\E[M:k0=\EP:k1=\EQ:k2=\ER:k3=\ES:kd=\EB:ke=\E>:kl=\ED:kr=\EC:\ :ks=\E=:ku=\EA:li#64:nd=\E[C:ns:pt:se=\E[0m:so=\E[7m:up=\E[A:sf=280\n: MH|d132|datagraphix|datagraphix 132a:\ :do=^J:co#80:li#30:cl=^l:ho=\Et:da:db:sf=\Ev:sr=\Ew:\ :up=\Ek:nd=\El:vs=\ex:ve=\Em\En:\ :al=\E3:ic=\E5:dc=\E6:in:ic=\E5: MI|soroc|Soroc 120:\ :do=^J:cd=\EY:ce=\ET:cl=2\E*:ma=^K^P^R^L^L :\ :kl=^H:ku=^K:kr=^L:kd=^J:tc=adm3a: # From: ma179abu%sdcc3@sdcsvax.ucsd.edu (Bill Houle) MI|iq140|soroc140|Soroc IQ140 with inverse & dim:\ :ic=\EQ:dc=\EW:al=\EE:dl=\ER:ce=\ET:cd=\EY:cl=\E+:cm=\E=%+ %+ :\ :up=^K:do=^J:le=^H:nd=^L:ho=^^:ta=\Ei:ma=^Kk^Jj^Hh^Ll^^h:am:bs:\ :co#80:li#24:ei=:im=:kb=^H:kh=^^:ku=^K:kd=^J:kl=^H:kr=^L:\ :k0=^AI:k1=^A@:k2=^AA:k3=^AB:k4=^AC:k5=^AD:k6=^AE:k7=^AF:\ :k8=^AG:k9=^AH:se=\E:so=\E:us=\E):ue=\E(: # tec is untested, and taken from CB/Unix virtual terminal driver. # Upper case terminal, uses lower case for control sequences!!! # The driver shows the C ~ operator used on CM coordinates. # Without the terminal in front of me, I can't figure out what's # going on, so I've dotted out the cm. Note there is no ~ in tgoto. MJ|tec400|tec scope:\ :do=^J:.cm=l%r%.%.:up=x:do=h:nd=g:le=w:ho=i:so={:se=|:sg#1:\ :cl=f:al=e:dl=u:ic=d:dc=t:ce=c:cd=s: # From ucbvax!geoff Mon Sep 21 21:15:45 1981 # This entry has been tested. MK|tec500|tec 500:\ :do=^J:am:le=^H:bs:cm=\E=%+ %+ :cl=20^Z:\ :co#80:ho=^^:li#24:nd=^L:up=^K:so=^]:se=^\: # I would appreciate more information on this terminal, such as the # manufacturer and the model number. There are too many tecs in here. ML|tec:\ :li#24:co#80:cl=^l:up=^k:nd=\037:\ :am:le=^H:bs:ho=\036:ma=^K^P^_ :do=^J: MM|teletec|Teletec Datascreen:\ :do=^J:am:le=^H:bs:co#80:cl=^l:ho=^^:li#24:nd=^_:up=^k: # From cbosg!ucbvax!SRC:george Fri Sep 11 22:38:32 1981 MN|ampex|d80|dialogue|dialogue80|ampex dialogue 80:\ :ct=\E3:st=\E1:do=^J:is=\EA:us=\El:ue=\Em:\ :am:le=^H:bs:pt:cl=75\E*:cm=\E=%+ %+ :\ :al=5*\EE:bt=\EI:ic=\EQ:im=:ei=:dl=5*\ER:dc=\EW:\ :ce=\Et:cd=\Ey:so=\Ej:se=\Ek:li#24:co#80:nd=^L:up=^K: # From: atd!dsd!rcb@ucbvax.berkeley.edu (Richard Bascove) A2|a210|210|ampex210|ampex a210:\ :am:bs:cl=\E*:cm=\E=%+ %+ :al=\EE:bt=\EI:ic=\EQ:im=:ei=:\ :dl=\ER:dc=\EW:ho=^^:xn:ce=\Et:cd=\Ey:li#24:co#80:nd=^L:up=^K:\ :pt:if=/usr/lib/tabset/std:is=\EC\Eu\E'\E(\El\EA\E%\E{\E.2\EG0\Ed\En:\ :kl=^H:kr=^L:kd=^V:ku=^K:kh=^^:hs:ts=\E.0\Eg\E}\Ef:fs=\E.2:\ :kn#10:k0=^A0^M:k1=^A1^M:k2=^A2^M:k3=^A3^M:k4=^A4^M:k5=^A5^M:\ :vb=\EU\EX\EU\EX\EU\EX\EU\EX:k6=^A6^M:k7=^A7^M:k8=^A8^M:k9=^A9^M:\ :so=\EG4:se=\EG0:us=\EG8:ue=\EG0:ug#1:sg#1: MO|digilog|333|digilog 333:\ :le=^H:bs:co#80:ce=\030:ho=^n:li#16:nd=^i:up=^o:do=^J: MP|ep48|ep4080|execuport 4080:\ :am:le=^H:bs:os:co#80:hu=\036:hd=\034:do=^J: MQ|ep40|ep4000|execuport 4000:\ :am:le=^H:bs:os:co#136:hu=\036:hd=\034:do=^J: MR|terminet1200|terminet300|tn1200|tn300|terminet|GE terminet 1200:\ :co#120:hc:os:do=^J: # AED 512 # by giles Billingsley (gilesb%ucbcad@berkeley) # rewritten 8/82 for newer AEDs and better operation of vi,etc. MS|aed|AED|aed512|AED512|aed 512:\ :db:co#64:li#40:cl=^L:bs:nd=\Ei0800\001:\ :up=^K:ve=\E\E\E\E\E\E\E\072004=000200??\001:\ :vb=\EK0001??0000K0001202080\001:\ :us=\E\07200>8000140\001:ue=\E\07200>8000100\001:\ :uc=\Ei???>l0800i0102\001:\ :ti=\E\07200>8000140{<04<0??00001010L<0\072004=0002??00\001:\ :te=\E\07200>8000100{804<0??00001000L80\072004=000200??\001:\ :so=\E\07200>8000140[80C00\001:se=\E[00C80\001:\ :is=\EG1MMM.`40K0001202080K8001????00^L\EC80L80{80^L\EK010100????K060\ 1??0000c818100\EG1HHH.\07210000019A27FD006A280D002A200A52429FE852486108611861\ 2861360N031B4C3F3F1800N041B0C1B4C38301800N001B3B313030301800N011B3B3130303418\ 00N021B3B313030381800N050800N061B3B313335301800\07211000015A58E8D5011A58F8D51\ 11A5908D5211A5918D531160\07212000015AD5011858EAD5111858FAD52118590AD531185916\ 0\0721300004B2071C5858E0A18658E0A0A858EA900858F268FA5278590A50A29018591A9F518\ 65908590A90165918591A59038E58E8590A591E58F290185912071C5180A0A0A0901858EA9008\ 58F268F60\0721350000BA9472031DEA9502031DE60\E\E\E\EG1MMM.^A: zL|aed-ucb|AED-UCB|aed512-ucb|AED512-UCB|aed 512 w/o UCB ROM:\ :db:co#64:li#40:cl=^L:bs:nd=\Ei0800\001:up=^K:\ :ve=\E\E\E\E\E\E\E\072004=000200??\001:\ :vb=\EK0001??0000K0001202080\001:\ :us=\E\07200>8000140\001:ue=\E\07200>8000100\001:\ :uc=\Ei???>l0800i0102\001:\ :ti=\E\07200>8000140{<04<0??00001010L<0\072004=0002??00\001:\ :te=\E\07200>8000100{804<0??00001000L80\072004=000200??\001:\ :so=\E\07200>8000140[80C00\001:se=\E[00C80\001:\ :if=/usr/lib/tabset/aed512: # CIT 80 - vt 100 emulator, the termcap has been modified to remove # the delay times and do an auto tab set rather than the indirect # file used in vt100. MT|cit80|cit 80|Citoh 80:\ :co#80:li#24:am:cl=\E[;H\EJ:bs:cm=\E[%i%2;%2H:nd=\E[C:up=\E[A:\ :ce=\EK:cd=\EJ:is=\E>:ks=\E[?1h\E=:ke=\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD: # From mtxinu!sybase!tim (Tim Wood) Fri Sep 27 09:39:12 PDT 1985 # Alternate cit101 (vt100 em) file used in vt100. # Uses 23 lines so can run citsys (like h19sys). # 24 May 85 (mtxinu!sybase!tim) - removed 2-byte limit on 'cm' cursor # coordinates otherwise there is garbling on long lines in # co#132 mode; also added support for multipage memory on the Itoh. MU|citc|Citoh fast vt100:\ :co#80:li#23:am:cl=\E[;H\E[2J:bs:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[3g\E[>5g:\ :ks=\E[?1h\E=:ke=\E[?1l\E>:ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:\ :vb=\E[?5h\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\E[?5l:\ :dc=\E[P:al=\E[L:im=:ei=:dl=\E[M:ic=\E[@:vs=\E7\E[U:ve=\E[V\E8:xn: MV|cita|:\ :co#80:li#23:am:cl=\E[;H\E[2J:bs:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[3g\E[>5g:\ :ks=\E[?1h\E=:ke=\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:vs=\E7\E[U:ve=\E[V\E8:\ :vb=\E[?5h\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\E[?5l:xn: MW|cit101:li#24:vb@:tc=citc MX|cit101b:li#24:tc=citc Mh|cit500|cit-500|cit 500:\ :co#80:li#40:cl=50\E[;H\E[2J:bs:am:cm=5\E[%i%2;%2H:nd=2\E[C:up=2\E[A:\ :ce=3\E[K:cd=50\E[J:so=2\E[7m:se=2\E[m:us=2\E[4m:ue=2\E[m:\ :is=\E(B\E)0\E>\E[?3l\E[?7h\E[?8h:ks=\E[?1h\E=:ke=\E[?1l\E>:\ :if=/usr/lib/tabset/vt100:ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:\ :kh=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:pt:sr=5\EM:xn:\ :do=\ED:al=\E[L:dc=\E[P:dl=\E[M: # Note several versions of blit. I don't know exactly what is what # so please send me any corrections to this -- mrh # From research!ikeya!rob Tue Aug 31 23:41 EDT 1982 MY|blit|jerq|blit-pb|blit running teletype rom:\ :do=^J:IC=\Ef%+ :DC=\Ee%+ :AL=\EF%+ :DL=\EE%+ :\ :mi:dl=\EE!:ic=\Ef!:dc=\Ee!:al=\EF!:\ :ce=\EK:cl=^L:cm=\EY%r%+ %+ :co#87:li#72:nd=\EC:\ :up=\EA:ku=\EA:kd=\EB:kr=\EC:kl=\ED:kb=^H:am:ul:pt:eo: MZ|cbblit|columbus enhanced tty blit:\ :vb=\E^G:so=\EU!:se=\EV!:us=\EU":ue=\EV":cd=\EJ:\ :im=\EQ:ei=\ER:ic@:co#88:sf=\EG:tc=blit: Ma|oblit|ojerq|first version of blit rom:\ :do=^J:AL=\Ef%+ :DL=\Ee%+ :mi:dl=\EE:ei=\ER:im=\EQ:dc=\EO:da:db:\ :al=\EF:cd=\EJ:ce=\EK:cl=^L:cm=\EY%r%+ %+ :co#88:li#72:nd=\EC:\ :up=\EA:vb=\E^G:am:ul:pt:eo: Mb|daleblit|daleterm|blit running Dale DeJager's ROM:\ :ku=\EA:kd=\EB:kr=\EC:kl=\ED:so=\EU!:se=\EV!:us=\EU":ue=\EV":\ :da@:db@:tc=oblit: Mc|datapoint|dp3|dp3360|datapoint 3360:\ :do=^J:am:le=^H:bs:cd=^_:ce=^^:cl=^]^_:co#82:ho=^]:li#25:nd=^x:up=^z: #From: cbosgd!utcs!romwa@ucbvax.berkeley.edu (mark dornfeld) # This termcap is for the LANPAR Technologies VISION 3220 # terminal. The function key definitions k0-k5 represent the # edit keypad: FIND, INSERT HERE, REMOVE, SELECT, PREV SCREEN, # NEXT SCREEN. The key definitions k6-k9 represent the PF1 to # PF4 keys. v0|v3220|LANPAR Vision II model 3220/3221/3222:\ :co#80:li#24:cl=\E[H\E[J:bs:am:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :is=\E>\E[?3l\E[?7h\E[?8h\E[p:ks=\E=:ke=\E>:\ :kn#10:k0=\E[1~:k1=\E[2~:k2=\E[3~:k3=\E[4~:k4=\E[5~:k5=\E[6~:\ :k6=\E[OP:k7=\E[OQ:k8=\E[OR:k9=\E[OS:\ :ku=\E[A:kd=\E[B:kr=\E[C:kl=\E[D:\ :kh=\E[H:pt:sr=\EM:xn:\ :dl=\E[M:dc=\E[P:ei=\E[4l:al=\E[L:im=\E[4h:mi: # From ucbvax!faletti (Faletti@Berkeley) # FREEDOM 100 by Liberty Electronics USA, SF. # :kh=^^: left out because it precludes using change-to-alternate-file in vi. # Basic Freedom 100 entry, works with VI at 1200 baud. Md|f100|freedom100|freedom|freedom 100 no padding:\ :am:bs:bw:mi:ms:pt:co#80:kn#20:li#24:\ :ct=\E3:st=\E1:is=\Eg\Ef\r\Ed:kr=^L:\ :cl=^Z:do=^J:ho=^^:kb=^H:kl=^H:\:kd=^V:\ :ko=dc,al,dl,cl,bt,ce,cd:ku=^K:le=^H:nd=^L:\ :ch=\E]%+ :cm=\E=%+ %+ :cv=\E[%+ :sr=\Ej:up=^K:\ :al=\EE:bt=\EI:cd=\EY:ce=\ET:dc=\EW:dl=\ER:ei=\Er:im=\Eq:\ :se=\EG0:so=\EG4:ue=\EG0:us=\EG8:as=\E$:ae=\E%:\ :vb=\Eb\200\200\Ed:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k0=^AI\r:\ :hs:ts=\Eg\Ef:fs=\r:ds=\Eg\Ef\r: Me|f100-rv|freedom100-rv|freedom-rv|freedom100 with reverse video at 1200:\ :is=\Eg\Ef\r\Eb:vb=\Ed\200\200\Eb:tc=freedom100: # VI at 9600 baud (or EMACS at 1200 -- but may be more than is needed for emacs) Mf|f100-v|freedom100-v|freedom-v|freedom100 for 9600 vi or 1200 emacs:\ :al=6.5*\EE:dl=11.5*\ER:\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :tc=freedom100: Mx|f100-v-rv|freedom100-v-rv|freedom-v-rv|freedom100 rev. vid. for 9600 vi:\ :al=6.5*\EE:dl=11.5*\ER:is=\Eg\Ef\r\Eb:\ :vb=\Ed\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Eb:\ :tc=freedom100: # EMACS at 9600 baud -- this still needs some more work on the padding My|f100-e|freedom100-e|freedom-e|freedom100 for 9600 emacs:\ :al=8.5*\EE:dl=11.5*\ER:ip=6:\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :tc=freedom100: Mz|f100-e-rv|freedom100-e-rv|freedom-e-rv|freedom100 rev. vid. for emacs 9600:\ :al=8.5*\EE:dl=11.5*\ER:ip=6:is=\Eg\Ef\r\Eb:\ :vb=\Ed\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Eb:\ :tc=freedom100: zM|f110-v|freedom110-v|freedom110 for 9600 vi or 1200 emacs:\ :is=\Eg\Ef\r\Ed\EO:dc=\EO\EW:im=\EO\Eq:\ :al=6.5*\EE:dl=11.5*\ER:\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :tc=freedom100: # (from kerch@lll-crg) Q1|f200|freedom200| Freedom 200 VDT by Liberty Electronics :\ :if=/usr/lib/tabset/stdcrt:al=\EE:am:bs:bt=\EI:cd=\EY:\ :ce=\ET:cl=^Z:cm=\E=%+ %+ :co#80:dc=\EW:dl=\ER:do=^V:\ :ds=\Eh:ei=\Er:im=\Eq:is=\Eg\El\E\041\062:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AE\r:k8=^AF\r:k9=^AG\r:kd=^V:kr=L:\ :ku=^K:li#24:ms:nd=^L:se=\EG0:so=\EG4:sr=\Ej:\ :te=\EJ\E\\2\E|\041\061^L^Y:ti=\E\\1\EK\E|\041\061L^Y:\ :ts=\Ef:ue=\EG0:up=^K:us=\EG8:vb=\Eb\Ed:hs:i2=\E^O\Eg:\ :ts=\Ef:fs=^M:ds=\E^N: Mg|dg|dg6053|data general 6053:\ :do=^J:am:le=^H:bs:cm=^P%r%.%.:cl=^L:ho=^H:nd=^S:\ :up=^W:ce=^K:co#80:li#24: # dg450 and dg200 from cornell Mj|dg450|dg6134|data general 6134:\ :nd=\030:bs@:tc=dg200: Mk|dg200|data general Dasher 200:\ :am:bc=^Y:bs=0:ce=^K:cl=^L:cm=^P%r%+\200%+\200:co#80:do=^Z:\ :ho=^H:li#24:\ :ll=\036FP0017:se=\036E:so=\036D:up=^W:\ :is=\036O\036FQ2\036FB000\036FE\036FA\036FQ2: # Note: lesser Dasher terminals will not work with vi because vi insists upon # having a command to move straight down from any position on the bottom line # and scroll the screen up, or a direct vertical scroll command. The 460 and # above have both, the D210/211, for instance, has neither. We must use ANSI # mode rather than DG mode because standard UNIX tty drivers assume that ^H is # backspace on all terminals. This is not so in DG mode. zF|dg460-ansi|Data General Dasher 460, ANSI-mode:\ :al=\E[L:am:bs:cd=\E[J:ce=\E[K:cl=\E[2J:\ :cm=\E[%i%2;%2H:co#80:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=:ho=\E[H:ic=\E[@:im=:ue=\E[05:ul:up=\E[A:us=\E[4m:is=\036F@:\ :k0=\E[001z:k1=\E[002z:k2=\E[003z:k3=\E[004z:k4=\E[005z:k5=\E[006z:\ :k6=\E[007z:k7=\E[008z:k8=\E[009z:k9=\E[00\:z:\ :kb=\E[D:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:kn#6:\ :l0=f1:l1=f2:l2=f3:l3=f4:l4=f5:l5=f6:l6=f7:l7=f8:l9=f10:\ :le=^H:li#24:mb=\E[5m:me=\E[0m:mh=\E[2m:mr=\E[7m:ms:mu=\EW:\ :nd=\E[C:nl=\ED:pt:se=\E[0m:sf=\E[S:so=\E[7m:sr=\E[T: Mi|cdi|cdi1203:\ :am:le=^H:bs:hc:os:co#80:dC#200:do=^J: # ^S is an arrow key! Boy is this guy in for a surprise on v7! Ml|sol:\ :do=^J:am:le=^Y:ho=^H:bs:cm=\E^1%.\E^2%.:cl=^K:ho=^N:co#64:li#16:\ :nd=^S:up=^W:kl=^A:kr=^S:ku=^W:kd=^Z:ma=^A^H^S ^W^P^Z^N: Mn|xl83|Cybernex XL-83:\ :do=^J:am:le=^H:bs:cd=62^P:ce=3^O:cl=62^L:cm=^W%+ %+ :co#80:ho=^K:\ :kd=^J:kl=^H:ku=^N:li#24:up=^N:nd=^I: Mo|omron|Omron 8025AG:\ :do=^J:al=\EL:am:le=^H:bs:cd=\ER:co#80:ce=\EK:cl=\EJ:\ :da:db:dc=\EP:dl=\EM:ho=\EH:li#24:nd=\EC:se=\E4:sf=\ES:\ :so=\Ef:sr=\ET:up=\EA:ve=:vs=\EN: Mp|plasma|plasma panel:\ :am:le=^H:bs:cl=^L:co#85:ho=^^:li#45:nd=\030:up=\026:do=^J: Mq|pty|psuedo teletype:\ :do=^J:co#80:li#24:am:cl=\EJ:le=^H:bs:cm=\EG%+ %+ :nd=\EC:\ :up=\EA:ce=\EK:cd=\EL:al=\EP:dl=\EN:ic=\EO:\ :so=\Ea$:se=\Eb$:us=\Ea!:ue=\Eb!: Mr|remote|virtual remote terminal:\ :co#79:am@:nl@:tc=virtual: Ms|swtp|ct82|southwest technical products ct82:\ :do=^J:am:le=^d:bc=^d:\ :al=^\^y:cd=^v:ce=^F:cl=^L:cm=%r^k%.%.:co#82:li#20:\ :dl=^z:nd=^s:up=^a:so=^^^v:se=^^^F:dc=^\^h:ic=^\^x:ho=^p:\ :ei=:sf=^n:sr=^o:ll=^c:im=:\ :is=^\^r^^^s^^^d^]^w^i^s^^^]^^^o^]^w^r^i: Mt|terak|Terak emulating Datamedia 1520:\ :tc=dm1520: # From john@ucbrenoir Tue Sep 24 13:14:44 1985 M4|sun-12|Sun 12-line window:\ :li#12:co#80:tc=sun: M5|sun-1|Sun 1-line window for sysline:\ :li#1:co#80:es:hs:ts=\r:fs=\E[K:ds=^L:tc=sun: LS|apollo:\ :al=\EI:am:bs:cd=\EJ:ce=\EK:ch=\EN%d:cl=^L:cm=\EM%+ %d):\ :cv=\EO+ :dc=\EP:dl=\EL:do=\EB:ei=\ER:im=\EQ:mi:nd=\EC:se=\ET:sf=\EE:\ :so=\ES:sr=\ED:te=\EX:ti=\EW:ue=\EV:up=\EA:us=\EU:co#88:li#53: # Apollo termcaps from Gary Darland, goodmanc@garnet LP|apollo_15P|apollo 15 inch display:\ :dN@:tc=vt132: LQ|apollo_19L|apollo 19 inch display:\ :dN@:tc=vt132: LR|apollo_color|apollo color display:\ :dN@:tc=vt132: Mv|virtual|VIRTUAL|cb unix virtual terminal:\ :do=^J:co#80:li#24:am:cl=\E\112:le=^H:bs:cm=\E\107%r%.%.:nd=\E\103:\ :up=\E\101:ce=\E\113:cd=\E\114:al=\E\120:dl=\E\116:im=:ei=:ic=\E\117:\ :da:db:kl=\E\104:kr=\E\103:ku=\E\101:kd=\E\102:kh=\E\105:\ :so=\E\141\004:se=\E\142\004:us=\E\141\001:ue=\E\142\001: Mw|it2|intertube2|intertec data systems intertube 2:\ :do=^J:am:bs:cl=^L:co#80:ho=^A:li#25:up=^Z:ce=\EK:\ :cm=^N%+ %+ :ch=^P%\102%.:cv=^K%.:nd=^F:do=\n:ll=^K^X\r:\ :so=\E0P:se=\E0@: Mx|delta|dd5000|delta data 5000:\ :do=^J:am:le=^H:bs:cl=^NR:cm=^O%\068%+9%\068%+9:co#80:li#27:\ :ho=^NQ:nc:nd=^Y:up=^Z:ce=^NU:dc=^NV:ma=^K^J^Z^P^Y :xr: My|mdl110|cybernex mdl-110:\ :cm=^P%+ %+ :co#80:li#24:am:cl=70^X:le=^H:bs:do=^J:\ :nd=^U:up=^Z:ho=^Y:ce=145^N@^V:cd=145^NA^W:al=65^NA^N^]:\ :dl=40^NA^N^^:im=:ei=:ic=3.5^NA^]:dm=:ed=:dc=3.5^NA^^:\ :so=^NF:se=^NG:ta=43\t:ma=^Z^P:cd=6^N@^V Mz|zen30|z30|zentec 30:\ :do=^J:mi:co#80:li#24:ma=^L ^R^L^K^P:ul:\ :al=1.5*\EE:le=^H:bs:ce=1.0*\ET:cm=\E=%+ %+ :cl=\E*:\ :ho=^^:nd=^L:se=\EG0:so=\EG6:up=^K:im=\Eq:ei=\Er:\ :am:dc=\EW:dl=1.5*\ER:cd=\EY: m0|modgraph|mod|Modgraph terminal emulating vt100, 24x80:\ :xn@:rf@:sr=5\EM\E[K:vs=\E\^9;0s\E\^7;1s:\ :is=\E\^9;0s\E\^7;1s\E[3g\E\^11;9s\E\^11;17s\E\^11;25s\E\^11;33s\E\^11;41s\E\^11;49s\E\^11;57s\E\^11;65s\E\^11;73s\E\^11;81s\E\^11;89s:\ :tc=vt100: # dmchat is like DM2500, but DOES need "all that padding" (jcm 1/31/82) # also, has a meta-key (MT) # from goldberger@su-csli.arpa MX|dmchat|dmchat version of datamedia 2500:\ :al=1*^P\n^X^]^X^]:\ :MT:km:\ :dl=2^P^Z^X^]:\ :tc=dm2500: #from Carol Block at ear (cblock@ear) # m7|mt70|m70|morrow mt70:\ :is=EGO\E"5:\ :cl=^Z:\ :cm=\E=%+ %+ :\ :do=^J:\ :im=:ic=\EQ:ei:\ :dm=:dc=\EW:ed=:\ :kl=\034L:kr=\034M:ku=\034J:kd=\034K:\ :so=\EG4:se=\EGO:\ :us=\EG1:ue=\EGO:\ :vs=\E"2:ve=\E"5\E(:\ :tc=adm31: # from keith bostic (bostic@monet) # m2|mod2|Modgraph GX-1000, set to 80x24, keypad not enabled:\ :is=\E<\E\^5;2s\E\^7;1s\E[3g\E\^11;9s\E\^11;17s\E\^11;25s\E\^11;33s\E\^11;41s\E\^11;49s\E\^11;57s\E\^11;65s\E\^11;73s\E\^11;81s\E\^11;89s\E\^12;0s\E\^14;2s\E\^15;9s\E\^25;1s\E\^9;1s\E\^27;1:\ :bs:cd=50\EJ:ce=3\EK:cl=50\EH\EJ:cm=5\EY%+ %+ :co#80:li#24:nd=2\EC:\ :pt:sr=5\EI:up=2\EA:da:db:am: S1|wsiris|iris40|iris emulating a 40 line visual 50 (approximately):\ :am:al=\EL:is=\E7B0\E7F7\E7C2\E7R3:\ :bs:cd=\EJ:ce=\EK:cl=\EH\EJ:ho=\EH:cm=\EY%+ %+ :co#80:li#40:nd=\EC:\ :pt:sr=\EI:up=\EA:ku=\EA:kd=\EB:kr=\EC:kl=\ED:\ :k0=\E0:k1=\E1:k2=\E2:k3=\E3:k4=\E4:k5=\E5:k6=\E6:k7=\E7:k8=\E8:k9=\E9:\ :vs=\E;:ve=\E>:cl=\Ev:ho=\EH:dl=\EM:so=\E9P:se=\E0@:\ :HS=\E7F2:HE=\E7F7:\ :us=\E7R2\E9P:ue=\E7R3\E0@:\ :CT#2:CZ=*Bblack,red,green,yellow,blue,magenta,cyan,*Fwhite: # # -------------------------------- # # N: ANN ARBOR # # Needs function keys added. # Originally from Mike O'Brien@Rand and Howard Katseff at Bell Labs. # Highly modified 6/22 by Mike O'Brien. # split out into several for the various screen sizes by dave-yost@rand # Modifications made 3/82 by Mark Horton # Modified by Tom Quarles at UCB for greater efficiency and more diversity # status line moved to top of screen, vb removed 5/82 # # assumes the following setup: # A menu: 0000 1010 0001 0000 # B menu: 9600 0100 1000 0000 0000 1000 0000 17 19 # C menu: 56 66 0 0 9600 0110 1100 # D menu: 0110 1001 1 0 # # Briefly, the settings are for the following modes: # (values are for bit set/clear with * indicating our preference # and the value used to test these termcaps) # Note that many of these settings are irelevent to the termcap # and are just set to the default mode of the terminal as shipped # by the factory. # # A menu: 0000 1010 0001 0000 # Block/underline cursor* # blinking/nonblinking cursor* # key click/no key click* # bell/no bell at column 72* # # key pad is cursor control*/key pad is numeric # return and line feed/return for key * # repeat after .5 sec*/no repeat # repeat at 25/15 chars per sec. * # # hold data until pause pressed/process data unless pause pressed* # slow scroll/no slow scroll* # Hold in area/don't hold in area* # functions keys have default*/function keys disabled on powerup # # show/don't show position of cursor during page transmit* # unused # unused # unused # # B menu: 9600 0100 1000 0000 0000 1000 0000 17 19 # Baud rate (9600*) # # 2 bits of parity - 00=odd,01=even*,10=space,11=mark # 1 stop bit*/2 stop bits # parity error detection off*/on # # keyboard local/on line* # half/full duplex* # disable/do not disable keyboard after data transmission* # # transmit entire page/stop transmission at cursor* # transfer/do not transfer protected characters* # transmit all characters/transmit only selected characters* # transmit all selected areas/transmit only 1 selected area* # # transmit/do not transmit line seperators to host* # transmit/do not transmit page tab stops tabs to host* # transmit/do not transmit column tab stop tabs to host* # transmit/do not transmit graphics control (underline,inverse..)* # # enable*/disable auto XON/XOFF control # require/do not require receipt of a DC1 from host after each LF* # pause key acts as a meta key/pause key is pause* # unused # # unused # unused # unused # unused # # XON character (17*) # XOFF character (19*) # # C menu: 56 66 0 0 9600 0110 1100 # number of lines to print data on (printer) (56*) # # number of lines on a sheet of paper (printer) (66*) # # left margin (printer) (0*) # # number of pad chars on new line to printer (0*) # # printer baud rate (9600*) # # printer parity: 00=odd,01=even*,10=space,11=mark # printer stop bits: 2*/1 # print/do not print guarded areas* # # new line is: 01=LF,10=CR,11=CRLF* # unused # unused # # D menu: 0110 1001 1 0 # LF is newline/LF is down one line, same column* # wrap to preceeding line if move left from col 1*/don't wrap # wrap to next line if move right from col 80*/don't wrap # backspace is/is not destructive* # # display*/ignore DEL character # display will not/will scroll* # page/column tab stops* # erase everything*/erase unprotected only # # editing extent: 0=display,1=line*,2=field,3=area # # unused # NA|aaa-unk|ann arbor ambassador (internal - don't use this directly):\ :do=^J:al=3\E[L:am:le=^H:bs:\ :cd=\E[J:ce=5\E[K:cl=156\E[H\E[J:cm=\E[%i%d;%dH:co#80:\ :dc=4\E[P:dl=3\E[M:ho=\E[H:ic=4\E[@:\ :md=\E[1m:mr=\E[7m:mb=\E[5m:mk=\E[8m:me=\E[m:\ :ku=\EM:kd=\ED:kl=\E[D:kr=\E[C:kh=\E[H:ko=cl,dc,dl,ce,cd:\ :ks=\EP`?z~[H~[[J`>z~[[J`8xz~[M`4xz~[[D`6xz~[[C`2xz~[D\E\\:\ :ke=\EP`?y~[H~[[J`>y~[[2J`8xy~[M`4xy~[[D`6xy~[[C`2xy~[D\E\\:\ :ch=\E[%i%d`:ei=:im=:pt:bw:bt=\E[Z:\ :mi:nd=\E[C:se=\E[m:so=\E[7m:ue=\E[m:us=\E[4m:up=\EM: NB|aaa-18|ann arbor ambassador/18 lines:\ :ti=\E[2J\E[18;0;0;18p:te=\E[60;0;0;18p\E[18;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;18p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#18:tc=aaa-unk: NC|aaa-20|ann arbor ambassador/20 lines:\ :ti=\E[2J\E[20;0;0;20p:te=\E[60;0;0;20p\E[20;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;20p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#20:tc=aaa-unk: ND|aaa-22|ann arbor ambassador/22 lines:\ :ti=\E[2J\E[22;0;0;22p:te=\E[60;0;0;22p\E[22;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;22p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#22:tc=aaa-unk: NE|aaa-24|ann arbor ambassador/24 lines:\ :ti=\E[2J\E[24;0;0;24p:te=\E[60;0;0;24p\E[24;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;24p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#24:tc=aaa-unk: NF|aaa-26|ann arbor ambassador/26 lines:\ :ti=\E[2J\E[26;0;0;26p:te=\E[60;0;0;26p\E[26;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;26p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#26:tc=aaa-unk: NG|aaa-28|ann arbor ambassador/28 lines:\ :ti=\E[2J\E[28;0;0;28p:te=\E[60;0;0;28p\E[28;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;28p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#28:tc=aaa-unk: NH|aaa|aaa-30|ambas|ambassador|ann arbor ambassador/30 lines:\ :ti=\E[2J\E[30;0;0;30p:te=\E[60;0;0;30p\E[30;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;30p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#30:tc=aaa-unk: NI|aaa-36|ann arbor ambassador/36 lines:\ :ti=\E[2J\E[36;0;0;36p:te=\E[60;0;0;36p\E[36;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;36p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#36:tc=aaa-unk: NJ|aaa-40|ann arbor ambassador/40 lines:\ :ti=\E[2J\E[40;0;0;40p:te=\E[60;0;0;40p\E[40;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;40p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#40:tc=aaa-unk: NK|aaa-48|ann arbor ambassador/48 lines:\ :ti=\E[2J\E[48;0;0;48p:te=\E[60;0;0;48p\E[48;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;48p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#48:tc=aaa-unk: NL|aaa-60|ann arbor ambassador/60 lines:\ :ti=\E[2J\E[60;0;0;60p:te=\E[60;0;0;60p\E[60;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;0;0;60p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#60:tc=aaa-unk: NS|aaa-unk-s|ann arbor ambassador unknown with/status:\ :es:hs:i2=\E7\E[>51h\E[H\E[2K\E[>51l\E8:\ :ts=\E7\E[>51h\E[H\E[2K\E[%i%d`:fs=\E[>51l\E8:\ :ds=\E7\E[>51h\E[H\E[2K\E[>51l\E8:\ :tc=aaa-unk: NM|aaa-18-s|ambassador|ann arbor ambassador/18 lines + status line:\ :ti=\E[2J\E[18;1;0;18p:\ :te=\E[60;1;0;18p\E[17;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;18p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#17:tc=aaa-unk-s: NN|aaa-20-s|ambassador|ann arbor ambassador/20 lines + status line:\ :ti=\E[2J\E[20;1;0;20p:\ :te=\E[60;1;0;20p\E[19;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;20p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#19:tc=aaa-unk-s: NO|aaa-22-s|ambassador|ann arbor ambassador/22 lines + status line:\ :ti=\E[2J\E[22;1;0;22p:\ :te=\E[60;1;0;22p\E[21;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;22p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#21:tc=aaa-unk-s: NP|aaa-24-s|ambassador|ann arbor ambassador/24 lines + status line:\ :ti=\E[2J\E[24;1;0;24p:\ :te=\E[60;1;0;24p\E[23;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;24p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#23:tc=aaa-unk-s: NQ|aaa-26-s|ambassador|ann arbor ambassador/26 lines + status line:\ :ti=\E[2J\E[26;1;0;26p:\ :te=\E[60;1;0;26p\E[25;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;26p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#25:tc=aaa-unk-s: NR|aaa-28-s|ambassador|ann arbor ambassador/28 lines + status line:\ :ti=\E[2J\E[28;1;0;28p:\ :te=\E[60;1;0;28p\E[27;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;28p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#27:tc=aaa-unk-s: NT|aaa-30-s|ambassador|ann arbor ambassador/30 lines + status line:\ :ti=\E[2J\E[30;1;0;30p:\ :te=\E[60;1;0;30p\E[29;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;30p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#29:tc=aaa-unk-s: NU|aaa-36-s|ambassador|ann arbor ambassador/36 lines + status line:\ :ti=\E[2J\E[36;1;0;36p:\ :te=\E[60;1;0;36p\E[35;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;36p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#35:tc=aaa-unk-s: NV|aaa-40-s|ambassador|ann arbor ambassador/40 lines + status line:\ :ti=\E[2J\E[40;1;0;40p:\ :te=\E[60;1;0;40p\E[39;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;40p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#39:tc=aaa-unk-s: NW|aaa-48-s|ann arbor ambassador/48 lines+sl:\ :ti=\E[2J\E[48;1;0;48p:te=\E[60;1;0;48p\E[47;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\EP`?y~[[2J~[[H\E7\E[60;1;0;48p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#47:tc=aaa-unk-s: NX|aaa-60-s|ambassador|ann arbor ambassador/60 lines + status line:\ :ti=\E[2J\E[60;1;0;60p:te=\E[60;1;0;60p\E[59;1H\E[J:\ :is=\EP`+x~M\E\\\E[m\E7\E[60;1;0;60p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#59:tc=aaa-unk-s: NY|aaa-18-rv|ambassador/18 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;18p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-18: NZ|aaa-20-rv|ambassador/20 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;20p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-20: Na|aaa-22-rv|ambassador/22 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;22p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-22: Nb|aaa-24-rv|ambassador/24 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;24p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-24: Nc|aaa-26-rv|ambassador/26 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;26p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-26: Nd|aaa-28-rv|ambassador/28 lines+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;28p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-28: Ne|aaa-30-rv|ann arbor ambassador/30 lines in reverse video:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;30p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-30: Nf|aaa-36-rv|ann arbor ambassador/36 lines in reverse video:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;36p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-36: Ng|aaa-40-rv|ann arbor ambassador/40 lines in reverse video:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;40p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-40: Nh|aaa-48-rv|ann arbor ambassador/48 lines in reverse video:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;48p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-48: Ni|aaa-60-rv|ann arbor ambassador/60 lines in reverse video:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;60p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-60: Nj|aaa-18-rv-s|aaa-18-s-rv|ambassador/18 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :ti=\E[2J\E[18;1;0;18p:te=\E[60;1;0;18p\E[17;1H\E[J:li#17:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;18p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-unk-s: Nk|aaa-20-rv-s|aaa-20-s-rv|ambassador/20 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :ti=\E[2J\E[20;1;0;20p:te=\E[60;1;0;20p\E[19;1H\E[J:li#19:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;20p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-unk-s: Nl|aaa-22-rv-s|aaa-22-s-rv|ambassador/22 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :ti=\E[2J\E[22;1;0;22p:te=\E[60;1;0;22p\E[21;1H\E[J:li#21:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;22p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-unk-s: Nm|aaa-24-rv-s|aaa-24-s-rv|ambassador/24 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :ti=\E[2J\E[24;1;0;24p:te=\E[60;1;0;24p\E[23;1H\E[J:li#23:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;24p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-unk-s: Nn|aaa-26-rv-s|aaa-26-s-rv|ambassador/26 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :ti=\E[2J\E[26;1;0;26p:te=\E[60;1;0;26p\E[25;1H\E[J:li#25:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;26p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-unk-s: No|aaa-28-rv-s|aaa-28-s-rv|ambassador/28 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :ti=\E[2J\E[28;1;0;28p:te=\E[60;1;0;28p\E[27;1H\E[J:li#27:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;28p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-unk-s: Np|aaa-rv|aaa-30-rv-s|aaa-30-s-rv|ambassador/30 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :ti=\E[2J\E[30;1;0;30p:te=\E[60;1;0;30p\E[29;1H\E[J:li#29:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;30p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-unk-s: Nq|aaa-36-rv-s|aaa-36-s-rv|ambassador/36 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :ti=\E[2J\E[36;1;0;36p:te=\E[60;1;0;36p\E[35;1H\E[J:li#35:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;36p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-unk-s: Nr|aaa-40-rv-s|aaa-40-s-rv|ambassador/40 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :ti=\E[2J\E[40;1;0;40p:te=\E[60;1;0;40p\E[39;1H\E[J:li#39:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;40p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-unk-s: Ns|aaa-48-rv-s|aaa-48-s-rv|ambassador/48 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :ti=\E[2J\E[48;1;0;48p:te=\E[60;1;0;48p\E[47;1H\E[J:li#47:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;48p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-unk-s: Nt|aaa-60-rv-s|aaa-60-s-rv|ambassador/60 lines+sl+rv:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :ti=\E[2J\E[60;1;0;60p:te=\E[60;1;0;60p\E[59;1H\E[J:li#59:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;60p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :tc=aaa-unk-s: NL|aaa-24-ctxt|ann arbor ambassador/24 lines:\ :ti=\E[30;1H\E[K\E[24;0;0;24p:te=\E[60;1;0;24p\E[60;1H\E[K:tc=aaa-24: NL|aaa-24-rv-ctxt|ambassador/24+rv:\ :ti=\E[30;1H\E[K\E[24;0;0;24p:te=\E[60;1;0;24p\E[60;1H\E[K:tc=aaa-24-rv: NL|aaa-s-ctxt|aaa-30-s-ctxt|hairy aaa:\ :ti=\E[30;1H\E[K\E[30;1;0;30p:te=\E[60;1;0;30p\E[59;1H\E[K:tc=aaa-30-s: NL|aaa-s-rv-ctxt|aaa-30-s-rv-ctxt|hairy aaa:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;1;0;30p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :ti=\E[30;1H\E[K\E[30;1;0;30p:te=\E[60;1;0;30p\E[59;1H\E[K:\ :li#29:tc=aaa-unk-s: NH|aaa-ctxt|aaa-30-ctxt|ann arbor ambassador/30 lines:\ :ti=\E[30;0;0;30p:te=\E[60;0;0;30p\E[60;1H\E[K:tc=aaa-30: NH|aaa-rv-ctxt|aaa-30-rv-ctxt|ann arbor ambassador/30 lines:\ :ti=\E[30;0;0;30p:te=\E[60;0;0;30p\E[60;1H\E[K:\ :md=\E[1;7m:mr=\E[m:mb=\E[5;7m:mk=\E[7;8m:me=\E[7m:\ :us=\E[4;7m:ue=\E[7m:se=\E[7m:so=\E[m:\ :is=\EP`+x~M\E\\\E[7m\E7\E[60;0;0;30p\E[3g\E[f\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E[8a\EH\E8\E[>6h\E[1Q:\ :li#30:tc=aaa-unk: Nd|aaa-db|ann arbor ambassador 30/destructive backspace:\ :ti=\E[H\E[J\E[30;0;0;30p:te=\E7\E[60;0;0;30p\E8:li#30:\ :is=\E[60;0;0;30p\E[H\E[J\E[1Q\E[m\E[20l\E[>30h:le=\E[D:bc=\E[D:bs@:\ :tc=aaa-unk: N1|aa|annarbor|4080|ann arbor 4080:\ :do=^J:pt:ct=^\^P^P:st=^]^P1:cm=^O%r%\066%.%>^S^L%+@:\ :co#80:li#40:le=^H:bs:cl=2^L:up=^N:nd=^_:ho=^K:am:\ :kb=^^:kd=^J:ku=^N:kl=^H:kr=^_:kh=^K:ma=^_ ^N^P: # # -------------------------------- # # P: PC entries for use with kermit # # greg small (gts@populi) # # Cannot use :pt:, it does not work (why?). :ho: seems required (why?). [gts] # Caution: 4.3 BSD tset does not pass li#25 to stty rows except during login? # :cl: clears attributes and sets wrap at margin before clearing the screen. P1|ansi.sys|ansisys|PC-DOS 3.1 ANSI.SYS:\ :am:bs:ce=\E[K:cl=\E[m\E[7h\E[2J:cm=\E[%i%d;%dH:co#80:\ :ku=^K:kd=^J:kl=^H:kr=^L:kh=^^:ma=^Hh\012j^Kk^Ll^^H:\ :ho=\E[H:li#25:nd=\E[C:up=\E[A:\ :ms:md=\E[1m:me=\E[m:mr=\E[7m:se=\E[m:so=\E[1m:ue=\E[m:us=\E[4m:\ :is=U1 PC-DOS 3.1 ANSI.SYS 9-23-86\n\E[m\E[7h: # # Define IBM PC keypad keys for vi as per MS-Kermit while using ANSI.SYS. # This should only be used when the terminal emulator cannot redefine the keys. # Since redefining keys with ansi.sys also affects PC-DOS programs, the key # definitions must be restored. If the terminal emulator is quit while in vi # or others using :ks:ke:, the keypad keys will not be defined as per PC-DOS. # The PgUp and PgDn are prefixed with ESC so that tn3270 can be used on Unix # (^U and ^D are already defined for tn3270). The ESC is safe for vi but it # does "beep". ESC ESC i is used for Ins to avoid tn3270 ESC i for coltab. # Left arrow is always BS, because PC-dos can tolerate this change. # Caution: vi is limited to 256 string bytes, longer crashes or wierds vi. # Consequently the End keypad key could not be set (it is relatively safe and # actually useful because it sends ^@ O, which beeps and opens a line above). P2|ansi.sysk|ansisysk|PC-DOS 3.1 ANSI.SYS with keypad redefined for vi:\ :ks=\E[;71;30p\E[;72;11p\E[;73;27;21p\E[;77;12p\E[;80;10p\E[;81;27;4p\E[;82;27;27;105p\E[;83;127p:\ :ke=\E[;71;0;71p\E[;72;0;72p\E[;73;0;73p\E[;77;0;77p\E[;80;0;80p\E[;81;0;81p\E[;82;0;82p\E[;83;0;83p:\ :is=U2 PC-DOS 3.1 ANSI.SYS with keypad redefined for vi 9-29-86\n\E[;75;8p:\ :tc=ansi.sys # # Adds ins/del line/character, hence vi reverse scrolls/inserts/deletes nicer. P3|nansi.sys|nansisys||PC-DOS Public Domain NANSI.SYS:\ :al=\E[1L:dl=\E[1M:ic=\E[1@:dc=\E[1P:\ :is=U3 PC-DOS Public Domain NANSI.SYS 9-23-86\n:\ :tc=ansi.sys: # # See U2 ansi.sysk and U3 nansi.sys above. P4|nansi.sysk|nansisysk|PC-DOS Public Domain NANSI.SYS with keypad redefined for vi:\ :al=\E[1L:dl=\E[1M:ic=\E[1@:dc=\E[1P:\ :is=U4 PC-DOS Public Domain NANSI.SYS with keypad redefined for vi 9-29-86\n\E[;75;8p:\ :tc=ansi.sysk: # # -------------------------------- # # T: TELETYPE # # We need descriptions for the model 40. There are known to be at least three # flavors of the 40, both seem more like IBM half duplex forms fillers than # ASCII terminals. They have lots of awful braindamage, such as printing # a visible newline indicator after each newline. The 40-1 is a half duplex # terminal and is hopeless. The 40-2 is braindamaged but has hope and is # described here. The 40-4 is a 3270 lookalike and beyond hope. # The terminal has visible bell but I don't know it - it's # null here to prevent it from showing the BL character. # There is an \EG in nl because of a bug in vi (if stty says you have # a "newline" style terminal (-crmode) vi figures all it needs is nl # to get crlf, even if cr is not ^M.) T0|40|tty40|ds40|ds40/2|ds40-2|dataspeed40|teletype dataspeed 40/2:\ :cl=160\ER:cd=160\EJ:al=160\EL:dl=160\EM:dc=50\EP:im=:ei=:ic=50\E\^:\ :nd=\EC:up=\E7:bs:cr=\EG:nl=\EG\EB:do=\EB:co#80:li#24:vb=:\ :so=\E3:se=\E4: T3|33|tty33|tty|model 33 teletype:\ :do=^J:co#72:hc:os: T4|43|tty43|model 43 teletype:\ :do=^J:kb=^h:am:le=^H:bs:hc:os:co#132: T7|37|tty37|model 37 teletype:\ :do=^J:le=^H:bs:hc:hu=\E8:hd=\E9:up=\E7:os: # From jwb Wed Mar 31 13:25:09 1982 remote from ihuxp # This entry appears to avoid the top line - I have no idea why. TT|4424|tty4424|teletype 4424M:\ :al=\EL:da:db:ip=2:im=:ei=:ic=\E\^:dc=\EP:dl=\EM:\ :co#80:li#23:am:cl=\E[2;H\E[J:bs:cm=\E[%i%2;%2H\E[B:\ :nd=\E[C:up=\E[A:pt:mi:sr=\ET:\ :ce=\E[K:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :is=\E[m\E[2;24r:\ :kd=\E[B:kl=\E[D:ku=\E[A:kr=\E[C:\ :kh=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS: # Teletype blit. # # -------------------------------- # # V: VISUAL # # The Visual 200 beeps when you type a character in insert mode. # This is a horribly obnoxious misfeature, and some of the entries # below try to get around the problem by ignoring the feature or # turning it off when inputting a character. They are said not to # work well at 300 baud. (You could always cut the wire to the bell!) #From mike@brl-vgr Mon Nov 14 08:34:29 1983 V2|vi200|vis200|visual 200 with function keys:\ :so=\E4:se=\E3:ms:do=^J:\ :al=\EL:am:le=^H:bs:cd=\Ey:ce=\Ex:cl=\Ev:\ :cm=\EY%+ %+ :co#80:dc=\EO:dl=\EM:ho=\EH:\ :im=:ei=:ic=\Ei \b\Ej:\ :is=\E3\Eb\Ej\E\\\El\EG\Ec\Ek:\ :k0=\EP:k1=\EQ:k2=\ER:k3=\E :k4=\E!:k5=\E":k6=\E#:\ :k7=\E$:k8=\E%:k9=\E&:kl=\ED:kr=\EC:ku=\EA:kd=\EB:kh=\EH:\ :li#24:nd=\EC:pt:sr=\EI:up=\EA:vs=\Ed:ve=\Ec: VR|vi200-rv-ic|visual 200 reverse video using insert char:\ :ei=\Ej:im=\Ei:ic@:tc=vi200-rv: # The older Visuals didn't come with function keys. This entry uses # ks and ke so that the keypad keys can be used as function keys. # If your version of vi doesn't support function keys you may want # to use V2. Vf|vi200-f|visual|visual 200 no function keys:\ :do=^J:al=\EL:am:le=^H:bs:cd=\Ey:ce=4*\Ex:cl=\Ev:\ :cm=\EY%+ %+ :co#80:dc=4*\EO:dl=4*\EM:ho=\EH:\ :im=:ei=:ic=\Ei \b\Ej:\ :is=\E3\Eb\Ej\E\\\El\EG\Ed\Ek:ks=\E=:ke=\E>:\ :k0=\E?p:k1=\E?q:k2=\E?r:k3=\E?s:k4=\E?t:k5=\E?u:k6=\E?v:\ :k7=\E?w:k8=\E?x:k9=\E?y:kl=\ED:kr=\EC:ku=\EA:kd=\EB:kh=\EH:\ :li#24:nd=\EC:pt:sr=\EI:up=\EA:vs=\Ed:ve=\Ec: Vr|vi200-rv|visual 200 reverse video:\ :so=\E4:se=\E3:sr@:vs@:ve@:tc=vi200: Vt|vi200-ic|visual 200 using insert char:\ :ei=\Ej:im=\Ei:ic@:tc=vi200: # From: jbs@athena.mit.edu Jeff Siegal V5|vi55|Visual 55:\ :im=\Ea:ei=\Eb:mi:dc=\Ew:dm=:ed=:al=\EL:dl=\EM:cs=\E_%+A%+A:\ :ho=\EH:cl=\Ev:is=\Ev\E_AX\Eb\EW\E9P\ET:so=\EU:se=\ET:ms:\ :do=^J:le=^H:bs:cd=\EJ:ce=\EK:cm=\EY%+ %+ :co#80:li#24:\ :nd=\EC:pt:sr=\EI:up=\EA:ku=\EA:kd=\EB:kr=\EC:kl=\ED:kb=^H: # # -------------------------------- # # X: TEKTRONIX # Xa|tek|tek4012|4012|tektronix 4012:\ :do=^J:is=\E^O:le=^H:bs:cl=1000\E^L:co#75:ns:li#35:os: Xb|tek4013|4013|tektronix 4013:\ :as=\E^N:ae=\E^O:dF#1000:tc=4012: Xc|tek4014|4014|tektronix 4014:\ :is=\E^O\E9:co#81:li#38:dF#1000:tc=tek4012: Xd|tek4015|4015|tektronix 4015:\ :as=\E^N:ae=\E^O:tc=4014: Xe|tek4014-sm|4014-sm|tektronix 4014 in small font:\ :is=\E^O\E\072:co#121:li#58:tc=tek4014: Xf|tek4015-sm|4015-sm|tektronix 4015 in small font:\ :as=\E^N:ae=\E^O:tc=4014-sm: # I think the 1000UP is supposed to be so expensive it never happens. X4|tek4023|4023|tex|tektronix 4023:\ :do=^J:so=^_P:se=^_@:cm=\034%r%+ %+ :nd=\t:le=^H:\ :bs:cl=4\E^L:co#80:li#24:am:up=1000UP:vt#4: # Can't use cursor motion because it's memory relative, and because # it only works in the workspace, not the monitor. Same for home. # Likewise, standout only works in the workspace. # 145 ms padding on al and AL taken out since it doesn't seem to be needed much. X5|4025|4027|4024|tek4025|tek4027|tek4024|4025cu|4027cu|tektronix 4024/4025/4027:\ :sf=^F^J:do=^F^J:is=\41com 31\r\n^_sto 9 17 25 33 41 49 57 65 73\r:\ :ks=^_lea p4 /h/\r^_lea p8 /k/\r^_lea p6 / /\r^_lea p2 /j/\r^_lea f5 /H/\r^_lea p5 /H/\r:\ :ke=^_lea p2\r^_lea p4\r^_lea p6\r^_lea p8\r^_lea p5\r^_lea f5\r:\ :am:le=^H:bs:da:db:pt:li#34:co#80:cl=^_era\r\n\n:up=^K:nd=^_rig\r:\ :al=^_up\r^_ili\r:dl=^_dli\r^F:\ :dc=^_dch\r:im=^_ich\r:ei=^F^_dow\r^K:nl=^F\n:\ :cd=^_dli 50\r:CC=^_:AL=^_up\r^_ili %d\r:DL=^_dli %d\r^F:\ :UP=^_up %d\r:DO=^_dow %d\r:LE=^_lef %d\r:RI=^_rig %d\r: X7|4025-17|4027-17|tek 4025 17 line window:\ :li#17:tc=4025: X8|4025-17ws|4027-17ws|tek 4025 17 line window in workspace:\ :is=\41com 31\r\n^_sto 9,17,25,33,41,49,57,65,73\r^_wor 17\r^_mon 17\r:\ :ti=^_wor h\r:te=^_mon h\r:so=^_att e\r:se=^_att s\r:tc=4025-17: X9|4025ex|4027ex|tek 4025 w/!:\ :ti=\41com 31\r:te=^_com 33\r:\ :is=^_com 33\r\n\41sto 9,17,25,33,41,49,57,65,73\r:tc=4025: # From jcoker@ucbic Xp|4107|tek4107|Tektronix 4107 graphics terminal with memory:\ :ti=\E[?6l\E[H\E[J:te=\E[?6h\E%!0\ELBP0\E%!1\E[32;1f:\ :is=\E%!0\ELBP0\E%!1\E[H\E[2g\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[J:\ :li#32:do=^J:al=3\E[L:xn:am:le=^H:bs:cd=\E[J:\ :ce=5\E[K:cl=156\E[H\E[J:cm=\E[%i%d;%dH:co#80:dc=4\E[P:dl=3\E[M:\ :ho=\E[H:ic=4\E[@:md=\E[1m:mr=\E[7m:mb=\E[5m:me=\E[m:ku=\EM:\ :kd=\ED:kl=\E[D:kr=\E[C:kh=\E[H:\ :ei=:im=:pt:bw:bt=\E[Z:mi:nd=\E[C:se=\E[m:so=\E[7m:\ :ue=\E[m:us=\E[4m:up=\EM: # Tektronix 4107 with sysline Xq|4107-s|tek4107-s|Tektronix 4107 with sysline but no memory:\ :is=\E%!1\E[2;32r\E[132D\E[2g\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[8C\EH\E[J:\ :es:hs:i2=\E7\E[?6l\E[2K\E[?6h\E8:ts=\E7\E[?6l\E[2K\E[;%i%df:\ :fs=\E[?6h\E8:ds=\E7\E[?6l\E[2K\E[?6h\E8:tc=4107: # From cbosg!teklabs!davem Wed Sep 16 21:11:41 1981 # Here's the comamnd file that I use to get rogue to work on the 4025. # It should work with any program using the old curses (e.g. it better # not try to scroll, or cursor addressing won't work. Also, you can't # see the cursor.) # (This "learns" the arrow keys for rogue. I have adapted it for termcap - mrh) Xr|4025-cr|tek 4025 for curses and rogue:\ :is=\41com 31\r\n^_sto 9 17 25 33 41 49 57 65 73\r:\ :am:le=^H:bs:pt:li#33:co#80:cm=^_jum%i%d,%d;:up=^K:\ :do=^F^J:cl=^_era;:nd=^_rig;:nl=^F\n:ti=^_wor 33h:te=^_wor 0: # next two lines commented out since curses only allows 128 chars, sigh. # :ti=^_lea p1/b/^_lea p2/j/^_lea p3/n/^_lea p4/h/^_lea p5/ /^_lea p6/l/^_lea p7/y/^_lea p8/k/^_lea p9/u/^_lea p./f/^_lea pt/`era w/13^_lea p0/s/^_wor 33h:\ # :te=^_lea p1^_lea p2^_lea p3^_lea p4^_lea pt^_lea p5^_lea p6^_lea p7^_lea p8^_lea p9/la/13^_lea p.^_lea p0^_wor 0: # The 4110 series may be a wonderful graphics series, but they make the 4025 # look good for screen editing. In the dialog area, you can't move the cursor # off the bottom line. Out of the dialog area, ^K moves it up, but there # is no way to scroll. Xs|4112|4114|tek4112|tektronix 4110 series:\ :is=\E3!1:li#34:co#80:am:al=\E[L:bs:bt=\E[Z:\ :cd=\E[0J:ce=\E[0K:cl=\E[2J\E[0;0H:cm=\E[%i%d;%dH:\ :db:dc=\E[P:dl=\E[M:ic=\E[@:im=:nd=\E[C:se=\E[m:\ :so=\E[7m:ue=\E[m:up=\EM:us=\E[4m:vs=:ve=:\ :sr=\E7\E[0;0H\E[L\E8:sf=\E7\E[0;0H\E[M\E8: Xt|4112-nd|4112 not in dialog area:up=^K:ns:tc=4112: Xu|4112-5|4112 in 5 line dialog area:li#5:tc=4112: Xv|4113|tek4113|tektronix 4113 color graphics, 5 line dialog area:\ :le=^H:do=^J:eo:da:bs:am:li#5:co#80:is=\EKA1\ELL5\ELV0\ELV1:\ :vb=\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERB0:\ :cl=\ELZ:uc=^H\ELM1_\ELM0:nd=\LM1 \LM0:\ :.as=\E^N:.ae=\E^O: Xw|4113-34|tek4113-34|tektronix 4113 color graphics, 34 line dialog area:\ :is=\EKA1\ELLB2\ELV0\ELV1:li#34:tc=tek4113: # ns hidden from vi to allow visual mode. APL font (as, ae) not supported here. # uc is slow, but looks nice. Suggest setenv MORE -up . vb needs enough delay # to let you see the background color being toggled. Xy|4113-nd|tek4113-nd|tektronix 4113 color graphics, no dialog area:\ :le=^H:do=^J:nd=\t:up=^K:ll=\ELF hl @:ho=\ELF7l\177 @:\ :eo:bs:am:li#34:co#80:is=\ELZ\EKA0\ELF7l\177 @:vs=\ELZ\EKA0:\ :vb=\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERBA4\ERB0:\ :cl=\E\f:uc=^H\EMG1_\EMG0:so=\EMT2:se=\EMT1:\ :.ns:.as=\E^N:.ae=\E^O: Xz|4105|tek4105:\ :al=\E[1L:am:bs:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%2;%2H:co#80:\ :dc=\E[1P:dl=\E[1M:dn=\E[1B:ho=\E[H:im=\E[4h:li#30:mi:nd=\E[1C:\ :as=\E[1m:ae=\E[0m:ms:pt:se=\E[0m:so=\E[7m:up=\E[1A:kb=^h:ku=\E[1A:\ :kd=\E[1B:kl=\E[1D:kr=\E[1C:us=\E[4m:ue=\E[0m:is=\E%!1\E[?6l\E[0m:\ :mr=\E[<3m:md=\E[<4m:mh=\E[<6m:mb=\E[<7m:me=\E[<1m:ti=\E%!1\E[?6l:xt: # This entry is from Tek. Inc. (Brian Biehl) Xz|4115|tek4115|Tektronix 4115:\ :co#80:li#34:\ :al=\E[L:am:bc=\E[D:bs:bt=\E[Z:cd=\E[J:ce=\E[K:\ :cl=\E[;H\E[2J:cm=\E[%i%d;%dH:da:db:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:eo:ho=\E[;H:im=\E[4h:if=/usr/lib/tabset/vt100:\ :is=\E%\0410\E%\014\ELV0\EKA1\ELBB2\ENU@\075\ELLB2\ELM0\ELV1\EKYA?\E%\0411\E[<1l\E[?7h\E[?8h\E[34;1H\E[34B\E[0m:\ :kb=^H:ke=\E>:ks=\E=:nd=\E[C:pt:se=\E[m:so=\E[7m:sr=\EM:\ :te=\E%\0410\ELBG8\E%\0411\E[34;1H\E[J: :ti=\E%\0410\ELBB2\E%\0411:\ :ue=\E[m:up=\E[A:us=\E[4m:\ :ve=\E%\0410\ELBG8\E%\0411\E[34;1H:\ :vs=\E%\0410\ELBB2\E%\0411: # The tek4125 emulates a vt100 incorrectly - the scrolling region # command is ignored. The following entry replaces the cs with the # needed al, dl, and im; removes some cursor pad commands that the tek4125 # chokes on; and adds a lot of initialization for the tek dialog area. # Note that this entry uses all 34 lines and sets the cursor color to green. # Steve Jacobson 8/85 XB|tek4125:\ :ks=\E=:li#34:\ :is=\E%\!0\EQD1\EUX03\EKA\ELBB2\ELCE0\ELI100\ELJ2\ELLB2\ELM0\ELS1\ELX00\ELV1\E%\!1\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:dl=\E[1M:\ :al=\E[1L:cs@:sc@:rc@:im=\E1:tc=vt100: # From carolyn@dali.berkeley.edu Thu Oct 31 12:54:27 1985 XA|4404|tek4404:\ :al=\E[1L:bs:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:cm=\E[%i%d;%dH:co#80:\ :cs=\E[%i%d;%dr:dc=\E[P:dl=\E[1M:do=^J:ei=\E[4l:ho=\E[H:im=\E[4h:\ :kd=\E[B:ke=\E[?1h:kl=\E[D:kr=\E[C:ks=\E[?1l:ku=\E[A:li#32::mb=\E[5m:\ :md=\E[1m:me=\E[m:nd=\E[C:pt:rc=\E8:sc=\E7:se=\E[27m:so=\E[7m:\ :ta=\E[2I:ti=\E%\!1\E[1;32r\E[?6l\E>:te=\E[1;1H\E[0J\E[?6h\E[?1l:\ :ue=\E[m:up=\E[A:us=\E[4m: # # -------------------------------- # # Z: Miscellaneous # # These compucolors appear similar, but they at least have different # sized screens. I don't know what's going on here. Z1|8001|ISC8001|compucolor|intecolor:\ :do=^J:al=\EU:am:le=^Z:bc=^Z:cl=3*^L:cm=^C%r%.%.:\ :co#80:cd=\EQ:dm=\EQ:ed=\EF:dc=\177:dl=\EV:ei=\EF:\ :im=\EQ:li#40:nd=1^Y:ta=8\t:up=^\:ho=1^H:pc=^@: Z2|compucolor2|compucolorII:\ :do=^J:pt:am:cm=%r^C%.%.:le=^Z:bc=^Z:li#32:co#64:\ :cl=^L:ho=^H:nd=^Y:up=^\: # From cithep!eric Wed Sep 16 08:06:44 1981 Z3|intext|Interactive Systems Corporation modified owl 1200:\ :do=^J:al=5.5*\020:am:le=^_:bc=^_:le=^H:bs:bt=^Y:cd=5.5*\026J:\ :ce=^K\160^R:cl=132\014:cm=\017%+ %+ :co#80:dc=5.5*\022:dl=5.5*\021:\ :ei=\026\074:im=\026\073:ip=5.5*:li#24:nd=\036:pt:up=\034:\ :se=^V# :sg#1:so=^V$,:ma=^K^P^R^L^L :\ :kl=^_:kd=^J:kr=^^:ku=\034:kb=^H:kh=^Z:\ :k1=^VA\r:k2=^VB\r:k3=^VC\r:k4=^VD\r:k5=^VE\r:\ :k6=^VF\r:k7=^VG\r:k8=^VH\r:k9=^VI\r:k0=^VJ\r: # # -------------------------------- # # a: ADDS # # Regent: lowest common denominator, works on all regents. a0|regent|Adds Regent Series:li#24:co#80:am:cl=^L:ll=^A:up=^Z:\ :bs:bc=^U:nd=^F:do=^J:ho=\EY : # Regent 100 has a bug where if computer sends escape when user is holding # down shift key it gets confused, so we avoid escape. a1|regent100|Adds Regent 100:k0=^B1^M:k1=^B2^M:k2=^B3^M:k3=^B4^M:\ :k4=^B5^M:k5=^B6^M:k6=^B7^M:k7=^B8^M:\ :l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:\ :so=\E0P:ue=\E0@:us=\E0`:se=\E0@:\ :cm=^K%+ %B^P%.:ug#1:sg#1:tc=regent: a2|regent20|Adds Regent 20:cd=\Ek:ce=\EK:cm=\EY%+ %+ :tc=regent: a3|regent25|Adds Regent 25:kh=^A:kl=^U:kr=^F:ku=^Z:kd=^J:tc=regent20: a4|regent40|Adds Regent 40:k0=^B1^M:k1=^B2^M:k2=^B3^M:k3=^B4^M:\ :k4=^B5^M:k5=^B6^M:k6=^B7^M:k7=^B8^M:\ :l0=F1:l1=F2:l2=F3:l3=F4:l4=F5:l5=F6:l6=F7:l7=F8:\ :al=2*\EM:dl=2*\El:\ :so=\E0P:ue=\E0@:us=\E0`:se=\E0@:ug#1:sg#1:tc=regent25: a5|regent40+|Adds Regent 40+:is=\EB:tc=regent40: a6|regent60|regent200|Adds Regent 60:se=\ER\E0@\EV:so=\ER\E0P\EV:dc=\EE:ei=\EF:\ :im=\EF:is=\EV\EB:ko=dc,im,ei:tc=regent40+: a7|regent60na|regent 60 w/no arrow keys:\ kl@:kr@:ku@:kd@:tc=regent60: # # adds viewpoint 90 - from cornell # Note: emacs sends ei occasionally to insure the terminal is out of # insert mode. This unfortunately puts the viewpoint90 IN insert # mode. A hack to get around this is: ic=\EF \EF^U. (Also, # - ei=:im=: must be present.) # - xs indicates glich that attributes stick to location # - bs save to move in standout mode # - cl=\EG\Ek clears screen and visual attributes without affecting # the status line a9|vp90|viewpoint90|adds viewpoint 90:\ :bs:bw:cd=\Ek:ce=\EK:cl=\EG\Ek:cm=\EY%+ %+ :co#80:\ :dc=\EE:dl=\El:dm=:do=^J:ed=:ei=:im=:ic=\EF \EF^U:ho=\EY :\ :nd=^F:up=^Z:\ :kb=^H:kd=^J:kh=^A:kl=^U:kr=^F:ku=^Z:li#24:ll=^A:\ :so=\ER\E0Q\EV:se=\ER\E0@\EV:\ :us=\ER\E0`\EV:ue=\ER\E0@\EV:\ :xs:ms: # Note: if return acts weird on a980, check internal switch #2 # on the top chip on the CONTROL pc board. ac|a980|adds consul 980:\ :do=^J:al=13\E^N:am:le=^H:bs:cl=^L\200^K@:cm=^K%+@\E^E%2:co#80:\ :dl=13\E^O:k0=\E0:k1=\E1:k2=\E2:k3=\E3:k4=\E4:k5=\E5:k6=\E6:k7=\E7:\ :k8=\E8:k9=\E9:li#24:nd=\E^E01:so=^Y^^^N:se=^O:up=9: as|viewpt60|viewpoint60|addsviewpoint60|adds viewpoint60:\ :tc=regent40: # From Onyx:edward Thu Jul 9 09:27:33 1981 av|viewpoint|addsviewpoint|adds viewpoint:\ :do=^J:am:le=^H:bs:li#24:co#80:cm=\EY%+ %+ :cd=\Ek:ce=\EK:\ :up=^Z:cl=^L:ll=^A:kl=^U:kd=^J:ku=^Z:kh=^A:\ :so=^N:se=^O:us=^N:ue=^O:is=^O\E0`:vs=^O\E0P:ve=^O\E0`: # # -------------------------------- # # b: BEEHIVE # # Reports are that most of these Beehive entries (except superbee) have not been # tested and do not work right. se is a trouble spot. Be warned. b2|sb2|sb3|fixed superbee:\ :xb@:tc=superbee: # set tab is ^F, clear (one) tab is ^V, no way to clear all tabs. # good grief - does this entry make sg/ug when it doesn't have to? # look at those spaces in se/so. Seems strange to me... bh|bh3m|beehiveIIIm:\ :if=/usr/lib/tabset/beehive:do=^J:\ :al=160^S:am:le=^H:bs:cd=^R:ce=^P:cl=^E^R:\ :co#80:dl=350^Q:ho=^E:li#20:ll=^E^K:\ :nd=^L:pt:se= ^_:so=^] :up=^K: # This loses on lines > 80 chars long, use at your own risk bi|superbeeic|super bee with insert char:\ :ic=:im=\EQ:ei=\ER:tc=superbee: bm|microb|microbee|micro bee series:\ :do=^J:am:le=^H:bs:cd=\EJ:ce=\EK:cl=\EE:co#80:cm=\EF%+ %+ :\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:k9=\Ex:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:\ :li#24:nd=\EC:pt:se=\Ed@ :so= \EdP:ue=\Ed@:up=\EA:us=\Ed`: # Superbee - f1=escape, f2=^C. # Note: there are at least 3 kinds of superbees in the world. The sb1 # holds onto escapes and botches ^C's. The sb2 is the best of the 3. # The sb3 puts garbage on the bottom of the screen when you scroll with # the switch in the back set to CRLF instead of AEP. This description # is tested on the sb2 but should work on all with either switch setting. # The f1/f2 business is for the sb1 and the :xb: can be taken out for # the other two if you want to try to hit that tiny escape key. # This description is tricky: being able to use cm depends on there being # 2048 bytes of memory and the hairy nl string. bs|sb1|superbee|superb|beehive super bee:\ :ct=\E3:st=\E1:is=\EH\EJ:do=^J:\ :sf=\n\200\200\200\n\200\200\200\EA\EK\200\200\200\ET\ET:\ :am:le=^H:bs:cd=3\EJ:ce=3\EK:cl=3\EH\EJ:co#80:cm=\EF%r%3%3:cr=1000\r:\ :dC#10:da:db:xb:dc=3\EP:dl=100\EM:so=\E_1:se=\E_3:\ :li#25:nl=\n\200\200\200\n\200\200\200\EA\EK\200\200\200\ET\ET:\ :nd=\EC:pt:up=\EA:ho=\EH:ve=\n:\ :k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:k8=\Ew:\ :kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA: # 8675, 8686, and bee from Cyrus Rahman b7|8675|harris 8675:\ :k1=^F:k2=^P:k3=^N:k4=^V:k5=^J:k6=^T:k7=^H:k8=\177:k9=\Ee:k10=\Ed:\ :k11=^W:k12=\ER:k13=\EE:k14=\EI:k15=\Ei:k16=\Eg:\ :is=\ES\E#\E*\Eh\Em\E?\E1\E9\E@\EX\EU:\ :tc=bee: b8|8686|harris 8686:\ :k1=^B^[p^C:k2=^B^[q^C:k3=^B^[r^C:k4=^B^[s^C:k5=\E3:\ :k6=\EI:k7=\ER:k8=\EJ:k9=\E(:k10=\Ej:k11=\EW:\ :k12=^B^[{^C:k13=^B^[|^C:k14=^B^[}^C:k15=^B^[~^C:k16=^B^[\177^C:\ :is=\ES\E#\E*\Eh\Em\E?\E1\E9\E@\EX\EU\E"*Z01\ \E"8F35021B7C83#\E"8F45021B7D83#\E"8F55021B7E83#\E"8F65021B7F83#\ \E"8F75021B7383#\E"8F851BD7#\E"8F95021B7083#\E"8FA5021B7183#\ \E"8FB5021B7283#:\ :tc=bee: be|bee|harris beehive:\ :co#80:li#24:am:bs:cd=\EJ:ce=\EK:cl=\EE:nd=\EC:\ :cm=\EF%+ %+ :up=\EA:do=\EB:ho=\EH:bt=\E>:\ :al=\EL:dc=\EP:dl=\EM:ei=\E@:im=\EQ:ic=:mi:\ :kl=\ED:kr=\EC:ku=\EA:kd=\EB:kh=\EH:kb=^H:\ :us=\Ed`:ue=\Ed@:so=\EdP:se=\Ed@:\ :ko=al,bt,ce,cl,dc,dl,ei,ho,ic,im: # # -------------------------------- # # c: CONCEPT (HUMAN DESIGNED SYSTEMS) # # From vax135!hpk Sat Jun 27 07:41:20 1981 # Extensive changes to c108 by arpavax:eric Feb 1982 # # There seem to be a number of different versions of the C108 PROMS # (with bug fixes in its Z-80 program). # The first one that we had would lock out the keyboard of you # sent lots of short lines (like /usr/dict/words) at 9600 baud. # Try that on your C108 and see if it sends a ^S when you type it. # If so, you have an old version of the PROMs. # The old one also messed up running vi with a 132-character line-length. # You should configure the C108 to send ^S/^Q before running this. # It is much faster (at 9600 baud) than the c100 because the delays # are not fixed. # new status line display entries for c108: # hs - has status capability # es - escape sequences are OK on status line # i2 - second init str - setup term for status display - set programmer mode, # select window 2, define window at last line of memory, # set bkgnd stat mesg there, select window 0. # ts - to status line - select window 2, home cursor, erase to end-of-window, # 1/2 bright on, goto(line#0, col#?) # fs - from status line - 1/2 bright off, select window 0 # ds - disable status display - set bkgnd status mesg with illegal window # # # the following two entries are for emacs -- they are just like the regular # entries except that they have buffer overflow control OFF c0|e108-8p:\ :i2=\EU\E z"\Ev^A\177 !p\E ;"\E z \Ev ^A\177p\Ep\n:\ :te=\Ev ^A\177p\Ep\r\n:tc=e108-4p: c1|e108-4p:\ :is=\EU\E f\Ef\E7\E5\E8\El\ENH\EK\E\200\Eo&\200\Eo\47\E\E!\E^G!\E^HA@ :\ :tc=c108-4p: c6|c108-na|c108-na-8p|concept108-na-8p|concept 108 w/8 pages, no arrows:\ :ks@:ke@:k7=\E;:k8=\E<:k9=\E=:tc=c108-8p c7|c108-rv-na|c108-rv-na-8p|concept 108 w/8 pages, no arrows in rev video:\ :ts=\E z"\E?\E^C\EE\Ea %+ :fs=\Ee\E z :\ :ks@:ke@:k7=\E;:k8=\E<:k9=\E=:tc=c108-rv-8p # this needs new frotz in the cm capability for 2-char addrs when > 95.... c8|c108-w|c108-w-8p|concept108-w-8p|concept 108 w/8 pages in wide mode:\ :is=\EU\E F\Ef\E7\E5\E8\El\ENH\EK\E\200\Eo&\200\Eo\47\E\E"\E^G!\E^HA@ :\ :ti=\EU\Ev 8^AD\Ep\r:te=\Ev ^A0^AD\Ep\r\n:pt@:cm@:\ :co#132:tc=c108-8p cA|avt-w|avtw|HDS concept avt w/4 or 8 pages; 132 columns:\ :is=\E[1*q\E[2!t\E[7!t\E[=4;101;119l\E[=103;107;118;207h\E)1\E[1Q\EW\E[7!y\E[0\0720\07232!r\E[w\E2\r\n:\ :ch=\E[%i%3G:cm=\E[%i%2;%3H:co#132:tc=avt: # # Concepts have only window relative cursor addressing, not screen relative. # To get it to work right here, ti/te (which were invented for the concept) # lock you into a one page window for screen style programs. To get out of # the one page window, we use a clever trick: we set the window size to zero # ("\Ev " in te) which the terminal recognizes as an error and resets the # window to all of memory. # # Some tty drivers use cr3 for concept, others use nl3, hence dN/dC below. # This padding is only needed at 9600 baud. # 2 nulls padding on te isn't always enough. 6 works fine. Maybe less # than 6 but more than 2 will work. cc|c100-rv-na|c100-rv-4p-na|concept100-rv-na|c100rv4pna|c100 with no arrows:\ :ks@:ke@:tc=c100-rv: # This is useful at 1200 baud. ce|c100-s|concept-s|concept100-s|slow concept 100:\ :vb=\Ek\200\EK:pt:dC@:dN@:tc=c100: cf|c100-rv-s|concept-rv-s|concept100-rv-s|c100rvs|slow reverse concept 100:\ :vb=\EK\200\Ek:pt:dC@:dN@:tc=c100-rv: # # -------------------------------- # # d: DEC (DIGITAL EQUIPMENT CORPORATION) # # Note that xn glitch in vt100 is not quite the same as concept, since # the cursor is left in a different position while in the weird state # (concept at beginning of next line, vt100 at end of this line) so # all versions of vi before 3.7 don't handle xn right on vt100. # I assume you have smooth scroll off or are at a slow enough baud # rate that it doesn't matter (1200? or less). Also this assumes # that you set auto-nl to "on", if you set it off use vt100-nam below. # # Since there are two things here called vt100, the installer can make # a local decision to make either one standard "vt100" by including # it in the list of terminals in reorder, since the first vt100 in # /etc/termcap is the one that it will find. The choice is between # nam (no automatic margins) and am (automatic margins), as determined # by the wrapline switch (group 3 #2). I presonally recommend turning # on the bit and using vt100-am, since having stuff hammer on the right # margin is sort of hard to read. However, the xn glitch does not occur # if you turn the bit off. # # I am unsure about the padding requirements listed here. I have heard # a claim that the vt100 needs no padding. It's possible that it needs # padding only if the xon/xoff switch is off. For UNIX, this switch # should probably be on. # # The vt100 uses rs and rf rather than is/ct/st because the tab settings # are in non-volatile memory and don't need to be reset upon login. # You can type "reset" to get them set. dp|vt100-np|vt100 with no padding (for psl games):\ :cl=\E[H\E[2J:sr=\EM:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :md=\E[1m:mr=\E[7m:mb=\E[5m:me=\E[m:tc=vt100: d1|vt100-nam|vt100nam|vt100 w/no am:\ :am@:xn@:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:ks=\E[?1h\E=:ke=\E[?1l\E>:\ :tc=vt100-am: d2|gt42|dec gt42:\ :do=^J:le=^H:bs:co#72:ns:li#40:os: d3|vt132|vt132:\ :al=99\E[L:dl=99\E[M:ip=7:dc=7\E[P:ei=\E[4l:im=\E[4h:xn:dN#30:tc=vt100: d4|gt40|dec gt40:\ :do=^J:le=^H:bs:co#72:ns:li#30:os: d5|vt50|dec vt50:\ :do=^J:le=^H:bs:cd=\EJ:ce=\EK:cl=\EH\EJ:co#80:li#12:nd=\EC:pt:up=\EA: d6|vt125|vt125-am|DEC vt125:\ :xn:do=^J:co#80:li#24:cl=50\E[H\E[2J:dC=10:dN=10:\ :le=^H:am:bs:cm=5\E[%i%d;%dH:nd=2\E[C:up=2\E[A:ce=3\E[K:cd=50\E[J:\ :so=2\E[7m:se=2\E[m:us=2\E[4m:ue=2\E[m:md=2\E[1m:mr=2\E[7m:mb=2\E[5m:\ :me=2\E[m:is=\E[1;24r\E[24;1H\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :ks=\E[?1h\E=:ke=\E[?1l\E>:if=/usr/lib/tabset/vt100:ku=\EOA:kd=\EOB:\ :kr=\EOC:kl=\EOD:kb=^H:ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :pt:sr=5\EM:vt#3:sc=\E7:rc=\E8:cs=\E[%i%d;%dr: d9|vt125-nam|DEC vt125 no automatic margin:\ :am@:tc=vt125-am: # DEC gigi color graphic terminal, same as vt52 d7|gigi|dec gigi terminal:\ :co#80:is=200\E>\E[?4l\E[?5l\E[?7h\E[?8h:\ :li#24:cl=100\E[;H\E[2J:bs:cm=50\E[%i%2;%2H:nd=200\E[C:up=100\E[A:\ :ce=120\E[K:cd=100\E[J:so=20\E[7m:se=20\E[m:us=20\E[4m:ue=20\E[m:\ :ks=200\E[?1h\E=:ke=200\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:\ :kh=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:pt:sr=200\EM:\ :dC=50:dF=200:dN=50:dT=50: dI|dw1|decwriter I:\ :do=^J:le=^H:bs:co#72:hc:os: # From tut@Topaz.CC Thu May 12 14:49:02 1983 dJ|dw3|la120|decwriter III:\ :bs:kb=^H:co#132:hc:os:pt:\ :is=\E(B\E[20l\E[w\E[1;132s\E[2g\E[9;17;25;33;41;49;57;65;73;81;89;97;105;113;121;129u\E[z\E[66t\E[1;66r\E[4g\E>\r: # From tut@topaz.CC Thu Sep 24 22:10:46 1981 df|dw4|decwriter IV:\ :do=^J:le=^H:bs:co#132:hc:os:am:\ :pt:is=\Ec:k0=\EOP:k1=\EOQ:k2=\EOR:k3=\EOS:kb=^H: dh|vt50h|dec vt50h:\ :do=^J:le=^H:bs:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :co#80:li#12:nd=\EC:pt:sr=\EI:up=\EA: di|vt100-s|vt100 with status line at top:\ :li#23:i2=\E[2;24r\E[24;1H:cm@:ho=\E[H^J:cl=50\E[;H^J\E[0J:\ :hs:es:ts=\E7\E[1;%dH\E[1K:fs=\E8:tc=vt100-am: dj|vt100-s-bot|vt100 with status line at bottom:\ :li#23:i2=\E[1;23r\E[23;1H:\ :hs:es:ts=\E7\E[24;%dH\E[1K:fs=\E8:tc=vt100-am: ds|vt100-nav|dec vt100 132 cols 14 lines (w/o advanced video option):\ :li#14:tc=vt100-w: dt|vt100-w|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: dv|vt100-w-nam|dec vt100 132 cols (w/advanced video), no am:\ :co#132:li#24:rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:vt@:tc=vt100-nam: d8|vt102|vt100 w/adv. video:\ :al=\E[1L:dl=\E[1M:im=\E[4h:ei=\E[4l:mi:dc=\E[1P:ku=\EOA:kd=\EOB:\ :kr=\EOC:kl=\EOD:k0=\EOp:k1=\EOq:k2=\EOr:k3=\EOs:k4=\EOt:k5=\EOu:\ :k6=\EOv:k7=\EOw:k8=\EOx:k9=\EOy:as=\E(0:ae=\E(B:am@:xn@:tc=vt100am: # (from lai@decwrl) should be a vt102, but have heard enough # unsubstantiated complaints to make it an alternate (obsolete) version dy|vt102-obs|dec vt102:\ :do=^J:co#80:li#24:cl=50\E[;H\E[2J:\ :le=^H:bs:cm=5\E[%i%d;%dH:nd=2\E[C:up=2\E[A:\ :ce=3\E[K:cd=50\E[J:so=2\E[7m:se=2\E[m:us=2\E[4m:ue=2\E[m:\ :md=2\E[1m:mr=2\E[7m:mb=2\E[5m:me=2\E[m:is=\E[1;24r\E[24;1H:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:ks=\E[?1h\E=:ke=\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:kb=^H:\ :ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:pt:sr=5\EM:vt#3:\ :sc=\E7:rc=\E8:cs=\E[%i%d;%dr:vs=\E[?7l:ve=\E[?7h: dw|vt52|dec vt52:\ :do=^J:le=^H:bs:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :co#80:li#24:\ :nd=\EC:pt:sr=\EI:up=\EA:ku=\EA:kd=\EB:kr=\EC:kl=\ED:kb=^H: # vt61 created by Roger Sacilotto Massachusetts Computer Associates, Inc # Similar to vt52 but add al and dl # dq|vt61|dec vt61:\ :al=\EPf:dl=\EPd:tc=vt52: dx|dw2|decwriter II:\ :do=^J:kb=^h:le=^H:bs:co#132:hc:os: # DEC PRO-350 console (VT220-style) dP|pro350|decpro|dec pro console:\ :bs:cd=\EJ:ce=\EK:cl=\EH\EJ:\ :cm=\EY%+ %+ :co#80:ho=\EH:\ :kl=\ED:kr=\EC:ku=\EA:kd=\EB:kh=\EH:\ :k0=\EE:k1=\EF:k2=\EG:k3=\EH:k4=\EI:k5=\EJ:k6=\Ei:k7=\Ej:\ :li#24:nd=\EC:pt:sr=\EI:up=\EA:do=\EB:\ :se=\E^N:so=\E^H:us=\E^D:ue=\E^C:\ :ae=\EG:as=\EF: # # From: Bracy H. Elton dm|vt200-ss|vt220-ss|dec vt200 series with smooth scroll:\ :is=\E>\E[?3l\E[?4h\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3l\E[?4h\E[?5l\E[?7h\E[?8h:\ :tc=vt200: dn|vt200-w|vt220-w|vt200-wj|vt220-wj|dec vt200 series; 132 col.; jump scroll:\ :is=\E>\E[?3h\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3h\E[?4l\E[?5l\E[?7h\E[?8h:\ :co#132:tc=vt200: do|vt200-ws|vt220-ws|dec vt200 series; 132 col.; smooth scroll:\ :is=\E>\E[?3h\E[?4h\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3h\E[?4h\E[?5l\E[?7h\E[?8h:\ :co#132:tc=vt200: dl|vt300|vt320|vt340|dec vt300 series with jump scroll:\ :im=\E[4h:ei=\E[4l:mi:dc=\E[P:dm=:ed=:al=\E[L:\ :cs=\E[%i%d;%dr:sf=\ED:sr=\EM:sb=\EM:\ :ce=\E[K:cl=\E[H\E[J:cd=\E[J:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :so=\E[7m:se=\E[27m:us=\E[4m:ue=\E[24m:\ :md=\E[1m:mr=\E[7m:mb=\E[5m:me=\E[m:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :tc=vt100: # @(#)termcap X10/6.6 11/7/86, minus alternate screen, plus :cs # vs100 emulator using tsim (from lai@decwrl) vt|vs100t|tsim|vs100-tsim:\ :bs:cm=\EM%+ %+ :ho=\EH:do=^J:up=^K:cl=\EE:ce=\EL:cs=\ES%+ %+ :\ :so=\Eh:se=\Er:us=\Eu:ue=\Ev:al=\EI:Al=\E+%+ :dl=\ED:Dl=\E-%+ :\ :ic=\Ei:dc=\Ed:is=\ER:rs=\ER:am:cd=\EQ:pt:nd=\En:li#24:co#80: # # -------------------------------- # # h: HEWLETT PACKARD # # Note: no "ho" on HP's since that homes to top of memory, not screen. # Due to severe 2621 braindamage, the only way to get the arrow keys to # transmit anything at all is to turn on the function key labels # (f1-f8) with ks, and even then the poor user has to hold down shift! # The default 2621 turns off the labels except when it has to to enable # the function keys. If your installation prefers labels on all the time, # or off all the time (at the "expense" of the function keys) move the # 2621-nl or 2621-wl labels to the front using reorder. # Note: there are newer ROM's for 2621's that allow you to set strap A # so the regular arrow keys xmit \EA, etc, as with the 2645. However, # even with this strap set, the terminal stops xmitting if you reset it, # until you unset and reset the strap! Since there is no way to set/unset # the strap with an escape sequence, we don't use it in the default. # If you like, you can use 2621-ba (braindamaged arrow keys). h1|2621-ba|2621 w/new rom, strap A set:\ :ks@:ke@:ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\Eh:tc=hp2621: # 2621 with function labels. Most of the time they are off, # but inside vi, the function key labels appear. You have to # hold down shift to get them to xmit. # 2621k45: untested # 2622: unsure if this is quite it, have only heard about the terminal. h3|2621k45|hp2621k45|k45|2622|hp2622|hp 2621 with 45 keyboard:\ :kb=^H:ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\Eh:ks=\E&s1A:ke=\E&s0A:tc=2621: h5|hp|hewlett-packard:\ :ct=\E3:st=\E1:do=^J:al=\EL:am:le=^H:bs:\ :cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\EH\EJ:cm=6\E&a%r%dc%dY:\ :co#80:cv=\E&a%dY:da:db:dc=\EP:dl=\EM:ei=\ER:im=\EQ:\ :kb=^H:li#24:mi:nd=\EC:pt:se=\E&d@:so=\E&dJ:\ :us=\E&dD:ue=\E&d@:up=\EA:xs:vt#6:pb#9600: # This entry does not use any of the fancy windowing stuff of the 2621. # Indeed, termcap does not yet handle such stuff. We are looking at it. h6|hp2626|hp2626a|hp2626p|2626|2626a|2626p|hp 2626:\ :dc=2\EP:ip=2:se=\E&d@:so=\E&dB:cd=500\EJ:\ :mr=\E&dB:us=\E&dD:mb=\E&dA:mk=\E&dS:me=\E&d@:ue=\E&d@:\ :kh=\Eh:ku=\EA:kl=\ED:kr=\EC:kd=\EB:ks=\E&s1A:ke=\E&s0A:\ :sf=\ES:ta=2^I:xs:tc=2621: # cD is a pain - but it only screws up at 9600 baud. # You should use this terminal at 4800 baud or less. h8|hp2648|hp2648a|2648a|2648|HP 2648a graphics terminal:\ :cl=50\EH\EJ:cm=20\E&a%r%dc%dY:dc=7\EP:ip=5:tc=2645: # This terminal should be used at 4800 baud or less. h9|hp2645-np|2645 w/no padding:cm=\E&a%r%dc%dY:tc=hp2645: # 2640a doesn't have the Y cursor addressing feature, and C is memory relative # instead of screen relative, as we need. ha|2640|hp2640a|2640a|hp 2640a:\ :cm@:ks@:ke@:tc=2645: hb|2640b|hp2640b|2644a|hp2644a|hp 264x series:\ :ks@:ke@:tc=2645: # 2621 using all 48 lines of memory, only 24 visible at any time. Untested. hl|2621-48|48 line 2621:\ :li#48:ho=\EH:cm=\E&a%r%dc%dR:tc=2621: # Hp 110 computer is the same as 2621 except has 16 lines hm|hp110|110|hp 110 computer:\ :li#16:tc=2621: # 2621 with no labels ever. Also prevents vi delays on escape. # Needed for UCB ARPAVAX console, since lsi-11 expands tabs (wrong). ht|hp2621-nt|2621nt|2621-nt|hp2621nt|hp 2621 w/no tabs:\ :pt@:tc=hp2621: # 2621 with labels on all the time - normal outside vi, function inside vi. hw|hp2621wl|2621wl|2621-wl|hp2621-wl|hp 2621 w/labels:\ :is=\E&jA\r:ke=\E&jA:tc=hp2621-fl: # 2392 (from haddix@arpa?) hz|2392|hp2392|hp2392a:\ :bt=\Ei:ip=2:is=\E&j@\E3\r:if=/usr/lib/tabset/stdcrt:\ :ml=\El:MT:mu=\Em:km:\ :mh=\E&dH:mr=\E&dB:us=\E&dD:mb=\E&dA:me=\E&d@:\ :ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\Eh:ks=\E&s1A:ke=\E&s0A:tc=hp: #HP 236 console #from ddavis@ic.berkeley.edu h7|236|hp236|HP236 internal terminal emulator:\ :am:bs:li#24:co#80:cl=\EF:cm=\EE%+ %+ :\ :dc=\EJ:dl=\EH:ic=\EI:al=\EG:up=^K:im=:ei=:\ :so=\EBI:se=\ECI:vs=\EDB:ve=\EDE: # hp150 from ddavis@ic.berkeley.edu h0|150|hp150|hp150a|150a:\ :is=\E&s1A\E&f0a1k2L\Ep\r\E&k0K\E&f0a2k2L\Eq\r\E&f0a3k2L\Er\r\E&f0a4k2L\Es\r\E&f0a5k2L\Et\r\E&f0a6k2L\Eu\r\E&f0a7k2L\Ev\r\E&f0a8k2L\Ew\r\E&k0D\E&s0A:\ :bt=\Ei:li#24:cm=\E&a%r%dc%dY:dc=2\EP:ip=2:pb#19200:so=\E&dJ:\ :se=\E&d@:us=\E&dD:ue=\E&d@:me=\E&d@:kh=\Eh:ku=\EA:kl=\ED:kr=\EC:\ :kd=\EB:kn#8:k1=\Ep:k2=\Eq:k3=\Er:k4=\Es:k5=\Et:k6=\Eu:k7=\Ev:\ :k8=\Ew:ta=2^I:ct=\E3:st=\E1:do=^J:al=\EL:am:le=^H:\ :bs:cd=\EJ:ce=\EK:ch=\E&a%dC:cl=\Eh\EJ:co#80:cv=\E&a%dY:da:db:dl=\EM:\ :ei=\ER:im=\EQ:kb=^H:mi:nd=\EC:pt:up=\EA:xs:vt#6:sf=\ES:sr=\ET:\ :vs=\E&s1A:ve=\E&s0A:ks=\E&jB\E&j@:ke=\E&j@: # # -------------------------------- # # i: INFOTON (GENERAL TERMINAL) # # Infoton is now called General Terminal Corp. or some such thing. # gt100 sounds like something DEC would come out with. Lets hope they don't. i1|i100|gt100|gt100a|General Terminal 100A (formerly Infoton 100):\ :do=^J:cl=^L:cd=\EJ:ce=\EK:li#24:co#80:\ :al=\EL:dl=\EM:up=\EA:nd=\EC:ho=\EH:cm=\Ef%r%+ %+ :vb=\Eb\Ea:\ :am:le=^H:bs:so=\Eb:se=\Ea: i4|i400|400|infoton 400:\ :do=^J:al=\E[L:am:le=^H:bs:ce=\E[N:cl=\E[2J:cm=%i\E[%3;%3H:co#80:\ :dl=\E[M:li#25:nd=\E[C:up=\E[A:im=\E[4h\E[2Q:ei=\E[4l\E[0Q:\ :dc=\E[4h\E[2Q\E[P\E[4l\E[0Q: ia|addrinfo:\ :do=^J:li#24:co#80:cl=^L:ho=^H:nd=^Y:cd=^K:\ :up=^\:am:le=^Z:bc=^Z:cm=\037%+\377%+\377:ll=^H^\: ik|infotonKAS:\ :do=^J:am:le=^Z:bc=^Z:cd=^K:cl=^L:co#80:li#24:nd=^Y:up=^\:ll=^H^\: # # -------------------------------- # # k: HEATHKIT (ZENITH) # kA|h19-a|h19a|heath-ansi|heathkit-a|heathkit h19 ansi mode:\ :\ :al=1*\E[1L:am:le=^H:bs:cd=\E[J:ce=\E[K:cl=\E[2J:cm=\E[%i%2;%2H:co#80:\ :dc=\E[1P:dl=1*\E[1M:do=\E[1B:ei=\E[4l:ho=\E[H:im=\E[4h:li#24:mi:\ :nd=\E[1C:as=\E[10m:ae=\E[11m:ms:pt:se=\E[0m:so=\E[7m:up=\E[1A:\ :vs=\E[>4h:ve=\E[>4l:kb=^h:ku=\E[1A:kd=\E[1B:kl=\E[1D:kr=\E[1C:\ :kh=\E[H:kn#8:k1=\EOS:k2=\EOT:k3=\EOU:k4=\EOV:k5=\EOW:l6=blue:\ :l7=red:l8=white:k6=\EOP:k7=\EOQ:k8=\EOR:\ :sr=\EM:is=\E<\E[>1;2;3;4;5;6;7;8;9l\E[0m\E[11m\E[?7h: kB|h19-bs|h19bs|heathkit w/keypad shifted:\ :ks=\Et:ke=\Eu:tc=h19-b: #written by David Shewmake, UCSF Medical Information Science #ucbvax!ucsfmis!shewmake #the z29-e entry sucks...but it works with emacs kD|z29-e|zenith 29 hacked for emacs:\ :ip=1.5:ks=\Et:ke=\Eu:vs@:ve@:al=1*\EL:am:le=^H:\ :bs:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :co#80:dc=\EN:dl=1*\EM:\ :do=\EB:ho=\EH:li#24:nd=\EC:as=\EF:ae=\EG:ms:\ :pt:sr=\EI:se=\Eq:so=\Ep:up=\EA:vs=\Ex4:ve=\Ey4:kb=^h:\ :ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\EH:kn#8:k1=\ES:k2=\ET:k3=\EU:\ :k4=\EV:k5=\EW:l6=blue:l7=red:l8=white:k6=\EP:k7=\EQ:k8=\ER:es:hs:\ :ts=\Ej\Ex5\Ex1\EY8%+ \Eo:fs=\Ek\Ey5:ds=\Ey1: # z29 in ansi mode. Assumes that the cursor is in the correct state, and that # the world is stable. `rs' causes the terminal to be reset to the state # indicated by the name. kc -> key click, nkc -> no key click, uc -> underscore # cursor, bc -> block cursor. # from Mike Meyers kF|z29a|z29a-kc-bc|h29a-kc-bc|heath/zenith 29 in ansi mode:\ :do=^J:co#80:li#24:cl=\E[2J:pt:ho=\E[H:\ :le=^H:bs:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:mb=\E[5m:mr=\E7m:\ :ce=\E[K:cd=\E[J:so=\E[7;2m:se=\E[m:us=\E[4m:ue=\E[m:mh=\E[2m:\ :md=\E[2m:mr=\E[7m:mb=\E[5m:me=\E[m:\ :rs=\E<\E[1;24r\E[24;1H\E[?7h\E[>4h\E[>1;2;3;5;6;7;8;9l\E[m\E[11m:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:kb=^H:\ :k1=\EOS:k2=\EOT:k3=\EOU:k4=\EOV:k5=\EOW:k6=\EOP:k7=\EOQ:k8=\EOR:\ :k9=\EOX:k0=\E[~:l0=help:kn#2:ko=ho,cd:if=/usr/lib/tabset/zenith29:\ :es:hs:ts=\E[s\E[>5;1h\E[25;%i%dH\E[1K:fs=\E[u\E[>5l:ds=\E[>1l:\ :cs=\E[%i%d;%dr:sr=\EM:sf=\ED:DO=\E[%dB:UP=\E[%dA:LE=\E[%dD:\ :RI=\E[%dC:AL=\E[%dL:DL=\E[%dM:sc=\E[s:rc=\E[r:dc=\E[1P:DC=\E[%dP:\ :kC=\E[J:ct=\E[3g:st=\EH:ti=\E[?7l:te=\E[?7h:ps=\E#7: kG|z29a-kc-uc|h29a-kc-uc|heath/zenith 29 in ansi mode:\ :rs=\E<\E[1;24r\E[24;1H\E[?7h\E[>1;2;3;4;5;6;7;8;9l\E[m\E[11m:\ :tc=z29a: kH|z29a-nkc-bc|h29a-nkc-bc|heath/zenith 29 in ansi mode:\ :rs=\E<\E[1;24r\E[24;1H\E[?7h\E[>2;4h\E[>1;3;5;6;7;8;9l\E[m\E[11m:\ :tc=z29a: kI|z29a-nkc-uc|h29a-nkc-uc|heath/zenith 29 in ansi mode:\ :rs=\E<\E[1;24r\E[24;1H\E[?7h\E[>2h\E[>1;3;4;5;6;7;8;9l\E[m\E[11m:\ :tc=z29a: #z100 entry from Brad Brahms at TRW (Brahms@USC-ECLC) # usenet: {decvax,ucbvax}!trwrb!trwspp!brahms kc|z100|h100|z110|z-100|h-100|heath/zenith z-100 pc with color monitor:\ :vs=\Ex4\Em71:ve=\Ey4\Em70:tc=z100bw: kY|z100bw|h100bw|z110bw|z-100bw|h-100bw|heath/zenith z-100 pc:\ :al=5*\EL:bs:cd=\EJ:ce=\EK:cl=5*\EE:cm=1*\EY%+ %+ :co#80:dc=1*\EN:\ :dl=5*\EM:do=\EB:ei=\EO:ho=\EH:im=\E@:li#24:mi:nd=\EC:as=\EF:ae=\EG:\ :ms:pt:sr=\EI:se=\Eq:so=\Ep:up=\EA:vs=\Ex4:ve=\Ey4:\ :kb=^h:ku=\EA:kd=\EB:kl=\ED:kr=\EC:kh=\EH:kn#10:\ :k0=\EJ:k1=\ES:k2=\ET:k3=\EU:k4=\EV:k5=\EW:\k6=\EP:k7=\EQ:\ :k8=\ER:k9=\EOI: kp|p19:\ :al=2*\EL:dl=2*\EM:tc=h19-b: # from ucscc!B.fiatlux@ucbvax.berkeley.edu zx|ztx|ztx11|zt-1|htx11|ztx-1-a|ztx-10/11:\ :al=\EL:am:bs:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :co#80:\ :dl=\EM:do=^J:ho=\EH:is=\Ej\EH\Eq\Ek\Ev\Ey1\Ey5\EG\Ey8\Ey9\Ey>:\ :k0=\ES:k1=\EB:k2=\EU:k3=\EV:k4=\EW:k5=\EP:k6=\EQ:k7=\ER:kb=^H:kd=\EB:\ :kl=\ED:kr=\EC:ku=\EA:le=^H:li#24:nd=\EC:pt:se=\Eq:so=\Es5:\ :sr=\EI:sr=\EI:ue=\Eq:up=\EA:us=\Es2:\ :es:hs:ts=\Ej\Ex5\Ex1\EY8%+ \Eo:fs=\Ek\Ey5:ds=\Ey1: # # -------------------------------- # # l: LEAR SIEGLER (ADM) # # If the adm31 gives you trouble with standout mode, check the DIP switch # in position 6, bank @c11, 25% from back end of pc. Should be OFF. # If there is no such switch, you have an old adm31 and must use oadm31 l2|adm2|lsi adm2:\ :do=^J:al=\EE:am:le=^H:bs:cd=\EY:ce=\ET:cl=\E;:\ :cm=\E=%+ %+ :co#80:dc=\EW:dl=\ER:\ :ei=:ho=^^:ic=\EQ:im=:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:li#24:nd=^L:up=^K: l4|adm42|42|lsi adm42:\ :vs=\EC\E3 \E3(:do=^J:al=270\EE:am:le=^H:bs:cd=\EY:ce=\ET:cl=\E;:\ :cm=\E=%+ %+ :co#80:dc=\EW:dl=\ER:ei=\Er:im=\Eq:ip=6*:li#24:\ :bt=\EI:nd=^L:se=\EG0:so=\EG4:up=^k:ma=^K^P:pc=\177: l5|adm5|5|lsi adm5:\ :do=^J:cd=\EY:ce=\ET:do=^J:kb=^H:kh=^^:\ :ma=^Hh^Jj^Kk^Ll^^H:se=\EG:sg#1:so=\EG:tc=adm3aplus: l7|adm20|lear siegler adm20:\ :am:li#24:co#80:bs:cl=^Z:cm=\E=%i%r%+^_%+^_:nd=^L:up=^K:ho=^^:ce=\ET:\ :cd=\EY:al=\EE:dl=\ER:im=:ei=:ic=\EQ:dm=:ed=:dc=\EW:so=\E):se=\E(:\ :bt=\EI:pt:kn#7:k1=^A:k2=^B:k3=^W:k4=^D:k5=^E:k6:^X:k7=^Z: # From Andrew Scott Beals l8|adm12|12|lsi adm12:\ :is=\Eq:do=^J:al=\EE:am:le=^H:bs:ce=\ET:cm=\E=%+ %+ :cl=^Z:cd=\EY:\ :co#80:dc=\EW:dl=\ER:ei=\Er:ho=^^:im=\Eq:\ :k0=^A0\r:k1=^A1\r:k2=^A2\r:k3=^A3\r:k4=^A4\r:\ :k5=^A5\r:k6=^A6\r:k7=^A7\r:k8=^A8\r:k9=^A9\r:kd=^J:kl=^H:kr=^L:ku=^K:\ :li#24:ma=j^Jk^P^K^Pl ^R^L^L :mi:nd=^L:\ :se=\EG0:so=\EG4:up=^K:us=\EG1:ue=\EG0: lb|adm3a+|3a+|adm3aplus:\ :kl=^H:kd=^J:ku=^K:kr=^L:tc=adm3a: lc|adm22|22|lsi adm22:\ :is=\E%\014\014\014\016\003\000\003\002\003\002\000\000\000\000\000\000\000\000\000\000\000:\ :al=\EE:am:bs:bt=\EI:cd=\Ey:ce=\Et:cl=\E+:cm=\000\E=%+ %+ :co#80:\ :dc=\EW:dl=\ER:do=^J:em=:ho=^^:ic=\EQ:im=:\ :k1=\001@\015:k2=\001A\015:k3=\001B\015:k4=\001C\015:\ :k5=\001D\015:k6=\001E\015:k7=\001F\015:kn#7:\ :ko=ho:l1=F1:l2=F2:l3=F3:l4=F4:l5=F5:l6=F6:l7=F7:\ :kb=^H:kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:li#24:\ :ma=j^Jk^P^K^Pl ^R^L^L :nd=^L:se=\E(:so=\E):ta=\Ei:up=^K: #From: stephen%comp.lancs.ac.uk@ucl-cs.arpa le|adm11|lsi adm11:\ :do=^J:bs:\ :cd=\EY:ce=\ET:kb=^H:kh=^^:\ :ma=^Hh^Jj^Kk^Ll^^H:so=\E):se=\E(:\ :kl=^H:kd=^J:ku=^K:kr=^L:\ :am:cm=\E=%+ %+ :cl=^Z:co#80:li#24:nd=^L:up=^K:\ :hs:ts=\EF\E):fs=\E(^M:ds=\Eh: # # -------------------------------- # # m: MICROTERM # # These mime1 entries refer to the Microterm Mime I or Mime II. # The default mime is assumed to be in enhanced act iv mode. m3|mime3a|mime1 emulating 3a:\ :am@:ma=^X ^K^J^Z^P:ku=^Z:kd=^K:kl=^H:kr=^X:tc=adm3a: m4|microterm|act4|microterm act iv:\ :am:do=^J:le=^H:bs:cd=^_:ce=^^:cl=^L:cm=^T%.%.:\ :co#80:li#24:nd=^X:up=^Z:ho=^]: # The padding on sr and ta for act5 and mime is a guess and not final. # The act 5 has hardware tabs, but they are in columns 8, 16, 24, 32, 41 (!)... m5|microterm5|act5|microterm act v:\ :uc=^H\EA:sr=3\EH:ku=^Z:kd=^K:kl=^H:kr=^X:ma=^Z^P^Xl^Kj:tc=act4: # Act V in split screen mode. act5s is not tested and said not to work. mS|act5s|skinny act5:\ :ti=\EP:te=\EQ:li#48:co#39:tc=act5: # Mimes using brightness for standout. Half bright is really dim unless # you turn up the brightness so far that lines show up on the screen. # uc is disabled to get around a curses bug, should be put back in someday. mf|mime-fb|full bright mime1:\ :so=^Y:se=^S:is=^S\E:tc=mime: mh|mime-hb|half bright mime1:\ :so=^S:se=^Y:is=^Y\E:tc=mime: mm|mime|mime1|mime2|mimei|mimeii|microterm mime1:\ :do=^J:al=80^A:am:le=^H:bs:cd=^_:ce=^^:cl=\035^C:cm=^T%+^X%> 0%+P:\ :co#80:dl=80^W:ta=2^I:li#24:nd=^X:pt:uc=^U:up=^z:ho=\035:do=^K:\ :is=^S\E^Q:ma=^X ^K^J^Z^P:ku=^Z:kd=^K:kl=^H:kr=^X:sr=3^R:vt#9: # These termcaps (for mime 2a) put the terminal in low intensity mode # since high intensity mode is so obnoxious. ms|mime2a-s|microterm mime2a (emulating an enhanced soroc iq120):\ :do=^J:\ :al=20*^A:am:le=^H:bs:cd=20*\EJ:ce=\EK:cl=\EL:cm=\E=%+ %+ :co#80:dc=\ED:\ :dl=20*^W:kl=^H:kr=^L:ku=^K:kd=^J:ho=^^:is=\E):sr=\EI\ :im=\EE:ei=^Z:ip=2:li#24:nd=^L:so=\E\072:se=\E;:up=\EI:\ :us=\E6:ue=\E7: # This is the preferred mode (but ^X can't be used as a kill character) mv|mime2a|mime2a-v|microterm mime2a (emulating an enhanced vt52):\ :do=^J:al=20*^A:le=^H:bs:cd=20*\EQ:co#80:ce=\EP:cl=\EL:cm=\EY%+ %+ :\ :is=^Ydc=^N:dl=20*^W:ip=2:ei=^Z:ho=\EH:im=^O:kd=\EB:kl=\ED:kr=\EC:\ :ku=\EA:li#24:nd=\EC:pt:se=\E9:so=\E8:up=\EA:sr=\EA:us=\E4:ue=\E5: mx|mime3ax|mime-3ax|mime1 emulating enhanced 3a:\ :al=80^A:dl=80^W:pt:ce=^X:cd=^_:tc=mime3a: # # -------------------------------- # # p: PERKIN ELMER # pe|pe550|bantam|perkin elmer 550:\ :do=^J:le=^H:bs:co#80:ce=20\EI:cl=20\EK:cm=\EX%+ \EY%+ :\ :ho=\EH:li#24:ll=\EH\EA:nd=\EC:up=\EA:ma=^Z^P:cd=6^N@^V: pf|fox|perkin elmer 1100:\ :ct=\E3:st=\E1:do=^J:\ :am:le=^H:bs:cd=5.5*\EJ:ce=\EI:cl=132\EH\EJ:co#80:ho=\EH:li#24:\ :ll=\EH\EA:nd=\EC:cm=\EX%+ \EY%+ :up=\EA:vb=^P^B^P^C: po|owl|perkin elmer 1200:\ :ct=\E3:st=\E1:do=^J:al=5.5*\EL:am:le=^H:\ :bs:cd=5.5*\EJ:ce=5.5\EI:cl=132\EH\EJ:ho=\EH:ll=\EH\EA:\ :cm=\EX%+ \EY%+ :co#80:dc=5.5*\EO:dl=5.5*\EM:ei=:ic=\EN:im=:ip=5.5*:\ :kb=^h:in:li#24:nd=\EC:up=\EA:se?=\E!\200:so?=\E!^H:vb=^P^B^P^C:\ :k1=\ERA:k2=\ERB:k3=\ERC:k4=\ERD:k5=\ERE:k6=\ERF:\ :k7=\ERG:k8=\ERH:k9=\ERI:k0=\ERJ: # # -------------------------------- # # q: HOME MADE TERMINALS # qB|bc|bill croft homebrew:\ :do=^J:am:le=^H:bs:cm=\E=%+ %+ :cl=^Z:co#96:ho=^^:li#72:\ :nd=^L:up=^K:vb=: qN|nucterm|rayterm|NUC homebrew:\ :do=^J:am:le=^H:bs:cl=1^L:li#24:co#80:nd=^C:\ :up=^N:ho=^B:ll=^K:ce=^A:cd=^E: qb|ex3000:\ :do=^J:li#24:co#80:ho=^Q: qc|carlock|klc:\ :do=^J:al=^E:am:bs:ce=^U:cl=100^Z:cm=\E=%+ %+ :co#80:dc=\177:dl=^D:\ :dm=:ed=:ei=^T:ho=^^:im=^T:li#24:nd=^L:se=^V:so=^V:up=^K:vb=\EV\EV: # uVAX qd|qdss|qdcons|qdss glass tty:\ :am:do=^J:le=^H:bs:cm=\E=%.%.:cl=1^Z:co#128:li#57::nd=^L:up=^K: qe|exidy|exidy2500|exidy sorcerer as dm2500:\ :do=^J:al=^P^J^X:am:le=^H:bs:ce=^W:cl=^^:cm=^L%r%n%.%.:co#64:\ :dc=\b:dl=^P^Z^X:dm=^P:ed=^X:ei=^X:ho=^B:ic=^\:\ :im=^P:li#30:nd=^\:pt:so=^N:se=^X:up=^Z: qn|netx|netronics:\ :do=^J:le=^H:bs:cd=2000^F^E:ce=1600^E:cl=466^L:cm=\E=%+@%+@:\ :co#64:ho=^D:li#16:ma=j^Jk^Pl :nd=\E+@A:pc=\200:sr=\E=@@^K:up=^K: # This came from the comp ctr who got it from some user. Smart indeed! qs|sexidy|exidy smart:\ :do=^J:li#24:co#64:cl=^l:ho=^q:nd=^s:\ :up=^w:le=^H:bs:le=^a:bc=^a:ma=^x^J:kd=^S: qu|ubell|ubellchar:\ :if=/usr/lib/tabset/ubell:do=^J:am:le=^H:bs:pt:ce=\Ed:cl=^Z:\ :cm=\E=%+ %+ :co#80:li#24:nd=^L:up=^K:ma=j^Jk^P^K^Pl :ho=^^: qw|ttyWilliams:\ :do=^J:co#80:li#12:le=^Y:bc=^Y:do=^K:up=^Z:cl=^^:ce=^_:am:ho=^]:nd=^X: qx|xitex|xitex sct-100:\ :do=^J:le=^H:bs:cd=2000^F^E:ce=1600^E:cl=400^L:cm=\E=%+@%+@:co#64:\ :ho=^D:li#16:ma=j^Jk^Pl :nd=\E+@A:pc=\200:sr=\E=@@^K:up=^K: # # -------------------------------- # # s: SPECIALS # # Special "terminals". These are used to label tty lines when you don't # know what kind of terminal is on it. The characteristics of an unknown # terminal are the lowest common denominator - they look about like a ti 700. # # -------------------------------- # # t: TEXAS INSTRUMENTS # t3|ti|ti700|ti733|735|ti735|ti silent 700:\ :do=^J:le=^H:bs:co#80:hc:os:dC#162: t4|ti745|745|743|ti silent 745:\ :do=^J:le=^H:bs:co#80:hc:os: t8|ti800|ti omni 800:\ :do=^J:le=^H:bs:co#132:hc:os: # From lesleymw@topaz.berkeley.edu t9|ti931|ti 931:\ al=\EN:am:bs:cd=\EJ:ce=\EI:cl=\EL:cm=\EY%+ %+ :co=#80:dl=\EO:do=\EB:\ eo:ho=\EH:li=#24:ku=\EA:kd=\EB:kr=\EC:kl=\ED:mi:nd:sf=\Eb:sr=\Ea:up=\EA: # # -------------------------------- # # v: TELEVIDEO # # There are some tvi's that require incredible amounts of padding and # some that don't. I'm assuming 912 and 920 are the old slow ones, # and 912b, 912c, 920b, 920c are the new ones that don't need padding. v1|tvi912|912|920|tvi920|old televideo:\ :ct=\E3:st=\E1:do=^J:\ :al=33*\EE:le=^H:ce=\ET:cm=\E=%+ %+ :cl=^Z:co#80:dc=\EW:dl=33*\ER:ei=:\ :kb=^H:ku=^K:kd=^J:kl=^H:kr=^L:k0=^AI\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:\ :bs:am:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:\ :ho=^^:im=:ic=\EQ:li#24:nd=^L:pt:se=\Ek:so=\Ej:up=^K:us=\El:ue=\Em:\ :ma=^K^P^L :sg#1:ug#1:if=/usr/lib/tabset/stdcrt # the 912 has a key that's like shift: 8 xmits "^A8\r". # The 920 has this plus real function keys that xmit different things. # Termcap makes you use the funct key on the 912 but the real keys on the 920. v2|912b|912c|tvi912b|tvi912c|tvi|new televideo 912:\ :al=5*\EE:dl=5*\ER:tc=tvi912: v3|920b|920c|tvi920b|tvi920c|new televideo 920:\ :k0=^AI\r:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:\ :k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:al=5*\EE:dl=5*\ER:tc=tvi912: # set to page 1 when entering ex (\E-17 ) # reset to page 0 when exiting ex (\E-07 ) v4|tvi912-2p|tvi920-2p|912-2p|920-2p|tvi-2p|televideo w/2 pages:\ :ti=\E-17 :te=\E-07 :tc=tvi912: v5|tvi950-ap|tvi 950 w/alt pages:\ :is=\E\\1:ti=\E-06 :te=\E-16 :tc=tvi950: v6|tvi950-b|bare tvi950 no is:\ :is@:tc=tvi950: v7|tvi950-ns|tvi950 w/no standout:\ :so@:se@:us@:ue@:tc=tvi950: vi|tvi925|925|televideo model 925:\ :hs:xn:am:bs:co#80:li#24:cm=\E=%+ %+ :cl=\E*:cd=\Ey:ce=\Et:is=\El\E":\ :al=\EE:dl=\ER:im=:ei=:ic=\EQ:dc=\EW:if=/usr/lib/tabset/stdcrt:\ :ho=^^:nd=^L:bt=\EI:pt:so=\EG4:se=\EG0:sg#1:us=\EG8:ue=\EG0:ug#1:\ :up=^K:do=^V:kb=^H:ku=^K:kd=^V:kl=^H:kr=^L:kh=^^:ma=^V^J^L :\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:\ :k8=^AG\r:k9=^AH\r:k0=^AI\r:ko=ic,dc,al,dl,cl,ce,cd,bt:\ :ts=\Ef:fs=^M\Eg:ds=\Eh:sr=\Ej: vj|tvi925vb|925vb|televideo model 925 visual bells:\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :tc=tvi925: # Since the 925's uses a character position to store the escape sequences to go # in and out of both stand out and underline modes, screen positioning is # difficult. The following 925 entries don't use these modes. vn|tvi925n|925n|televideo model 925 no standout or underline:\ :so@:se@:us@:ue@:tc=tvi925: vk|tvi925vbn|925vbn|televideo model 925 visual bells no so or ul:\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :tc=tvi925n: # entry by Tim Curry 5/21/82 Univ. of Central Fla. duke!ucf-cs!tim v9|925a|tvi925a|TeleVideo Model 925:\ :al=\EE:am:bs:bt=\EI:bw:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :co#80:dc=\EW:\ :dl=\ER:do=^V:ei=:ic=\EQ:if=/usr/lib/tabset/std:im=:kb=^H:kd=^V:\ :kh=^^:kl=^H:kn#12:kr=^L:ku=^K:li#24:nd=^L:pt:se=\EG0:sg=#1:so=\EG4:\ :ue=\EG0:ug#1:up=^K:us=\EG8:is=\El\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :ve=\E.4:vs=\E.2: # The following tvi descriptions from B:pjphar and virus!mike # is for all 950's. It sets the following attributes: # full duplex (\EDF) write protect off (\E() # conversation mode (\EC) graphics mode off (\E%) # white on black (\Ed) auto page flip off (\Ew) # turn off status line (\Eg) clear status line (\Ef\r) # normal video (\E0) monitor mode off (\EX or \Eu) # edit mode (\Er) load blank char to space (\Ee\040) # line edit mode (\EO) enable buffer control (^O) # protect mode off (\E\047) duplex edit keys (\El) # program unshifted send key to send line all (\E016) # program shifted send key to send line unprotected (\E004) # set the following to nulls: # field delimiter (\Ex0\200\200) # line delimiter (\Ex1\200\200) # start-protected field delimiter (\Ex2\200\200) # end-protected field delimiter (\Ex3\200\200) # set end of text delimiter to carriage return/null (\Ex4\r\200) # CHANGED 4-29-87 to set tabs and keep status line --John Kunze (jak@opal) va|tvi950|950|televideo950:\ :ct=\E3:st=\E1:do=^J:\ :is=\EDF\EC\Ed\EG0\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \El\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200\Ef\r:if=/usr/lib/tabset/stdcrt:\ :al=\EE:am:le=^H:bs:bt=\EI:cd=\Ey:ce=\Et:cl=\E*:cm=\E=%+ %+ :\ :co#80:dc=\EW:dl=\ER:do=^V:ei=\Er:ho=^^:im=\Eq:k0=^A0\r:\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:\ :k7=^AF\r:k8=^AG\r:k9=^AH\r:kb=^H:kd=^V:kh=^^:kl=^H:\ :ko=ic\054dc\054al\054dl\054cl\054bt\054ce\054cd:kr=^L:\ :ku=^K:li#24:ma=^Vj^Kk^Hh^Ll^^H:mi:ms:nd=^L:pt:se=\EG0:\ :sg#1:so=\EG4:sr=\Ej:ue=\EG0:ug#1:up=^K:us=\EG8:\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :xn:hs:ts=\Eg\Ef:fs=\r:ds=\Eg\Ef\r: # # is for 950 with two pages adds the following: # set 48 line page (\E\\2) # place cursor at page 0, line 24, column 1 (\E-07 ) # set local (no send) edit keys (\Ek) # # two page 950 adds the following: # when entering ex, set 24 line page (\E\\1) # when exiting ex, reset 48 line page (\E\\2) # place cursor at 0,24,1 (\E-07 ) # set duplex (send) edit keys (\El) when entering vi # set local (no send) edit keys (\Ek) when exiting vi # vb|tvi950-2p|950-2p|televideo950 w/2 pages:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200\E\\2\E-07 \ :te=\E\\2\E-07 :ti=\E\\1\E-07 :ks=\El:ke=\Ek:tc=tvi950: # # is for 950 with four pages adds the following: # set 96 line page (\E\\3) # place cursor at page 0, line 24, column 1 (\E-07 ) # # four page 950 adds the following: # when entering ex, set 24 line page (\E\\1) # when exiting ex, reset 96 line page (\E\\3) # place cursor at 0,24,1 (\E-07 ) # vc|tvi950-4p|950-4p|televideo950 w/4 pages:\ :is=\EDF\EC\Ed\EG0\Eg\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200\E\\3\E-07 \ :te=\E\\3\E-07 :ti=\E\\1\E-07 :ks=\El:ke=\Ek:tc=tvi950: # # is for reverse video 950 changes the following: # set reverse video (\Ed) # # set vb accordingly (\Ed ...nulls... \Eb) # vd|tvi950-rv|950-rv|televideo950 rev video:\ :is=\EDF\EC\Eb\EG0\Eg\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \El\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200:\ :vb=\Ed\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Eb:\ :tc=tvi950: # # uses the appropriate entries from 950-2p and 950-rv # ve|tvi950-rv-2p|950-rv-2p|televideo950 rev video w/2 pages:\ :is=\EDF\EC\Eb\EG0\Eg\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200\E\\2\E-07 :\ :vb=\Ed\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Eb:\ :te=\E\\2\E-07 :ti=\E\\1\E-07 :ks=\El:ke=\Ek:tc=tvi950: # # uses the appropriate entries from 950-4p and 950-rv # vf|tvi950-rv-4p|950-rv-4p|televideo950 rev video w/4 pages:\ :is=\EDF\EC\Eb\EG0\Er\EO\E\047\E(\E%\Ew\EX\Ee ^O\ \Ek\E016\E004\Ex0\200\200\Ex1\200\200\Ex2\200\200\ \Ex3\200\200\Ex4\r\200\E\\3\E-07 :\ :vb=\Ed\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Eb:\ :te=\E\\3\E-07 :ti=\E\\1\E-07 :ks=\El:ke=\Ek:tc=tvi950: vg|tvi924|924|televideo model 924:\ :am:bs:xn:co#80:li#24:cm=\E=%+ %+ :cl=\E*0:cd=\Ey:ce=\Et:is=\Ek0\E"^O:\ :al=\EE:dl=\ER:im=:ei=:ic=\EQ:dc=\EW:if=/usr/lib/tabset/stdcrt:ho=^^:\ :nd=^L:bt=\EI:pt:so=\EG4:se=\EG0:us=\EG8:ue=\EG0:up=^K:do=^V:kb=^H:\ :ku=^K:kd=^V:kl=^H:kr=^L:kh=^^:ma=^Vj^Kk^Ll^^H^R^L:k1=^A@\r:k2=^AA\r:\ :k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:\ :k0=^AI\r:ko=ic,dc,al,dl,cl,ce,cd,bt:sr=\Ej:\ :hs:fs=^Y\Es1:ts=\Ef:ds=\Es0\Ef^Y: vo|tvi924vb|924vb|televideo model 924 visual bells:\ :vb=\Eb\200\200\200\200\200\200\200\200\200\200\200\200\200\200\200\Ed:\ :tc=tvi924: # tvipt termcap from armsis@amber (Gene Rochlin), 9/19/84. Works with vi and # rogue. NOTE: Esc v sets autowrap on, Esc u sets 80 char/line (rather than # 40), Esc K chooses the normal character set. Not sure padding is needed, but # adapted from the tvi920c termcap. so and us are klutzy, but at least use no # screen space. vp|tvipt|televideopt:if=/usr/lib/tabset/stdcrt:\ :is=\Ev\Eu\EK:al=5*\EE:am:bs:bt=\EI:ce=\ET:cm=\E=%+ %+ :cl=^Z:co#80:\ :dl=5*\ER:kb=^H:ku=^K:kd=^J:kl=^H:kr=^L:ho=^^:li#24:nd=^L:se=\EF:\ :so=\EG1@A\EH:ue=\EF:us=\EG1B@\EH:up=^K:ma=^Kk^Ll^R^L: # Vanilla tvi910 -- W. Gish (cswarren@violet) 10/29/86 vm|tvi910|910|televideo model 910:if=/usr/lib/tabset/stdcrt:\ :bs:bt=\EI:cd=\EY:ce=\ET:cm=\E=%+ %+ :cl=^Z:co#80:\ :kb=^H:ku=^K:kd=^J:kl=^H:kr=^L:k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:\ :k5=^AD\r:k6=^AE\r:k7=^AF\r:k8=^AG\r:k9=^AH\r:k0=^AI\r:\ :li#24:nd=^L:pt:se=\EG0:so=\EG4:up=^K:us=\EG8:ue=\EG0:\ :ho=\E=\001\001:ma=^Kk^Ll^R^L:sg#1: # from Alan R. Rogers (rogers%albany@csnet-relay) vh|tvi910+|910+|televideo 910+:\ :al=5*\EE:am:bs:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+\040%+\040:\ :co#80:dc=\EW:dl=\ER:do=^J:ei=:ho=^^:ic=\EQ:\ :if=/usr/lib/tabset/stdcrt:im=:k0=^A@\r:k1=^AA\r:k2=^AB\r:k3=^AC\r:\ :k4=^AD\r:k5=^AE\r:k6=^AF\r:k7=^AG\r:k8=^AH\r:k9=^AI\r:kb=^H:\ :kd=^J:kh=^^:kl=^H:kr=^L:ku=^K:li#24:ll=\E=7\040:ma=^K^P^L\040:\ :nd=^L:pt:se=\EG0:sg#1:so=\EG4:ue=\EG0:up=^K:us=\EG8:xn: # From fair@ucbarpa Sun Oct 27 07:21:05 1985 v6|ims950-b|bare ims950 no is:\ :is@:tc=ims950: v7|ims950-ns|ims950 w/no standout:\ :so@:se@:us@:ue@:tc=ims950: va|ims950|ims televideo 950 emulation:\ :k0@:k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:k9@:kb@:kd@:kh@:kl@:ko@:kr@:ku@:\ :vb@:xn@:tc=tvi950: vd|ims950-rv|ims tvi950 rev video:\ :k0@:k1@:k2@:k3@:k4@:k5@:k6@:k7@:k8@:k9@:kb@:kd@:kh@:kl@:ko@:kr@:ku@:\ :vb@:xn@:tc=tvi950-rv: vx|ims-ansi|ultima2|ultimaII|IMS Ultima II:\ :pt:am:bs:co#80:li#24:\ :is=\E[0m\E[>14l\E[?1;?5;20l\E>\E[1m^M:if=/usr/lib/tabset/vt100:\ :cl=\E[;H\E[2J:cd=\E[0J:ce=\E[0K:cm=\E[%i%2;%2H:up=\EM:do=\ED:\ :ku=\E[A:kd=\E[B:kr=\E[C:kl=\E[D:kh=\E[H:\ :so=\E[7m:se=\E[0m\E[1m:us=\E[4m:ue=\E[0m\E[1m:sr=\EM: # # -------------------------------- # # y: TELERAY # # Note two things called "teleray". Reorder should move the common one # to the front if you have either. A dumb teleray with the cursor stuck # on the bottom and no obvious model number is probably a 3700. y1|t3700|teleray|dumb teleray 3700:\ :do=^J:le=^H:bs:cl=^L:co#80:li#24: y3|t3800|teleray 3800 series:\ :do=^J:le=^H:bs:cd=\EJ:ce=\EK:cl=^L:cm=\EY%+ %+ :co#80: \ :do=\n:ho=\EH:li#24:ll=\EY7 :nd=\EC:pt:up=^K: y6|t1061|teleray 1061:\ :if=/usr/lib/tabset/teleray:\ :ct=\EG:st=\EF:do=^J:\ :al=2*\EL:am:le=^H:bs:cd=1\EJ:ce=\EK:cl=1^L:cm=\EY%+ %+ :co#80:\ :dc=\EQ:dl=2*\EM:ei=:ho=\EH:ic=\EP:im=:ip=0.4*:\ :k1=^Z1:k2=^Z2:k3=^Z3:k4=^Z4:k5=^Z5:k6=^Z6:k7=^Z7:k8=^Z8:\ :li#24:nd=\EC:pt:se=\ER@:so= \ERD:\ :is=\Ee\EU01^Z1\EV\EU02^Z2\EV\EU03^Z3\EV\EU04^Z4\EV\EU05^Z5\EV\EU06^Z6\EV\EU07^Z7\EV\EU08^Z8\EV\Ef:\ :up=\EA:us=\ERH:ue=\ER@:xs:xt:sg#2:ug#1: # "Teleray Arpa Special", offically designated as # "Teleray Arpa network model 10" with "Special feature 720". # This is the new (1981) fast microcode updating the older "arpa" proms # (which gave meta-key and pgmmable-fxn keys). 720 is much much faster, # converts the keypad to programmable function keys, and has other goodies. # Standout mode is still broken (magic cookie, etc) so is suppressed as no # programs handle such lossage properly. # Note: this is NOT the old termcap's "t1061f with fast proms." # From Univ of Utah, J.Lepreau Tue Feb 1 06:39:37 1983 # lepreau@utah-cs, harpo!utah-cs!lepreau # y7|t10|teleray 10 special:\ :so@:se@:us@:ue@:\ :al=\EL:bs:cd=\EJ:ce=\EK:cl=30\Ej:cm=\EY%+ %+ :co#80:\ :dc=\EQ:dl=\EM:ei=:ho=\EH:ic=\EP:im=:km:li#24:nd=\EC:pc=\200:pt:\ :se=\ER@:so=\ERD:sf=\Eq:sg#2:sr=\Ep:up=\EA:ug#1:ue=\ER@:us=\ERH:\ :xs:xt: yf|t1061f|teleray 1061 with fast PROMs:\ :al=\EL:ip@:dl=\EM:tc=t1061: # Wyse 50 entry by Toni Guttman extended by Jeff Anton ye|w50|wyse50|Wyse 50:\ :al=\EE:am:bs:bt=\EI:cd=\EY:ce=\ET:cl=^Z:cm=\E=%+ %+ :co#80:\ :dc=\EW:dl=\ER:do=^J:ei=\Er:im=\Eq:is=\E`\072\200\EC\EDF\E0\E'\E(\EA21:\ :kd=^J:kl=^H:kr=^L:ku=^K:li#24:nd=^L:up=^K:us=\EG8:ue=\EG0:\ :so=\EG4:se=\EG0:sg#1:sr=\Ej:ho=^^:ug#1: # it is not known if the status line works with sysline yh|w50-s|wyse50-s|Wyse 50 for sysline:\ :hs:ts=\Ef:fs=\r:ds=\Ef\r:es:tc=w50: yg|w50-w|w50-132|wyse50-132|Wyse 50-132:\ :cm=\Ea%i%dR%dC:co#132:is=\E`;\200\EC\EDF\E0\E'\E(\EA21:tc=w50: w6|w60|wyse60|Wyse 60 in native mode:\ :ae=\EcD:al=\EE:am:as=\EcE:bs:bt=\EI:bw:cd=\Ey:ce=\Et:\ :cl=^Z:cm=\E=%+\040%+\040:co#80:ct=\E0:dc=\EW:dl=\ER:do=^J:\ :ei=\Er:im=\Eq:is=:kb=^?:kd=^N:ke=\E~2:kl=^B:kr=^F:ks=\E~3:ku=^P:\ :le=^H:li#43:ll=^^^K:mb=\EG2:me=\EG0:mh=\EGp:mi:mr=\EG4:ms:\ :nd=^L:pt:se=\EG0:sf=\n:so=\EG4:sr=\Ej:ue=\EG0:up=^K:us=\EG8: # from John Gillmore hoptoad!gnu@lll-crg.arpa wv|wyse-vp|wyse|Wyse 50 in ADDS Viewpoint emulation mode with "enhance" on:\ :am:do=^J:if=/usr/lib/tabset/wyse-adds:\ :le=^H:bs:li#24:co#80:cm=\EY%+ %+ :cd=\Ek:ce=\EK:nd=^F:\ :up=^Z:cl=^L:ho=^A:ll=^A^Z:kl=^U:kr=^F:kd=^J:ku=^Z:kh=^A:\ :pt:so=^N:se=^O:us=^N:ue=^O:dl=\El:al=\EM:im=\Eq:ei=\Er:dc=\EW:\ :is=\E`\072\E`9^O\Er:rs=\E`\072\E`9^O\Er: wk|wyse-vp-nk|Wyse 50 in ADDS Viewpoint enhanced mode with cursor keys gone:\ :kl@:kr@:kd@:ku@:kh@:tc=wyse-vp: vw|wyse925|Wyse-50 emulating tvi925:\ :xn@:tc=tvi925: # wyse 75 series from JLarson.pa@xerox.arpa wx|wyse75|wy75|wyse 75 terminal :\ :co#80:li#24:cl=50\E[H\E[2J:bs:cm=5\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :al=3\E[L:dl=3\E[M:ku=\E[A:kd=\E[B:kr=\E[C:kl=\E[D:do=\E[B:\ :ic=\E[@:ei=:im=:pt:bw:dc=\E[P:ce=3\E[K:ho=10\E[H:pt:\ :mi:nd=\E[C:bt=\E[Z:us=\E[8p:ue=\E[p:so=\E[5m:se=\E[m:\ :md=\E[1p:mr=\E[16p:mb=\E[2p:mk=\E[4p:me=\E[0p:hs:ll=\E[24;1H:\ :cd=50\E[J:cs=9\E[%i%d;%dr:ae=\E(B:as=\E(0:kh=\E[H:kb=^H:\ :k0=\EOP:k1=\EOQ:k2=\EOR:k3=\EOS:k4=\E[M:\ :k5=\E[17~:k6=\E[31~:k7=\E[18~:k8=\E[19~:k9=\E[20~:kn#10:\ :l0=PF1:l1=PF2:l2=PF3:l3=PF4:l4=F5:\ :l5=F6:l6=F7:l7=F8:l8=F9:l9=F10:\ :is=\E[1;24r\E[24;1H\E[35;?25h\E[4;?10;3;1l\E[m\E(B\E>:\ :ds=\E7\E[>,//\E8:ts=\E7\E[>,^A:fs=^A\E8: wx|wyse75-80|wy75-80|wyse 75 terminal with 80-column initialization:\ :is=\E[?3l:tc=wy75: wl|wyse75-132|wy75-132|wyse 75 terminal with 132 columns :\ :is=\E[?3h:co#132:tc=wy75: # # Wyse WY75 utilizing keypad # w5|wy75ap|wyse75ap|wy-75ap|wyse-75ap|Wyse WY-75 Applications and Cursor keypad:\ :is=\E[1;24r\E[?10;3l\E[?1;25h\E[4l\E[m\E(B\E=:\ :kd=\EOB:ke=10\E[?1l\E>:kh=\EOH:kl=\EOD:kr=\EOC:\ :ks=10\E[?1h\E=:ku=\EOA:\ :tc=wyse75: # from ucbvax!ucsfmis!shewmake Wc|wy85|wyse85|wyse-85:\ :do=^J:co#80:li#24:cl=\E[;H\E[2J:\ :le=^H:bs:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :ce=\E[0K:cd=\E[0J:so=\E[7m:se=\E[27m:\ :us=\E[4m:ue=\E[24m:\ :is=\E[1;24r\E[24;1H\E[0m:\ :ks=\E[?1h\E=:ke=\E[?1l\E>:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:kb=^H:\ :ho=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kh=\E[H"ta=^I:pt:sr=\EM:\ :sc=\E7:rc=\E8:cs=\E[%i%d;%dr:as=^N:ae=^O:bt=\E[Z:\ :dc=\E[P:dl=\E[M:al=\E[L:ei=\E[4l:im=\E[4h:\ :vb=\E[?5h\E[?5l:\ :hs:es:ts=\E7\E[?25l\E[40h\E[25;%dH\E[2K:fs=\E[1;24r\E8\E[?25h: # # -------------------------------- # # z: Miscellaneous # z0|wind:\ :bs:cm=\Ep%r%.%.:cl=\En\120\030\Eo:co#80:\ :ho=\Ep\200\200:li#24:nd=^L:up=^K:nl=\035:\ :kl=\E3:kr=\E4:ku=\E1:kd=\E2:k1=\E5:k2=\E6:k3=\E7:k4=\E8:\ :so=\Em\014:se=\Em\003: z1|wind16:\ :bs:cm=\Ep%r%.%.:cl=\En\120\020\Eo:co#80:\ :ho=\Ep\200\200:li#16:nd=^L:up=^K:nl=\035:\ :so=\Em\014:se=\Em\003: z2|wind40:\ :bs:cm=\Ep%r%.%.:cl=\En\120\050\Eo:co#80:\ :ho=\Ep\200\200:li#40:nd=^L:up=^K:nl=\035:\ :so=\Em\014:se=\Em\003: z3|wind50:\ :bs:cm=\Ep%r%.%.:cl=\En\128\062\Eo:co#88:\ :ho=\Ep\200\200:li#50:nd=^L:up=^K:nl=\035:\ :kl=\E3:kr=\E4:ku=\E1:kd=\E2:k1=\E5:k2=\E6:k3=\E7:k4=\E8:\ :so=\Em\014:se=\Em\003: z4|cad68-3|cgc3|cad68 basic monitor transparent mode size 3 chars:\ :am:bs:cl=^Z:co#73:ho=\036:li#36:nd=^L:up=^K: z5|cad68-2|cgc2|cad68 basic monitor transparent mode size 2 chars:\ :am:bs:cl=^Z:co#85:ho=\036:li#39:nd=^L:up=^K:\ :kl=\E3:kr=\E4:ku=\E1:kd=\E2:k1=\E5:k2=\E6:k3=\E7:k4=\E8:\ :so=\Em\014:se=\Em\003: z6|v50|visual 50:\ :am:bs:al=\EL:dl=\EM:\ :cd=\Ek:ce=\EK:cl=^Z:cm=\E=%+\040%+\040:co#80:do=^J:ho=\EH:\ :kb=^H:kd=\EB:kh=\EH:kl=\ED:kr=\EC:ku=\EA:li#24:ms:nd=^L:pt:\ :so=\EU:se=\ET:up=^K: z7|trs2|trsII|trs80II|Radio Shack Model II using P&T CP/M:\ :nl=^_:al=^D:am:bs:cd=^B:ce=^A:cl=^L:cm=\EY%+ %+ :co#80:\ :dl=^K:do=^_:ho=^F:li#24:nd=^]:ms:pt:se=^O:so=^N:up:=^^:\ :kb=^H:kd=^_:kl=^\:kr=^]:ku=^^: z9|ps300|Picture System 300:us@:ue@:so@:se@:xt:pt@:tc=vt100: za|masscomp2:co#64:li#21:tc=masscomp: zb|masscomp1:co#104:li#36:tc=masscomp: zc|masscomp:\ :al=\E[L:bs:cd=\E[J:ce=\E[K:co#80:dc=\E[P:dl=\E[M:do=\E[B:\ :ei=\E[4l:im=\E[4h:is=\EGc\EGb\EGw:li#24:mi:MT:nd=\E[C:pt:se=\E[0m:\ :sg#0:so=\E[7m:cm=\E[%i%d;%dH:ue=\EGau:us=\EGu:up=\E[A:\ :ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:kb=^h:cl=\E[2J: # Kimtron TC entries include (undocumented) codes for: enter dim mode (mh), # enter bold mode (md), enter reverse mode (mr), turn off all attributes (me) # Kimtron ABM 85 added by Dual Systems zd|abm85|Kimtron ABM 85:\ :is=\EC\EX\Eg\En\E%\Er\E(\Ek\Em\Eq:if=/usr/lib/tabset/stdcrt:\ :li#24:co#80:am:bs:bw:ms:pt:\ :cl=\E*:cd=\Ey:dl=\ER:al=\EE:ce=\Et:dc=\EW:im=\EQ:ei=\Er:\ :cm=\E=%+ %+ :do=^J:nd=^L:up=^K:bt=\EI:\ :kh=^^:kb=^H:kd=^J:ku=^K:kd=^J:kl=^H:kr=^L:\ :so=\Ej:se=\Ek:sg#1:us=\El:ue=\Em:ug#1: # Kimtron ABM 85H added by Dual Systems. # Some notes about the 85h entries: # 1) there are several firmware revs of 85H in the world. Use o85h for # firmware revs prior to SP51 # 2) Make sure to use 85h entry if the terminal is in 85H mode and the # 85e entry if it is in 920 emulation mode. They are incompatible in # some places and NOT software settable i.e., `is' can't fix change it) # 3) In 85h mode, the arrow keys and special functions transmit when # the terminal is in dup-edit, and work only locally in local-edit. # Vi won't swallow `del char' for instance, but `vs' turns on # dup-edit anyway so that the arrow keys will work right. If the # arrow keys don't work the way you like, change `vs', `ve', and `is'. # 920E mode does not have software commands to toggle between dup # and local edit, so you get whatever was set last on the terminal. # 4) vb attribute is nice, but seems too slow to work correctly (\Eb\Ed) # 5) Make sure `hidden' attributes are selected. If `embedded' attributes # are selected, the entries :sg@: and :ug@: should be removed. # 6) auto new-line should be on (selectable from setup mode only) # # From fair@ucbarpa Sun Oct 27 07:21:05 1985 ze|85h|85H|abm85h|Kimtron ABM 85H, 85H mode:\ :is=\EC\EN\EX^T^N\EA\Ea\E%\E9\Ee\Er\En\E"\E}\E'\E(\Ef^M\EG0\Ed\E.4\El:\ :im=\EZ:kd=^V:so=\EG4:se=\EG0:us=\EG8:ue=\EG0:vb@:vs=\E.2:ve=\E.4:\ :mh=\E):mr=\EG4:me=\E(\EG0:sg@:ug@:ds=\Ee:fs=^M:hs:ts=\Eg\Ef:tc=abm85: zf|85e|85E|abm85e|Kimtron ABM 85H, 920E mode:\ :is=\EC\EX\EA\E%\E9\Ee\Er\En\E"\E}\E'\E(\Ef^M\Ek\Eq\Em:\ :mh=\E):mr=\Ej:me=\E(\Ek:im=\EZ:sg@:ug@:vb@:tc=abm85: zg|o85h|oabm85h|Kimtron ABM 85H, old firmware rev.:\ :is=\E}\EC\EX\Ee\En\E%\Er\E(\Ek\Em\Eq\Ed\ET\EC\E9\EF:\ :im=\EZ:sg@:ug@:vb=\200\200\200^G\200\200\200:\ :mh=\E):mr=\Ej:me=\E(\Ek:tc=abm85: #from malman@bbn-vax.arpa zE|kt7|kimtron model kt-7:\ :am:bs:co#80:li#24:cm=\E=%+ %+ :cl=^Z:cd=\EY:ce=\ET:is=\El\E":\ :al=\EE:dl=\ER:im=:ei=:ic=\EQ:dc=\EW:if=/usr/lib/tabset/stdcrt:\ :ho=^^:nd=^L:bt=\EI:pt:so=\EG4:se=\EG0:sg#0:us=\EG8:ue=\EG0:ug#0:\ :up=^K:do=^V:kb=^H:ku=^K:kd=^V:kl=^H:kr=^L:kh=^^:ma=^V^J^L :\ :k1=^A@\r:k2=^AA\r:k3=^AB\r:k4=^AC\r:k5=^AD\r:k6=^AE\r:k7=^AF\r:\ :k8=^AG\r:k9=^AH\r:k0=^AI\r:ko=ic,dc,al,dl,cl,ce,cd,bt:\ :ts=\Ef:fs=\Eg: zh|appleII|apple ii plus:vs=\024\103\066:ve=\024\103\062:\ :am:co#80:ce=\035:li#24:cl=\014:bs:nd=\034:up=\037:ho=\E\031:pt:\ :cd=\013:so=\017:se=\016:cm=\036%r%+ %+ :is=\024T1\016:do=^J:kd=^J:\ :vb=\024G1\024T1:kr=: # Gary Ford 21NOV83 # New version from ee178aci%sdcc7@SDCSVAX.ARPA Fri Oct 11 21:27:00 1985 zi|apple-80|apple II with smarterm 80 col:\ :am:bs:bt=^R:bw:cd=10*^K:ce=10^]:cl=10*^L:cm=^^%r%+ %+ :\ :co#80:cr=10*^M:do=^J:ho=^Y:le=^H:li#24:nd=^\\:up=^_: # zj|lisa|apple lisa xenix console display (white on black):\ :al=\E[L:am:bs:cd=\E[J:ce=\E[K:cl=^L:cm=\E[%i%d;%dH:co#88:\ :dc=\E[P:dl=\E[M:dn=\E[B:ei=:ho=\E[H:ic=\E[@:im=:li#32:\ :nd=\E[C:ms:pt:so=\E[m:se=\E[7m:us=\E[4m:ue=\E[7m:up=\E[A:\ :kb=^h:ku=\E[A:kd=\E[B:kl=\E[D:kr=\E[C:eo:\ :is=\E[7m^L:GS=\E[11m:GE=\E[10m:GV=\140:GH=a:G1=c:\ :G2=f:G3=e:G4=d:GU=u:GD=s:GC=b:GL=v:GR=t: # The following is a version of the ibm-pc entry distributed with PC/IX, # (Interactive Systems' System 3 for the Big Blue), modified by Richard # McIntosh at UCB/CSM. The :pt: and :uc: have been removed from the original, # (the former is untrue, and the latter failed under UCB/man); standout and # underline modes have been added. Note: this entry describes the "native" # capabilities of the PC monochrome display, without ANY emulation; most # communications packages (but NOT PC/IX connect) do some kind of emulation. pc|ibmpc|ibm pc PC/IX:\ :li#24:co#80:am:bs:bw:eo:\ :cd=\E[J:ce=\E[K:cl=\Ec:cm=\E[%i%2;%2H:do=\E[B:ho=\E[;H:\ :nd=\E[C:up=\E[A:so=\E[7m:se=\E[0m:us=\E[4m:ue=\E[0m: pc3-bold|ibmpc3|IBM PC BSD/386 Console with bold instead of underline:\ :us=\E[=15F:ue=\E[=R:tc=pc3:\ pc3|ibmpc3|IBM PC BSD/386 Console:\ :li#25:al=\E[L:dl=\E[M:md=\E[=15F:me=\E[=R:mh=\E[=8F:\ :kh=\E[H:kH=\E[F:kP=\E[I:kN=\E[G:kI=\E[L:\ :ku=\E[A:kd=\E[B:kl=\E[D:kr=\E[C:tc=pc: zk|ibmx|ibmpcx|IBM PC xenix console display:\ :al=\E[L:am:bs:cd=\E[J:ce=\E[K:cl=^L:cm=\E[%d;%dH:co#80:\ :dc=\E[P:dl=\E[M:dn=\E[B:ei=:ho=\E[H:ic=\E[@:im=:li#25:\ :nd=\E[C:ms:se=\E[0m:so=\E[7m:us=\E[4m:\ :ue=\E[m:up=\E[A:MR=\E[0m:\ :kb=^h:kh=\E[Y:ku=\E[A:kd=\E[B:kl=\E[D:kr=\E[C:eo:\ :GS=\E[11m:GE=\E[10m:\ :GC=b:GL=v:GR=t:RT=^J:\ :GH=\E[196g:GV=\E[179g:\ :GU=\E[193g:GD=\E[194g:\ :G1=\E[191g:G2=\E[218g:G3=\E[192g:G4=\E[217g:\ :CW=\E[E:NU=\E[F:RF=\E[G:RC=\E[H:\ :WL=\E[K:WR=\E[L:CL=\E[M:CR=\E[N:\ :HM=\E[Y:EN=\E[d:PU=\E[Z:PD=\E[e: zl|ibmc|ibmcpc|IBM PC xenix color console display:\ :tc=ibm: zl|ibmcx|ibmcpcx|IBM PC xenix color console display:\ :tc=ibmx: zm|kaypro|kaypro2|kaypro II:\ :am:bs:cm=\E=%+ %+ :cl=1^Z:co#80:ho=^^:li#24:ma=^K^P:nd=^L:up=^K:\ :kr= :kl=^H:ku= :kd=^J: # From Suk Lee ..!{decvax,linus,allegra,ihnp4}!utcsrgv!spoo zn|trs100|Radio Shack Model 100:\ :am:bs:le=^H:li#8:co#40:ku=^^:kd=^_:kl=^]:kr=^\:up=\EA:\ :nd=\EC:ho=\EH:ce=\EK:cd=\EJ:cl=\EE:xt:cm=\EY%+ %+ :\ :so=\Ep:se=\Eq:al=\EL:dl=\EM: zt|mac|macintosh|Macintosh with MacTerminal:\ :al=20\E[L:dl=20\E[M:ip=7:dc=7\E[P:ic=9\E[@:xn:dN#30:tc=vt100: zs|zen50|z50:zephyr:\ :cm=\E=%+ %+ :cd=\EY:co#80:li#24:\ :am:al=\EE:ce=\ET:dc=\EW:dl=\ER:ic=\EQ:im=:ei=:\ :cl=\E+:bs:ma=^Hh^Ll^Jj^Kk:sg#1:se=\EGO:so=\EG4:\ :kl=^H:kr=^L:ku=^K:kd=^J:kh=\036:up=^K:\ :BS=^U:CL=^V:CR=^B:RK=^L:UK=^K:LK=^H:DK=^J:HM=\036: zu|go140|graphon go-140:\ :co#80:li#24:cl=10\E[;H\E[2J:bs:cm=\E[%i%2;%2H:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=10\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:\ :is=\E<\E=\E[?3l\E[?7l\E(B\E[J\E7\E[;r\E8\E[m\E[q:\ :dl=\E[M:al=\E[L:dc=\E[P:im=\E[4h:ei=\E[4l:\ :ks=\E[?1h\E=:ke=\E[?1l\E>:\ :if=/usr/lib/tabset/vt100:ku=\EOA:kd=\EOB:kr=\EOC:kl=\EOD:\ :kh=\E[H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:pt:sr=\EM: zv|go140w|graphon go-140 in 132 column mode:\ :co#132:is=\E<\E=\E[?3h\E[?7h\E(B\E[J\E7\E[;r\E8\E[m\E[q:\ :tc=go140: zw|sanyo55|sanyo|sanyo mbc-55x pc compatible:\ :co#80:li#25:am:cl=\E[H\E[J:bs:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :ce=\E[K:cd=\E[J:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m: #From: Simson L. Garfinkel zC|ST|atari st:\ :bs:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :co#80:li#25:nd=\EC:\ :pt:sr=\EI:up=\EA:ku=\EA:kd=\EB:kr=\EC:kl=\ED:\ :do=\EB:\ :so=\Ep:se=\Eq:dl=\EM:al=\EL:am: # UniTerm terminal program for the Atari ST: 49-line VT220 emulation mode # From Paul M. Aoki, aoki@ucbvax.Berkeley.EDU zD|uniterm|uniterm49|UniTerm VT200 emulator, 49 lines:\ :li#49:is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;49r\E[49;1H:\ :tc=vt200: # YTERM standard version 1.0. (gts 9-25-84) # Straight old ascii keyboard except function keys are Yale (e.g.,ASCII.KBD). # Only 80 tab columns (else yterm 1.1 bug). No :xn: in 1.0. # Cannot use termcap :sr=\EM: because vi will not work, too bad. # vi string is given so that yterm is reset each vi startup. Y0|yterm10|yterm 1.0 UCB ascii.kbd:\ :am:bs:cd=^K:ce=^]:cl=^L:cm=^^%r%+ %+ :co#80:EP:ho=^Y:li#24:nd=^\:pt:\ :rc=\E8:sc=\E7:so=\E[7m:se=\E[m:up=^_:us=\E[4m:ue=\E[m:\ :is=^O\E[7i\E[m\E[?7h\E[?3g\r\EHY0 for \EHYTERM 1.\EH0 with A\EHSCII.KBD\EH 9-13-84\EH \EH \EH \EH \EH\n:\ :ku=^K:kd=^J:kl=^H:kr=^L:kh=^^:ma=h\012j k lH:\ :k0=\E0:k1=\E1:k2=\E2:k3=\E3:k4=\E4:k5=\E5:k6=\E6:k7=\E7:k8=\E8:k9=\E9:\ :vs=^O\E[7i\E[m\E[?7h\E[?3g\r\EHY0 \EH \EH \EH \EH \EH \EH \EH \EH \EH\r: # YTERM varient version 1.1. (gts 9-13-84) Version 1.1 has :xn:. Y1|yterm11|yterm 1.1 UCB ascii.kbd:\ :xn:is=^O\E[7i\E[m\E[?7h\E[?3g\r\EHY1 for \EHYTERM 1.\EH1 with A\EHSCII.KBD\EH 9-13-84\EH \EH \EH \EH \EH\n:\ :tc=yterm10 # YTERM 1.0 varient no autowrap or tabs # X does not remember autowrap or tabs when T is deleted and restarted. Y2|yterm10nat|yterm 1.0 UCB ascii.kbd no autowrap or tabs:\ :am@:pt@:vs=^O\E[7i\E[m\E[?7l\E[?3g\rY2\r:\ :is=^O\E[7i\E[m\E[?7l\E[?3g\rY2 for YTERM 1.0 with ASCII.KBD 9-20-84 no autowrap or tabs\n:\ :tc=yterm10 # KERMIT standard all versions. (gts 9-25-84) # Straight ascii keyboard. :sr=\EI: not avail. many versions + bug prone in vi. K0|kermit|standard kermit:\ :bs:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :co#80:ho=\EH:li#24:nd=\EC:up=\EA:\ :ku=^K:kd=^J:kl=^H:kr=^L:kh=^^:ma=^Hh\012j^Kk^Ll^^H:\ :is=K0 Standard Kermit 9-25-84\n: K1|kermitam|standard kermit plus am:\ :am:is=K1 Standard Kermit plus Automatic Margins\n:tc=kermit: # IBMPC Kermit 1.2. (gts 8-30-84) # Bugs :cd:ce: do not work except at beginning of line! :cl: does not work, # but fake with :cl=\EH\EJ (since :cd=\EJ: works at beginning of line). K2|pckermit|pckermit12|UCB IBMPC Kermit 1.2:\ :am:li#25:cd@:ce@:cl=\EH\EJ:\ :is=K2 UCB IBMPC Kermit 1.2 8-30-84\n:tc=kermit: # IBMPC Kermit 1.20 (gts 12-19-84) # Cannot use line 25, now acts funny like ansi special scrolling region. # Initialization must escape from that region by cursor position to line 24. # Cannot use character insert because 1.20 goes crazy if insert at col 80. # Does not use am: because autowrap mode lost when kermit dropped and restarted. K3|pckermit120|UCB IBMPC Kermit 1.20:\ :al=\EL:am@:dc=\EN:dl=\EM:do=\EB:ei@:im@:li#24:pt:se=\Eq:so=\Ep:\ :is=\EO\Eq\EJ\EY7 K3 UCB IBMPC Kermit 1.20 12-19-84\n:\ :vs=\EO\Eq\EEK3:tc=kermit: # MS-DOS Kermit 2.27 for the IBMPC (UCB gts 3-17-85) # Straight ascii keyboard. :sr=\EI: not avail. many versions + bug prone in vi. # Cannot use line 25, now acts funny like ansi special scrolling region. # Initialization must escape from that region by cursor position to line 24. # Does not use am: because autowrap mode lost when kermit dropped and restarted. # Reverse video for standout like H19. K4|msk227|mskermit227|MS-DOS Kermit 2.27 for the IBMPC:\ :al=\EL:am@:bs:cd=\EJ:ce=\EK:cl=\EE:cm=\EY%+ %+ :co#80:\ :dc=\EN:dl=\EM:do=\EB:ei=\EO:im=\E@:\ :ho=\EH:li#24:nd=\EC:up=\EA:pt:rc=\Ek:sc=\Ej:se=\Eq:so=\Ep:\ :ku=^K:kd=^J:kl=^H:kr=^L:kh=^^:ma=^Hh\012j^Kk^Ll^^H:\ :is=\EO\Eq\EG\Ew\EJ\EY7 K4 MS Kermit 2.27 for the IBMPC 3-17-85\n:\ :vs=\EO\Eq\EG\EwK4: # MS-DOS Kermit 2.27 with automatic margins (UCB gts 3-17-85) K5|msk227am|mskermit227am|UCB MS-DOS Kermit 2.27 with automatic margins:\ :am:\ :is=\EO\Eq\EG\Ev\EJ\EY7 K5 MS Kermit 2.27 +automatic margins 3-17-85\n:\ :vs=\EO\Eq\EG\EvK5:tc=mskermit227: # MS-DOS Kermit 2.27 UCB 227.14 for the IBM PC (UCB gts 3-17-85) # Automatic margins now default. Use ansi set graphic rendition for standout, # underline and ul codes (md,me,mr). Define function keys. K6|msk22714|mskermit22714|UCB MS-DOS Kermit 2.27 UCB 227.14 IBM PC:\ :am:kn#10:\ :k0=\E0:k1=\E1:k2=\E2:k3=\E3:k4=\E4:k5=\E5:k6=\E6:k7=\E7:k8=\E8:k9=\E9:\ :md=\E[1m:me=\E[m:mr=\E[7m:se=\E[m:so=\E[1m:ue=\E[m:us=\E[4m:\ :is=\EO\Eq\EG\Ev\EJ\EY7 K6 MS Kermit 2.27 UCB 227.14 IBM PC 3-17-85\n:\ :vs=\EO\Eq\EG\EvK6:tc=mskermit227: # From earle@smeagol.UUCP 29 Oct 85 05:40:18 GMT # MS-Kermit with Heath-19 emulation mode enabled Kh|h19k|h19kermit|heathkit emulation provided by Kermit (no auto margin):\ :am@:ta@:pt@:xt:da:db:tc=h19-u: # rough draft of Amiga termcap by Mike Meyer AA|amiga|Amiga ANSI:\ :co#80:li#25:am:do=\E[B:ce=\E[K:cd=\E[J:\ :cl=\E[H\E[J:ku=\E[A:kd=\E[B:kl=\E[C:kr=\E[D:kb=^H:\ :al=\E[L:dl=\E[M:le=^H:cm=\E[%i%d;%dH:nd=\E[C:up=\E[A:\ :ce=\E[K:ho=\E[H:dc=\E[P:ic=\E[@:\ :so=\E[2m:se=\E[m:us=\E[4m:ue=\E[m:mr=\E[7m:mb=\E[7;2m:me=\E[m: # The pcplot IBM-PC terminal emulation program is really messed up. It is # supposed to emulate a vt-100, but emulates the wraparound bug incorrectly, # doesn't support scrolling regions, ignores add line commands, and ignores # delete line commands. Consequently, the resulting behavior looks like a # crude adm3a-type terminal. # Steve Jacobson 8/85 pp|pcplot:\ :cs@:sc@:rc@:xn@:tc=vt100: # From Joel Rubin, jmrubin@coral, a preliminary TERMCAP for VIDTEX, # a terminal program sold by Compuserve. Line and column numbers are # computer-dependent (I have a Commodore '64); you should use the meta-B # option to shut off clean-breaking of lines. No key codes included # since some of them are programmable and most are machine-specific. # Works on vi if you don't use clean-breaking. Very similar to the IBM 3101 # termcap. Escape-D used for backspace because control-H is destructive # backspace. There seem to be a few weirdnesses (especially at the beginning # of a wrapped line), and the cursor does not, unfortunately, flash. zQ|vid|vidtex|Compuserve vidtex program:\ :am:bc=\ED:cl=^L:li#25:co#40:nd=\EC:up=\EA:cd=\EJ:ce=\EK:\ :ho=\EH:cm=\EY%+\40%+\40:pt: # Fortune from c160-3bp@Coral (Robert Nathanson) via tut Wed Oct 5, 1983 zK|fos|fortune|Fortune system:\ :is=^_..:li#25:co#80:am:bs:bw:cl=20^L:cd=3*^\Y:\ :ic=5^\Q:dc=5^\W:dl=15^\R:al=15^\E:cm=^\C%+ %+ :ta=^Z:ho=10^^:do=3^J:\ :up=3^K:bs=^H:kb=^H:kd=^Ay\r:kh=^A?\r:kl=^Aw\r:kr=^Az\r:ku=^Ax\r:\ :nl=5^J:so=^\H`:se=^\I`:sg=0:us=^\HP:ue=^\IP:ug=0:ce=^\Z:rv=\EH:re=\EI:\ :rg=0:GS=\Eo:GE=^O:GG=0:GV=-:GH=&:GU=%:GD=#:G1=(:G2= :G3=":G4=*:CF=\E]:\ :CO=\E\\:WL=^Aa\r:WR=^Ab\r:CL=^Ac\r:CR=^Ad\r:DL=^Ae\r:RF=^Af\r:\ :RC=^Ag\r:CW=^Ah\r:NU=^Aj\r:EN=^Ak\r:HM=^Al:PL=^Am\r:PU=^An\r:PD=^Ao\r:\ :PR=^Ap\r:HP=^A@\r:RT=^Aq\r:TB=\r:CN=\177:MP=\E+F: # basis from Peter Harrison, Computer Graphics Lab, San Francisco # ucbvax!ucsfmis!harrison ...uucp / ucbvax!ucsfmis!harrison@BERKELEY ...ARPA ba|basis|BASIS108 computer with terminal translation table active:\ :do=5000^J:nl=5000*^J:\ :cd=\EY:ce=\ET:cl=300\E*:ma=^K^P^R^L^L :\ :kb=^H:kl=^H:ku=^K:kr=^L:kd=^J:so=\E(:se=\E):tc=adm3a: # From Peter Harrison, Computer Graphics Lab, San Francisco # ucbvax!ucsfmis!harrison .....uucp # ucbvax!ucsfmis!harrison@BERKELEY .......ARPA # "These two work. If you don't have the inverse video chip for the # Apple with videx then remove the so and se fields." zO|DaleApple|Apple with videx videoterm 80 column board with inverse video:\ :do=^J:am:le=^H:bs:cd=^K:ce=^]:cl=300^L:cm=^^%r%+ %+ :co#80:ho=^Y:\ :kd=^J:kl=^H:kr=^U:kh=^Y:\ :li#24:nd=^\:pt:so=^Z3:se=^Z2:up=^_:xn: zJ|ibmaed|IBM Experimental display:\ :al=\EN:am:bs:cd=\EJ:ce=\EI:cl=\EH\EK:cm=\EY%+\40%+\40:co#80:\ :dc=\EQ:dl=\EO:do=\EB:ei=:ho=\EH:ic=\EP:im=:li#52:\ :nd=\EC:ms:so=\E0:se=\E0:us=:ue=:up=\EA:\ :kb=^h:ku=\EA:kd=\EB:kl=\ED:kr=\EC:eo:vb=\EG:pt: # funny terminal that the TANDEM uses. zA|653|t653x|Tandem 653x multipage terminal:\ :li#24:co#80:ho=\EH:cm=\023%+ %+ :cl=\EI:cd=\EJ:ce=\EK:am:bs:\ :if=/usr/lib/tabset/tandem653:sb=\ES:sr=\ET:da:db:so=\E6$:se=\E6 :\ :us=\E60:ue=\E6 :sg#1:ug#1:up=\EA:do=\012:le=\010:nd=\EC:\ :hs:ts=\Eo:fs=\r:ds=\Eo\r:ws#64: # From Paul Leondis, unllab@amber.berkeley.edu zB|ifmr|Informer D304:\ :am:bs:cd=\E/:ce=\EQ:cl=\EZ:cm=\EY%r%+ %+ :co#80:dc=\E\\:\ :do=^J:im=:ei=:ic=\E[:li#24:nd=\EC:so=\EJ:se=\EK:up=\EA:\ :sr=\En:ho=\EH: # # END OF TERMCAP # ------------------------ # # END OF LOCAL TERMCAP # -------------------------- 0| lᶁ 10 0 0A2.11 BSD UNIX #174: Sat Oct 28 20:19:40 PDT 1995 0~ ln 9R0vR0v0@ -l x e7cce7  /  7%  %w ) e&. %@ȥ-  R f   ʋe  % AL P  %.f | 5)= N . N `5 Nl %@ N  N . N 7 N~ % 72 N  7$   X! 5  <n  @m& & E%@N  @m& Re   @m& N%  @m 7` D-~ %w8'w $'@  w'w '6Nff N% N  N T  N w&  5 Nee  e 5 N Z     @@E%@ffe Re5Nfe N% ŀe 5w % 8 <L P NfL P %   ߪ 5 - ?% L & vL  "  wr%w X%7 Nf f N %wJ%w 6%  L P N f w%w$ w~$ wx$w $D   ! 0w$w $ .  r 7 d!w$w $  #7 w$w $DC  ̋̋wr$w ^$  r 7 E %7:&  7p:&    7Z V:&   &   %F,&  ̋  w#(w.#w #   L  w# x 5 ff L% 50p   8 Lw D#  uN !5&f %5Lw# 5  f !  0   w " p  @e5ff l%5Lw" r5  w-f n  4 w D" 0* d!  &  Z%7 w"r !f5f r 7 w ! w!w ! t  w!ww !  7   ~x #7 pw!w t!wwz!w f!  R L@ E wR!2 "5% %h %  h | h $ 7& $ 7& $   7& $   7& $ 7& $  b 7w & $  b 7pwn & $ 7V& $ 7H& $ 7:_w $   w  t7 n J |55 ff e55 DhP& %eR& %eT& %eXRLF`& %e72w   _ r !_j b_n !5 & f X!%5= b 5u fff !e5 #u 1hf ^!%50hh :=hVN T$wbw ND      + - ̥9 Wp @@`e̥0  ww D5 5      + -! ̥9 f& ff >eee@ ee@ 5u̥0 A@  wrA@ww JD LԋwBw .DC ^ w"5 7J@  55@- 7 5!w De LN !4e4e  !4e7 Be v Nfe %w\w H-@ LwBN9 < %w  BuNefef )%=@@wЋ Ћ w D T$4 4  'ww  f X! %  T$P &4 4 whw TD 4-&4-!4 4   &e & ^!%4    w me   s lt  yw8&  4  b '     ` TW ~  s`K6!  w 0D85U5_\5P_\  m@e4 ,5Ne & f&  uN &4USt%4 5p@ #5lL 0 ḽ 9R0vR0v0@#5& & ^!% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff X!%ށ̥a &  !e 3     U̥r 33w 4$ & 6 w5 4@E%@EU5N&e !  &e ! Nf&e X!%4 IN&e !  &e ! Nf&e X!%  (Ne& f&  ff eee@ 4t@t"4 4t T$ '_tw N T$@ T$N 'ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  x ve@ 4tw"w D55ff %f&& "eff&e e &e  55 www5 5 w D5#5ff T %f&& eff&e *ew6&e '44  && ef&& !e&e & (%%U w D5_o5ff %f&& eff&e Ze L&e 8f f ff&e V e 744  && ef&& !e&e & (%%UUw @@m e%fe &  &e  55 3ff `%f&e@ &50c &e  55 3 L P U44  && ef&& !e&e & (%%&_fffffe e _&e % __e_  mm@ e@ f& ef&& !efe& (%%_ _w @0 0 @0 N |7F7Bww D85_Ne& f&q fe Ve4-4-/44  &&  ef&& !e&e & ^!%%&e & &e  55 ew^wZw4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  x ve@ 4t4-4-/44  && ef&& !e&e & ^!%%&e & ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& !e&e$& ^!%%&e$ & `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& !e&e$& ^!%%&e$ & `Btp$t t"  ff Nef&& !e&e$& (%%Uw w r D5#5 5 wwwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& :% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l 5l u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm % a@ `` e w D a@@m e  w e  aAm HN@`@m &f %  aN f`f %  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef )% #U4 4  fef )%5 w    6v&  @ppC`p   6@Cwzwtw D # & & !e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _v#5uNfe & (% _v#bNe & f&  uN &)U5| m- 5 & (%St%@ & r& U   & (% S U _4" @_8"w DE%%"5   & (% U wv w ^D55@ #  T$ 3 ' 4 4 4 4 4 ww~w  r$4 5+ 0 &5e-Fe %$ & $    % ww  5f % 7 f % 7wX@ m74 %$ e w       % e-pww D \4 5 e %$ w8  5 e-w # l%ww  N (ww rDCDpC & & wZw FN 'wJ ~5 & E        ~5>wlYwfw Net@f &e  w6w.w  &U7U7 Ae vB7   % 55 a  a!PE -% w$ ( `e vWt vwx@ `e @  (%PLe U?:: `e 7(U? a7 ?U ew dDE wZw FD5 ' 5N &!w5A vBB-  }ee@ !ۃ `!ւ ` `8mr& E%dm^%w w7*'$!      7& A& BF7!W-T-7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu, Bw* J@B |_`+@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& " z   5 , @ :% & f E "  (˥-%0     ,:% &  " 8 5E& z   5 , @ :% & f E "  wCan't fchdir() back to starting directoryunknown option: %cusage: chown [-fR] owner[.group] file ... unknown group: %sunknown user id: %s.Can't open ..chown: chown: /etc/grouprr/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd: Unknown error: %d.FPj|,;KZk &9J`z%<Vx #Gh':\o|$6J`zRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired *dr*o~*x<+fJ+e<*g+c"+sL*lL*L*u*Dv*O*X*U0 l "R0R00K   e7cce7" /   7%  tw 5 5 /f  5%uf v  -f v %N % tf v  h f v   R e    0 Nf e t  Z 7   t  ` % .  (& v   Nf& % Nf& % N&  5`  5 5t=T @ @m % u-N tww D#& v !   & 6 %  <&  w &?D eD &  E  [^  w $D  @mf v  t7P> w ! w D &   //&    e v eD%<  ˋeD%< /Ne@ < D% "i n 7  rD WpDN x x%n w2ˋw D &   //&    ˋe  v se@ v v  weD%< ݂ w w D̥: ̋̋wxw d C Wp De` ˋk ˋ =K ˋˋ w&w T "%w= t@0 t@0 t:&fe % &fe %w  $ 77 wj w P  7 wF w 2   J 5%%Jw w p  N& v w w B  N& v w pw   N& v w @w l x fef <%5 wX w w : D Lԋw2 w  De LN 4ee, b  4e Be v Nfe %w w -@ w NV %Vw f BuNefef <%=@@w: Ћ Ћ   Ћ Ћ yw^ &  4  b '     ` TW ~  s`K6!  w V D85U5_ 5P_  mx@e4 ,5Ne &   uN R4USt%l 5&x 8 5" 8 5& & ` % 45@e-4  % U5EU  w( E w  D  +   r= wB w5 a U5ff Z %ށ̥a &  f e 3     U̥r 33w D5"E@e44fef <% 8 U4 4  fef <%5 w w w7  ы A@PЋ w FD:5UE5Hw* _ 5uNfe & x% _ bNe &   uN R)U5| m- 5 & x%St%x   U   & x% S U _ @_ w DE%%"5   & x% U wv w ^D55@ 8   3  4 4 4 4 4 ww~w  t$l 5+ $ &5e-He %\ & &     ww  5f  7 f  7wX@ m7l %\ e w        e-rww D ^l 5 e %\ w:  5 e- w  ww  N ~ww rDCDpC R  wZw FN wJ ~5 & E 0 l "R0R00K       ~5>wlYwfw Net@f Le  w6w.w  (U7U7Ae vB7   % 55 a  a!PE -% w$ R `e vWt vwz@ `e @  R%RNe U?<< `e 7*U? a7  ?U ew dDE wZw FD5  5N R!w5A vBB-  }ee@ !ۃ `!ւ ` `:m& E%m%w w7*'$!     v 7l& A\& BF7!>W-7*w 8uDAB %u f& & e w5 5  W- W00~u5  .lud Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& z   5 , @ :% & f E  (˥-%0     ,:% &  8 5E& z   5 , @ :% & f E  w@(#) Copyright (c) 1980 Regents of the University of California. All rights reserved. @(#)quotaon.c 5.2 (Berkeley) 8/8/85quotasquotaoffquotaonName must be quotaon or quotaoff not %s -v-aUsage: %s [-v] -a %s [-v] filesys ... /etc/mtab/etc/mtabrq%s not found in /etc/fstab /%s: quotas turned off rw%s/%s%s: quotas turned on rqsetquota: /etc/mtabro%s: mounted read-only %s: not mounted /etc/fstabr: Unknown error: %dlt~$6HZf| ,;Jbo1N_~@Wv1Ij 1@Tj B W RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB j4do&xfegcslL<u@DO*XRU0 l\b0)0)0"!FA@@D N 7 w7 w7 w7 wA7x w7p w7h w7` w7X w7P w7H wԀ  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5b ~5 & E        ~5  pH 1&  6! %   D & rf@rr @`         6  N  A @ B -     @ppC`p&  6!    rD@rr `       6  B A @ -     H1W f r @  W f r@  @ &   rf@rr @`    v & B   vf& v &  mN m  6 6  % eJ   6v   6v   6vb"Ћ f EA `P P ) `P w tPC+wd>TXVzwN(~ , *~J">7 > ww wC     ~ ~w^&TXe&& $ R~55R 5 R RRRRRR~ R7 djB>7 ^@:EIv EEI v EEIv  EI v  I~xrI f`Z JD> .( ,Q~) Q ~# f~ f ~&P  E   5 Q  Q~ It` Z  5 Jv  fv~ JNf   5 QQҐ  Ґ ~    0ЋC~  > 5 Jv  fv~ JN@: > *'$!       7 7~7 X& A& BF7!W- HB7 7&7 ,7PP 57& >  B !w7 r e0b 0 & t  5 5 `U^7 p p 7^7 `J7<6fFEU0 5  8 T %7 \ 7P 77  2J5 =&)fF :W % J5 ) Դ& #&f7´e"w   pI III7wSXL0v  A~~2 $ w U 7P2P I7BCDEF@7 7 77 b7Y  pv Er bj dIm 2 RJ D<~ ~  :   E~V    N~ fvwhEeTpNj >>X0|J7 7<776 @  Q @ e Q0H  & DԄ`̰~ B~  w D% 5 %w w D@0 lb0)0)0  x%`%  ww D%%wrt @Pw N Ne ~&    @E%* ew  h d"\ VTNv % 24.0 `eʱw ı PL^mm@ e@ 7 w  % - -e,ڱw Ա   v  %  %  % % % % %%<%<%e%w % 5  FNf  Ne ww 5&% /_@E%#. f | % %\ %T 2w@57$$7#_N w Dnh5 #T @7#p@p7  !s@=  _ww v7s-s-  b##w6w "& 333ww Dnh## 5u% N%J 7r(  f& ## f& "ef& \#Z# f& eee@ f& u ff e5u  e5 ߐ W- @ww ww ԫ5E >% , ī < hE x%ww |% , ) %7f - ,  , (F hE& x%ww DC ,th³-7ww ܪ eh5  xl%w <@E& x%@E7@EE@P= E E PE& %7FE@& %7. & &  7& w D L]LMNe%~f}f& L%ww DCwt& L% ww zD N wl(@ 5Nevt& L%w 2DNf&  %w w % ,  0 , , ڪ ֪ (ww 4¨ / * xzNe& DV 755 4fe %7pw^fw BD , 7H4h-*7$w* %*w  < 7e 0be - @ 0b- 0,4 4 4 e 7|ww ~D% , wnw VD   4w:w &* 2-(*50 Z 53E5 355 X 7Ҧww ww e? vD8 62 e vWtD  && De  & H | .mj&  7^w w DPt ! w vC0em&e vf e? ve v% e? ve vCtܥ 2&ʥ`¥ De ` H `&0  w :  ܥu !NAe v%DAe vfAe ve%0Ae vfAe vfAe vee% L b@@m@me?-H wx  @ Ue%  @te@] U Τ     -֤   % e% @teUDm ee5   %  ee5   %D#%  @tU"e# % %  _w  .555058@50Z B- V 5*$E .w5@ 5@5  @d=ew P e em e5 Ң3̢ 56 8B85l T@Ue% Tte@]  C-^&<#V eeC-< ee,mL e5C-wnw ZDE2U3! $ 3! $ w&w D  w-w DE 53! w  w 7 0*&7"B%dX7 57 ww 7 % % %|_!Ce N Zt33  v5u3 A@@ A f&EE  UA@@ A f&|vEE  U& %7ҟ & %7 %% ! ww xD B v5u@ 0ZEEf&@t5w]w]wMwM5w]w]wM|wMx%sMsMs] s]"sM$sM&sM sM" s]$s]&7ww 677@EE4PtP7wZw F H7H7D@EE4t7ww  77U@EE4t( / w   &( %7 fe& %7wwwtw `d % =f7^3,X% l <"%  ,  %  x & & #%7w ڀ   &w  %   && #%7ww 5    "5(wj5 :t-( 2 /5+ -% D7-<% l  @ N& %     w D Ne ~$ 3!(N %  Ne ww ~DC  v5u55 t]t]  3 x5= _&5="_&5=5=5=$5=&5 4%_&@: d xE3EU5: 4 x .%%X  & % tMtM15-tMtM& %  j( 22 82  x  6w5  6 1w `@ A f&@ A EE5u55M 5M"5E3  _\(ff ږ%  v5u4@tM53& %  j( v Ʊ 55t]t]   v5u== Z B x _& 4 x%X & % _&5_&& %  j( _&5_& X_&4 w,w DE  b1ww   v5u  r Z<7З(5 @Be@ % @ 7A@e   p h & B 4E%%64d& & we| & & Oe7E& & De & & t&& & Oe7" & ΕWt e@ f&t&t && Oe7j ~`_)_)w 0D 5 e  U RB-B  _, x, %d@`% &f -e)@]R5 f f \ f f %56@wt%d@`% &f -e f f %5  f %``t `_f+fw DC e >      x2  $w:  es   Tw TD  wRe  E     x8   ݁  et  žE w D@ lB tE@ E5 @! @fef wj` E5 %  @ ffe @m& @m& 4e5w n7 b1jT > @@ >@>v & % 4:>4<@EWt r @` %2 2  7L6 b1 <& . %w$w DE   % 2ww D> @0 ݟW \ t64tCtE e7* %_0  .5" ]]@ A 40t0 t  6 17&, 6 w 67d7L6 b1ew B  5" ]]@ A 40t0_/ _/7ew _/w dD 66tE e7e* ! *4 6w0w D Ne ~|5tE e75B _Ne wb 3!6.3 6*# n/35 3 547.N6 b13e*w FD  xN i  1 n/5 3ߐ 5 7N6 b1ww DE re2`%f  2ww %dX0   `_3  T% 6     P57 7 5  5  5* D : @0**7*4_EE &, 6 ww D*7ߐwnw ZD-7* 3!*3*** p ՟w w DeCe &f  v70rw0nte5hL%%DL7 F@e5 8֋t @-߆N r 7 N5  pM "pM pM &pM$pM pM % =4 @e4Kss     3f& %Jr0Eww DeN& %785E%)yE7EEf&333  33ww D * v]5u5> vf&A@ e @ 5utt U@w  e@ f& eB5 v / v NK 5_Cte@t4 @Et 4U  Ksee u w D5 7\V vE@ Wt@P  e@ f& 2efv K%ߐE v b17 (5@% v]5u vee@ @mAm@ 5utt E@w2w Dh & 8 l& 8 w w DWpRCe7% s w  w DCWpRBe7   @H p 18 w w p8 5wbe  w >  AWtEWpRBe7 @tE5 @tE5% 2 = _%*LF5 eb1 %e / %_w_@ `B5 @ `0Btn5N D >e> / > X٘ 8 se3(UX&eb1 %&e / _554 @ `0 B_95& /   R4 UN& = E b1r@E@-_9AEt5 &f& e%  t]L]t] _9%`_9w D tE5 WtEWpRe7u @`BEt%  @\2 )U5 vep / %`@w_E b1 w Dex&  & (*.r@ j3l  `fe  %ww tDCe & < ">fE ٖ%5 @t&  e& <  %`&e ex %ww D  8 e@ 5utt< 5 5w rU4  w \DEWtEWpRe7uEtE5E5@ @`BR5NAWp `e u e v@55 @mAm@ f&@&%. +@ 5u  4   U bwhA@v t @mm@ %W !@mm@ @mAm@ W  55   x6VP5ep 2024  2 @ @@ @  @_w ^D54  8 E__ w$@0 @4p@@5 N b1 5%  &  e = 8 D5!"3 EtE3 a5BEWp Ame u@ll@ 5us s"  3(U5 X 5@ 4pt@0 @e&52@2@@_8@w ^AWpRDe7 _C x E% 4 4 e b1_>D0_>D rU AE@ p_>DE%@5 8& &@eH&@e& BDe @&@eH&@e(& BDe e&22 4 @eH pE (U5__U X M5 X 4 4 e b1 8@@00 @  E@ @0 __ >e> b1 @wPw ff fff e 5ww D h m [ X  > x r X X wPe$&&&&w e e,&&& Xee,& Xٖ%&&   & w пD WtEWpRe7u5 tE @`B `& @9% @wEWp `@5 5 `& ;%A@w 0D  5 3a@we@ ,% !  X C  ! e e%!  w D _L  %! :74L6 b1Ce 3! b!Jm O@m,Ibee = @m,3Km0e e@ f@&( XeB-@0}ww uuu 5  5555 D(  @a  @a0# @a0 @a   %C %e   @a  @a Aa9l %@ % ! M X ٢%! N N N ّ w  @a @m  @a4l % e   3e @ w ,w4w w*w +.r+ww D@4E% U  / 5U@44 5 33 & P%5f& @ee p 4E% E5E b1@wR5 4E%5U3UN& P%55@0 0w D@e5uu uu u uuNfef P% L ww pDC55 w\4E5 SQNfAWp Z@  ; 8 @' `2o  ٖ%O53<3>5@,<,>5 d  U%  UBNfAWp %5@  _2P% %l@ 7 qw q n % _2P%`55<5>v5uE5@,@5%`_R #>< 5u  A 5 u u  % & ff& ^e5u@n%  .n_2P% 9A ll@ 4 <.t >*%@%%A ll@ 4<t>uuA@e@ 7lwj 8  > '20e@ 5 u 2,fff :e fff 9et0t2!% fff z<fff x9e%2  @-@55 Uf n @m& N+%7l*& @@m%,< ,>U5E 5]@@m%N UB < f&@'%~f$%}f!ll@ A f&j & vEE  j wĴ7 j  ffAWp ew x@4E wjNWp  w :DC 2! rBWp Be5F"U355@ EF 3 3436383: 3 3<3>3 3  3 "& $><ee@ v3(s*3@,3 .3 03 2 w"w D500& Z 54E5 2 E&  e3 E  E&  ́e3 E@E4 b1e b1 ~4 @  ` _AWpu0b.*: J-Ke%DAWp u  s-4E@-'e -%`N zN ,  g g Nff %ww D#5e  ;hh@ A f&g & vEE  QEg L5FUe / 551& Z 5!55 EUU 55UU5  5#wU#ew pD@ 5@ ; 855y  E5e b1E5 5  E5e b1E ww ޯD5,P `O K  A%%" 5% 5-  %4E -dʃ5 fWp % 5`  w&-J%J`fWp w l=  ff [f5$ f&& $ wƮw D0b 4E% 2!Ee -jw~w jD 4 . -"!*: *:VdOe%D -le5Ne * /c Ի!ccwc23234Fw3@ 0 , ~w zDC N& 6]%wjN& b^w HDC \33 N P%5 2-<*2- >&4 4 2 <2 >54E4 b1 E&  {e2 E@E5E b1@+U  / 5U < >E5E b1% #wH5U4ew D 5 @ U  / 5U3C l<l>@ :W 6#6%J da %  ',>=U4E5E b1 / 5U 4 E5E b1@w>U  <<>%4N& P%554E4e b1 E&  ye3 E w @ U & / 5U%E5E b1wZ@  x < >%b66U _ <->LJ%b66U@_w ک F@E%UNe ~aaP_7 F_@e7D_ @  x  X Ne X Nf Xٖ%N  X %F%, X N X .   %   5" \\@ A 30s0   27\ , <^ 3e`w ` ` ~`Nf | % ^ wT ʠ w%E]E E7_Ne %  ^7 _E_a_a_a6 u Lj] Z  L_N r _a _a3 X%F %,  ; X %? X5_aA _aH XT X5_:bNe _:bw _ _7 \@e7\7\B  -teˋ  ~fe %7 \w\  \ \ \\ \x\Ul\5EX\T\M\[1  -[5!f&[" UU@ A f&[&50  l[ 27z J Z[ 3e]w ] ^ ]Nf | % "[ wrw ^%H\%@\f[ Z % wFw 2@e0 P~w*w D e& e w w Dlf5$  U@$&e / 5 $ߐww D5 e  b15e b1E$N&Wp  e 5  4-4.E?"ߐw w Dm% & e E$%5"  $E e 5& ރU$ fww DE$ fww D$" E  ߐwdw PD5@ r y  5 J@ r y  5 L)X0-&(-Z5< < X&( $ n7 /  3 6 L 6 J L G JwC5 -b) _Rlҗ̗5N &)Wp  fWp  5f)Wp  _@)__RlE$_RlU$_RlCE& e _Rl m&@ _Rl= _Rl W5  W7!Y @&)Wp "C01+, f&  UU5u53 5 % t  e& e 6 EAE@ ,5e& D @ePPPePPPeAePPP U U  Ftt 3 _hE$_lC +3,30313 _Rl U@$_RlE@$_Rlf&e2 %_Rl&e2f v}_Rlf&e> % _Rle>APPPP&& $_h@e>PPPP_Rl _h _ h  4 A v4PtP _Rl  _h A v4@t@ _Rl  _h  _j  f&e8_hj _@j _i &e8_|j H _i u T5 _hN 5p-(-T  T l _ht& _h _j=&  _j)= _ h _h _jU$ _h _h _jhb55$=_hE$E f_h _j& 5$E _hU$ &Wp  _hw j 5 @<  o@55" uo@wBw .AWpACEpF`D|5@ . x  m57$E 0  %b66U$%b66U$ LR_ w:R,E 0- _w \D Rt (7NTwJT & &3&(E$$E U$&e>  ) he ww D5& e  he4)wқw D& e 4 &4 "4 $ww D$E $=  E$ fF$E ?U$ &Wp  0 'E$5$& E && $ && $ & e wU$ b1w ֚D U$E$@wƚw DE U"@ePPP 44 "p Ne E"wpw \DC W=  oE5 rf5 .% e W=@5$54 E$E fw& ރ F& 0$"E A@E E<"UE")P=!5  U";!W= e & 0 l ~U8!A@E  e & 0 & $_vp5!$E U$ Wp  _p4!_p_xp4!_p2!3!A@E  e & 0 2!5%%,E , n _xp)_xp t_vp& ރ_p_xp<"0!1!   & | U0! _xp  & |_vp1!,W=-"    & | & 0  0  3-E?"_xp)=<!0 _xp % % & | _xp& | _xp % % & ރ_vp:! ~_xpl%)_rr_xp& ރ_xp&  3-e D  F -- *.E"%\U"<" E"/ t *5& 0 6!_xp5_xp*@%*@5 _xp t w DC< < Q<e & ރ A E A7 E W 9*E@ E 5e & f%_*`s*  wE%% % 5  t E e & ރe*n 5 E K x ʋFʊD vEu%ʋ vDe% %WpdDu  vEu% U@%  _ u E _ ue &U ރ _ u5@  vEu% WpSWp%%5 e  ރ % w VD 5 ˆ5=  o_$E w"-K#H0-&(< <5H&( $ n7 / 55 5 D*$5 $E 5_#& / __ _Jy _Jy@ _Jy& p & , 55e5  $E 5_M5%  )9 && $ 7_w6 AE *NW=E , 5@ AE  5  5$ m%3 AE  e 4& ރE$ f@_lww D,E 5n D>5rF5@e- 69 f LFf&A &% _ wtΦ&e b1 %U@$&e / t- _w "DCt,E 5n 5  _"|5$_ _#`@wڏ5&_|-G_P|=@_P|VE5_P|< _P|< _P|*E&( $ _|t- _| C%dd@e5f N+%5* ?n f e&5#4-@& t8 =_|t- j d= = 4-e ff f%55@*`t*umB 3 fn7 / ؃҃55$_zC0-&(_z  _z=_"{3  _z=t-  fnh5t- _ f5 _`s-#_zU@$&e / w DC E _^~EE<_~- ~_^~%% b~_X~En E Y x <s-"~x5*5U "U.* & 0  `  EE "_*5@*`s*% , t   <$"E \ t U"&0& 0 -w0w D=  ww D :%:& 0  t 825& 0 &e `   & 0 & `  E"_4-4.wbw NDC$"E E E >E3 &3% 5  <"E%% % E%^ t E%?e@&E t ww DC% 6!7! % 5  wzw `DC @& t 5wLw 8@ $E&& @& TYe@E$@0 @5@$ @&& $ N b1ww ҉wډw ƉD 825   44: E  E4 4 e5 e4evD b17h_w*w D   b 44_f~`~5 u B E@B-@#f& %`` # E 44e޳D b17_@@wJ5 e4eP›D b17B”w Dj}d}5   5_@w؇eE55L-5 Bm ߃K5 w zDC||5 W L JE E 5e 5@5  e4e>D b170` ZVeRD b17  44 _ww D | |5 _w~ e5 ı eR _ w DC  wt{n{5@ NXLwNJ= Be@95e5/uw = Be E@  E@5& %DmBmC @@=`_w DC  - 5e ww DZzTz5 ?  E 44"e'E% E4E -e 4֯үeί= _wNw :DCzyy5~ PPP 4 4 _~w_~ xfe& h%fe f%w ʃ ;w̃N;;Wp  w ;wNf;;Wp %w j p;wlNf\;X;Wp %w 8%qt7 6;7 4;80 ( w$ ;N ff ;;Wp ew :8 wN::Wp  w @ &e /   %2,~& 4 4 4 & e  n7 / %L8 _ ta55  ff& :e  aff@& Re5  VeeP~@<  @& e4NJ VP~ F4e b1 _ff@& e3    ww ހ@ &e / 46  a5%&N&@& % e  2 @ wf 4 ~ ɀ%5Ae v@55 .5 5 4 !uff@& de5 < eeu L-؇%d t4e b1 N& N&e ٖ%v5_ V55 N@& x  ap%d  e@ % %dw ~ @ff& 6e @ ff Xe]  &e /  4 4 %2-ff@& e V5eeP~ԔД4  F4e b1t ap pet w}w }@ %dt-   apw}w }Nfe Xٖ%w}w v}fff e5wd}U AWp "eT5w N5 "w "}D ff& e ff& ne5U Wp "e4w 4  9f f & e .f f & e5 ff& ew~|U Wp "ep4w j4  "w 8|DE5eH4w B4 Wp "5 " 5Uw{w {D5e3w 3Wp 5(U FU w{w {D5@ b15@ȵE@D b15 5 Epp5D035 D5DD03Ew{w zDAmEWpBeEA@v5u,, 3!5wz  w zDAmEWpBeEA@v5u,"3!5oo55=U@ / _,  3 3ss3 wy_$oo5U_w zy HU4 00D034 w>yw *y U@ / _nn5D %D%D_VnPn00U5U F5 nE rtm쥀t4 vE@4 wpxw \xDmm& / 5ߐN. 7B.w0xw xD5 5 @ 7U5 E@ b1www wDAmEWpeEuA@v5u9,>3!;58 mm56U@ / ll5U_ F@,C-w$w5w wD$%,-Ubl\l5U_ F_*l$l5D5 e%E_wvw tvD 5 wjvw RvDE3!U e%nEw4vw vD e*, ]W-gCta55 8 5% N & ̇ @6v5u4E%@ F tappUB% ta707,A@wXu w75u 5   eA@v5u@-A-uu   _p@ta55 _ _% _”& ̇ _”v5u F@tappUB_ff& e5  _v V5@ &A@v Ct@m55% t@m55TP ] Z% & ̇ 5 _”@v5u%4E%@N FN  V5t@mpH %_Nwƞwž_. w rDC 3 <5 55, @, 55  5@3@5-wPrw (H4E% 4E%` (5  5 ' '7-8't7-:'": e%%t04 wq 'w zq ')wvq~' w XqDCB= N'6 j07-8<' 6'5@@ 5@E@E4P@U@5 & ٖ%5wp%5@%%%%4E%@& ~e&% % %%E7-8\& 5_N& B_N% % S%%UB  fefe& e%_& _w o*: L-woe%D w ro2!nHe ~e07vH2 3 0w:oeBJF2e07:w oDC `EtenH5B , ,wnB- w nD, 5-U  / @@mEtenH5C, C-?) @p$ w\n5*:  ee%D" 0222*23 03 2 U / 0H23 03 2 N  s3s @< 6 " 3 03 2Ae vf& f e55  3  ~_0N V5@eEt5`e4APPPPPP@32@@eAe4PPPPPPefe %ZVN NF 2! rBWp e@AePPPPPP _w XlD U & / 5 032272L24 04 2 Uwlw lD5@ E5E b1 wkw kD %RU 6& & e4 44 UB & 5F  d7d7& eE5E b14  f?b^27TH24 0e07BJ5F5FB 2! rBWp euU3@5@5@@| tEF,( wjw rjB5F__ e vf&  e5 _ʀ€A 2! rBWp eu3 @f&@5 @f&@5@@ @eAPPPPPP*&EF V eEWt@`e4PPPPPP@2e4AePPPPPPe fe %  F whw hD\5q> <A@ee@ c ee@ 5uee@ 5u 5u 5u@E5i& A@ b f&& ^e5uR_ _ff& e55!  _5-<5->UBd7d7& e_Nf k @m&  J~F~N @e!P~t<t>@t@a @ta0 $0 &@t@a ߀ ta0 0   5 u UBd7d7& eBeK@t`5$5&  0N@t@af&ff e @t@a @t`0 $0 &ff xe@t@a 6 "t`55  t`0 0 ff e  5 u Ղ U@wew e @  x u u  ffff ]e5uff@& e5 _5 5 5   v@ Wt @P& v@ Wt @P& ~% VA @t@t`e&  j{f{ F  ff&f e_ VBt`e1  ${{N fff e fff He V ͇zz 5 Vzzfff f @\e5u  N fffff e  wcw cDfef Fg & % zzCeB tBae  & Pe w0cw c 2!t- wc  4eB-: 4E%`t- w bD U & / 5Uwbw bDE5E b1wbw lbDB5 5 5 E5E @x5Ep5% 5 %  fe&  fe&  e57 waCe˥/ @5 ˥/@U f / @5U@ 4 4 @4E%@f_@f B_5  &%??:_˵E%%_a$ EBpu` ˋ˥/"`0$%.$.% 5ˋ 5 $   _Բ_FB%" eОw ʞ5 _AAWp @A@l @mEteH5u%@Ap, p, -"@&e$fe % uu-u-e.w (_ @Ap, !e w ew @x@ _¬Ap_̬ @ x@Ap@0 @@e7tu -@5 H u-@ B __@E@5EN b1N &__N &@E@5EN b1.*@Ap, +__N ~ @U f / @5UЉ̉u_@4 e>w 8_@7(N @@HAepw}@05 __%ˋ 5 5 "e E5 @- -4 4 4@7,< 7,>7 7 E5 &&f he5_e<e@ f& Tef& Te5u5 5 _:5-_FE  __N  &&f he5_5 55 __N V@m5   `(Nf z ^&&f DeAE@ 4`t`t `_:%K@5 e E5 8u-55@5% "um% %55u- @m@5 @0-"fe&e$ % _55AA 4`t`t @5l 55  4 4 5-_"%%_ˋ_@ 6_f B_ (  @><e@ f& bQef& Re4t4 55$tttA @mAm@ 5 u A @mAm@ 5u  A@e@ f& Pef& vQe4t@UB __N t __%ejw d@e E@m&& @><&%% "l&&f De@e E@m&@>0 <@UBˋ E7w@7 7t@4 __N 5 %`ˋ^f B_t E 4 @4 @0-  @_f@& %5 ~_ 54  - 8@-x 8 ~d _ -@)@4 5 %_^ _^ˋtf B_t @0- O_%@% 5;@ }-N ~@5@5U f / e%Dւ@U@ @5_Rf@& %5__Բu "@E@5EN b1f@& %5/_@0-  $f@& %5@E@5EN b1 _ _$ } Γ_$,(@x@ Ap@7N @p@Ap @Ap @Ap@Ap @0"@fe&e$ %@0 @@e7Nf  __@54E%_5@˥/_ 2 5@><Am@ #W ? N __N _N ~_ %>  & f ^ef&@& e55 5 N@>@ae& %@>fef W & %__N 5 CeN ~˥/+N  ˥/ >~ @U f / @5U@ u @U f / @5U@5_"˥/  t _Բ ˥/N _"N _Բw :RN ff@& @e& Xe wRw RD5AE@- e E-%? ` -`wQw QD5 5 @4 "e E5 N5   &&f&ef Oe5  @><e@ f& Hef& 8Ief&@<>N ~@wPm@ f&@><&% m@ f&@<>Ne&&f he5N ~rCe E5@59@@m@- @@m4 =BBm sCmume E5@5`lN %5-Ղ u- t sCmN&e %ffN F@UB  _@4,<_4,>_&&f 0e_w OD  4  &&"e E&&e Oe(Ne f& he wN A1`2e.e FUBw nNDC@3  "e E&e& Oe7B ~w*Nw N @A@v5u fff ^e5u(%fff De%ff@& e5 wM V5 @E@m= w NMDCe5 5 "Neff && Oe5  w Mlu t-<t->Շ  %.%.K-w L D@0- % X  ~w|L% 4E%@  & fe&& Oe%..@p- % ~N&& %Ýw Kww7 Hw3 e7e"bwWp"mXw H 4e%H__w^Kw JKDww7 13!3! + 3 3 3   F@He2( __wJw JzvWp"Cmnvbv^vRv4 e" __wbJw NJ v_8 v*: F%Ce= e X  +( & de52vv M & %^`Z` Fe%D2!5 5FU  d7d7 e ~eB-tނ7 &u zwVIw BI @><e@ f& @e5u_ r 5 Hu D5 5 # fff ^ev5uff@& eeu u-u-ԇ@U@d7d7f ew~H^WpCenEnE @0-5==5U@& / e ނ==500U_ Fw GD  L- t-t-ff, ze;& wG w G*: L-e%2%d E 33wRGe%D܂ N@&O Xٖ% w G<~r5Wt@ 555 % r N6 / 7AWp|DeI3˕@4t3AWpBe*J_b i 5@ 5˕QU@555&& ff @6eue5`@ 655t- s-5!t@ 55me@- ss5 E 2   Y t w,=w =D!@0 @ A *J r5Wp|eIu@ N b15_x@E5EtE5Wp|eIu@&& AWp Am@ @mAm@ f& 5eu@&& ff 4eu@AA 855@AA H55@3 E?%@E4@0 @U b_@U@%5E ~U3  E%s@t@m3 3( v s EtUA55U8U0Kw;w ;@teI5E5@_>C@EtEWp|eIu@45@a5 5 ( ٖ%f n&"+& & eU  %ۇ@0 E%  f _I@E% G E%@ @7   E%@03 3 @3@Ap @  pN b@  ́Wp|eIft5@ @@ Wp|q-IWp|eIft@= ̂ %N fw9w 8D&EtE5Wp|CeI@ m 5 vuEUA5 v]5u55& ff /ef5umu & ff /eu`& ff 0euu@ (15@ <15@_A mm@ f&Eea&f e &  U@ w7$ 5E5A vu@e5`A@5vM  OA@Am@ 5u5 @vEWteufE& AA vA_ee@ 5uff \%A@xff ږ% A@v5u5-   @A@Am@ 5ur@t@m2rrA@vr(J_w 06  AWtEWp|e*Iu6ff fff e w5w 5D5  WtEWp|CeI `& ǖ% @w5EWp `@55 `& Ȗ%A@_  _  0_  _ _  8_  _  _  _  _  8_  &_  >_  *_  v_  z_  ^_  0_  @_  4_  _  _  _  _ _ _ _ Z_ _  >_  _  p_   _  >_  n_  _  _  L_ _  _  p_  _  _ &_  L_  \_  _  V_  _  ,_ |_ _ _ _ _ _ _ _ _ _ "_ R_ _ _ F_ _ @_  _  _  F_  H_  z_  _  _  8_  _ _ \_ l_ _  _  _ _  _  D_ 4_  _ _ _ 0_ ~_ _ _  >_  J_  _  "_  B_ f_  _  _  _ _ _ _ _  _ >_ _ $_  l_ :_ l_  _  _ _ n_ R_ _ X_ _  _  _  _ _ t_  _  _  b_  _  _  D_  B_  _  L_  _  D_ _ _  H_  p_  _  @_   _  \_  _  0_ _ X_ _  _  h_ _ _ _  _  _  _  _ _ _ _ F_  _  J_  _ _ z_ _ _   _ "_ L_ r_  _ 0_ _ *_ _ _ (_ _ X_ j_ _  J_  \_  >_  _  _  ^_  R_  _  ._  _  `_  _  _  _  _  _  <_  _  X_  b_  _  _  _  _  _ `_  _  _  _  _  _ _ _ _  N_  _  _  _  _  _  _  P_  _  _  _  _  _  _  F_  _  6_  _  _  _  Z_  _  _  _  _  B_  _   _  _  _  H_  _  <_  P_  _  _  _  @_  _  _  0_  p_  `_  |_  _  _  _  J_ x_ _ _ L_ _ _ _ w ~*~55@e55 Ne 4wX*w D*ND%L@e555 tfe& %7Ne 4w)w )@e555Ne 4w)w )N% @e55tfe& %7|Ne 4w^)w J)D%D> , F_< 25 5 4 4 5 lu e 5-t t->5  $t-+B<@ A f&L & vEE     7p@7`wR(w >(> _5 :_u%fh_%fh_A@EvB%_W= /P5 fe \fe %7_W=@  fe  W= @{f  xN& AN@N&  6Ne& Nef&  %7 W=@ P5 fe fe %7w&w &4 fe   fe  %e vB tfe& %7T@ tfe& %70. tfe& %7  _fe& %7 Ne 0 D< t&fe %57 t&fe %57| t&fe %57TwB%< @BR Ref& e7QwQd7fe 8 ߐdU@fefe @ږ%7ڀ _$ 0-xQ(-pQ#-fQ#-`Q< @BRQ ef& e5 u ߐ_5@w-dE@E@ )@eP~  H  Ne zH %b6 / _AeP~>H _w v#D  x 82ߐwT# 1w 8# 5    x 85  r `t@m55ff >% a@- v5@u@` 5, e D- %@w"Nf@  ` r f vf&` r `t@mUU w 6"w>"w *"DNe ~   ab6 b1 tn%b66  82  15@E@ߐNe w!w !DC-w!w !-w!w !-w!w !D-w!w p! Pwt!w `!d  4E%@V w>!@ B 짳  w !  Pw!w D B@2 J  4E%@ ~w @ B  w && 6%wx w d h& 6%w\ w H B@ 5 ,._J@2 J525A _<fE h _ N 52    ~d ^ h  & & f& Oe7( ~ww  B@@0 =N B@ 4E%@ 6 ',5@5@5  N l  6U@   ~ ~wVw BF D * xll t 77 w><ll@ 4t  w Bмк@2  #5& B3& B 5@& B ~wTwRw:w &@ Xw*w  Xww 4Br2  Ne& DV  ~4fe %7ww  B2 2  (4E%Ne& & && Oe7t ~@7^wPw <@B@2   & ` 7, ~ww    ` 7 ww DNe nuNe& & ww B@2  Ne nE5Ne& & 7t ~w\w HH  Ne nE5Ne & 7& ww DC7-8 ! h 5 O4E%@: h 5w E4E4P4U@5 54 w llB2 2  Ne nNe& & 7B ~w*w   Ne n55Ne & 7 ww DCB%8%:7-8-8 h  w585:8:  U@  lE4  ^E4 w *&*BNe n BBu55uU fe& %7#@2   uuuuNe & 7 ~ww  0ww zzB@2    BNe n55Ne & 7@ ~w(w  '5  Ne n55Ne & 7 ww     < ww "5 5 5 B5 @@0 }N _@ 5@5@ ~!  ~$_4E%@?@e5%.@% fe % !5 ~!  ~\U  ~ 6U@d7d7& e @1@=N F@5@ #5@5@ ~  ~ 6U@ ww,  ( %& B@  ~& ڽ 7N ȥ@  )2-   6U@d7d7 eN& 5_f,3-3- _54   ,8-8_4E%@2  0%6B_ _ :(6( 0( N& %5_ _ 6  6 &  @eU@ ~ @@0 }N @  !  _z f N K 6U@ & fe& Oe51%.. X u & fe Oe && & N l  6U@E *5  ~  ~ __w D   ~ wUF5U@ AA @@3468::54 : h E4d7d7 e 7f3 6U@w 00B@@0 =N _  ~_@ EU@ _UF@ A @@3468::d7d7 e 6U@d7d7 e@e P~   & fe Oe72"> <N 7 @ @0 =N  6U@3 6U@  ~ ~w w B2 J _ !   ~xb4E%@bO,RG%6 & 0B485@5@, l ' 6U@ ## # 2 ~ 6& & Σe ^#Z# T#   ~ ~w w %@ ,  wf w R VXbE7LwJ w ~*B _ Bj ef&&p j0ewt(w `($Ce,h_D  > %D> (%3 60 %3 TT~| f& %3fb m vsmm@ f& %3  5<5> ff & Oe7v ff& Ze wJ'w 6'  W-  CEA@v5u  eu  W- A@v5u t @mw&w &0  w&w &B\@\@@\0 \N\ 5_$5  5 5 j_@5@5458@545:@f B_5 f B_@4E%@5I45^NeZ&  fe^f& Oe7_%Z #^_@^ _, _, _, _, _, o#!_ De`̕ @e~!̥ ̥  ̋De` ̥ =\̥  ̋5~̋ ̥ ̋  fe~& %N ~@\@@\N\ 5_$?fef\e$ %5_n5 5 5  L  ! NK 5 b _@ _L5 5  %~@e~55, @e5 %%~u@   5A1` @ 0 @ 5A1`  %3T 99  @ E5Nf@ @me&fe^f e_  _ 4%X[ ^9Z9 AWt f&A Evee@ f& e V Ne&f e5XumNe&f  e5XumDmumB%X X_twX 88UE  _Wt f&A Evee@ 5TuVffT e fVfT eUE  eB-_N ~5 @ e5A @e5pNNf  5  eu-  f  e  f     x7t7U  `gNf  0 B7>7 AWt f&A Evee@ f& eUE VNef& l e5XumDmumB%%_lg _l , AhEp7 PF ?>fe?>f\e$ % <686U N  ! K% N ~wjw V5$5&0 $0 &\C5 e C5 e 7 7 7 7 ,h ʵ ( e ww D` 555 8  / 4 /2@/_$ m@ 5ut t- T_$4     @   @5 %0b s-5e -Je? vu m@ 5u e? vuAe? veu@e2P~7 7  _&Ne&  fef& Oe7D 84 2AeP~_$Ae vwAe? vue r7zmt7pwl AaAe? vCC-2AeP~_$  A6`p8 % 7Ae v@e v _F _Ffb5 f  Ep_ffff De 2AeP~_$7 2b5   f H e? vB C$.`&  f H N&0  f & & f& De5 e u  v5`u`5mu  & ff&& f& Oet5 w p w P % wwww(ffff Dewjw VZt `wRw >EP "3 3   , 0 ,4hŽ ( -  ~   ~XT 5  .2! K%04! K%,?! K%% t D5D/ E e5   @e5 ~ seP~e 5 JD1 'X X b15E   %  %  $C   %  b1 @wTw @@E%4 4 44 Ne& ږ%7wwww 4 Ne&r ږ%7www DP @( 5 B?s-:%3#  ,(/ @ +&e %Vefe L&fe %  rB_t e 3 33 3 2B.B3 3 3 3 $3 &3 3 "3 3 3 (3 3 63 ws-3%3#  ,(( "5 55U   @WtUp_P    _PtU5&fe %_P5=   !JD@ A f&@ & vEE  __f / _w X EU b1& / 5 327h 347`Eww  w w  ww  V@-  >@-  &@ @   % &>N  RANA,  ,   X1`w>w * ?%0u?d?7 -?85 0ut?+-? -?( ?-?-? 7- 7 -?(7-(7(?   ? 7>:4 >4 @EU4((88?  44$$&& ""4 64 E e55t=b>057R>  5,@ - 8  8 8 ʰ  ʰ    p%w~2244..00, ?! NK Ne?42! Le57 t,& & e9t,?&,f ~%z t.2&.. ~%t04&00 ~%5 3_U g .2! K%04! K%3 23 43 8UU& / 55 232763..4 24347"3004 43884 8U b1\& DeE _w  I x    œ%8f6 4(; 3-( œ  *~; 3- œ ww   P x l   w 64(: 3-(   j: 3-  <w DC , ( 7-7- %%  N  ww %_tefe& %7^ >%" %""< ff e5u%" %""< ff He5us-s- s- s- R AePPPPw w %S B@eWtePPPP%%< ff e5u%%< ff e5u&fe &te& %7w w L  xfe L&fe %7w w DCe(  vB blL ee wn w Z DCL&  <  e t< @B<  zef& Fef& e4t<  he4t < @B<  ef& ef& $e4 t( * ,.02468:<> @"B$D&F(H*Jw( w ~*f %` % X  dbM@wL*w 8*% AWpFq6w** w * BWpFCe6  .2%w)$E  Le3 "$ 5$ UCU@f)Wp  w v) AWpFDe6N&)Wp   nwX)w D) AWpFDe6Nf&)Wp %w()w ) AWpFDe6Nf&)Wp %w(w ( AWpFBe6U&)Wp " w(w (D AWpFCe6N f&)Wp ew(N f& .gew R( AWpFDe6E $)Wp (w:(w &(D 5=$!F,E 0- 5@$E@$e b1 &$E& & e4 E$ 5e = =  3U $_w'n EP%E&f %U$w D'D0ut/5~ b/0 V/ p%   6/w'w &  f  / xJ7F5&  7_w&"  w j&  fU@E@wR&w >&>p7 %7Fw4&w &2 %7(w&w &w&w %&& (" De & H 7 w%w %  . QL%IF%C 5 5 9 0  0  0  0 ! WteU&p  0  p  p  8$w%w $  8jd5@ed7PPPPQ_< & @B ef& 6e5u&fe %7  & %7wr$w ^$ ^ fe& %7ZNe  fe& %7(wr:wn:w$w # p /@PP 7`Pw`Pw PB<5d7APPPPA& PP *ew~P_w#w #  _^fe& %7x_^A& ff ef&< ff leee@ 5u W  %=%8pjwmOwmOw OA& ff Zew`O<OeOw O%<Oߐ = u55u( wfO+`O r<5 A& HO r<@ f& e5uw"O&fe %w0"w "%&O5 5 5 5 nh ׵:<>@"te<  >e5u<  e5uߐ&fe %7wt!w `!`%j_> 4 _>fe %74h5 %r>r@  e@r >r:r<  =e<r :7te< ff e2r  e<r < ff e r  e<J _wP w < @ ",@  , ,@Bw @ % "   rJ6 B2 r   7r*6&@  w @Br`J `@Br`r 2`N wxw d@  @e@Bp e@,,@B@eH @@B ww KKww   b @7hK7dKww K K &7 %7ww   %?7JK7& \%7|2K07wbw N ̬ J  wDw 0   X 44%dX  Be? I     T  &! K%7]4WpBedXwH3te f7j]3WpBe2!wH3Wp e0bwLJxJ,I7 &I3Wp e? vN! NK 73 3Wp e? vWteUw3Hl3Wp r -H V3Wp r 7HHWp"e? vuN! NK 7H @teU7pHfH$e? vN! NK 7T\ @  2 ef& eN! NK 7I  @! NK 7[ [a0[[ 7[7[ n6G tWten6pl6 -62Hww   e@ %  @ %ww p _V1t%  $GG7 G7 GH v5u  1 Tee@ f& eCtptpe u  !  &v K%ZZ " e@ f& eDv NK  v 7^Zw\ZteHZ v5u Jree u  w8w $DCb 5K P"H `ۖ%ww DC3 _4N f `ۖ%& o9 x5N f% `ۖ%N fl `ۖ%N f `ۖ%e%% r y d N ff hee N ff& heN fA t@=%N f ,< `ۖ% N f `ۖ% B%  @ 5 _JN f>_D ! $_h % ' (N f%_4 _: _z _ !_ &@ _JN f `ۖ% _r N f@& f& he5 _JwZw F De @  xC eu f& ff j e`@f& ff p eu5vN f & `ۖ%@e!wN f - `ۖ%A@  5uw  @ R?UwB?N X N  wTw @N  ٖ%w:w &@f&@Eea&@Et&f e ww D5+B<  @$" EW % N t N& t N fߐ50 .% +%(%4R$%a0.R @RRmR R%R7 Q__5  ww  UO  |0- 57 "XP / 7 X XXWE  82 P / WWp Wh7 WP b1wJw 6-W  w40W7 WP b1 _x x6pW %_x^W 7XWPW %_x>W 4W_x%_x r 7WH8 _x 54_x& De V  VV  &lf` De _x _X_X nV _x`VZV  _XLV r e%%4 m`  %Pe UVEVU_X%25 U2%U. +U  ._XU%UU% UU_Z `U_Xw Bfe p 7T@@@0 =N B% ~74E%@ ~)% &f xۖ%Ne e&  e N@me&  w>w * 5 @E55 ` fAWp %& f Te55 *: .5#+ 5  N ~ 4  N _:` __e%Dʂ*:  e%D tLef  & %##N 5  3 333 s #@U R#@J# D# @E@5EN b1wz fAWp %N ,b w < >N 7Fw4 w Nfe p  ew *:%D 5#N N 4 |N b E 4  `& fAWp %N , w z B   z ~wZ @2 J 4E%` ~-H= w ~*  w~*w j*  wn*wpw N*DuEp% =5 0 Q3555 55  Q5 xQ HQ  Q w)w )DEtE5%  p 5Q  U bwp) e v@55 #u5@mAm@ f&AWpAm@&%  AWpAmefB ff ` egt x6WpCe0Q,&5  ,o _w z( n5 o 5t7Pn wh(t@ QU 5AWpBe0Q @ 5@ @Q@ QU @Q5 E>%@ , Q@  Q@ QUO @% 2  *n$n nn w n' mmm wb' mEt555B ff euA r5A rur@ QU 55 ?5  E>%4N ٖ% E>%$ X@ QU 557 m7 m33 U b_$2@ 0 Q@t@m2 v r2  2@ Q EWt@PUA55UUJ_,w %Blt]Fl57 8l Bl_ 4lEt55V5 55 5  ٖ%U7 k%k 5515 gf1ff eU7 k57 k5 bk _ x5 5 5`NkE%@E%  _t@ QU 5  j@ QUK @  Q7 j*@  Q@ QUO%j5jEE4@ QUM  bj5bj`7 Pj7 Xj Tj"7 Nj7 Vj@j2 2  3 b N 5 5t5@5 5%(@ Q"N 5  i  i ( 5 @w #t5w "D&Ti@ m 5 vuEt555B ff ef5A 5`u`u B ff eu`B ff euA r5A ru h@_A mm@ ee@ f&Eea&f e   E5tA@5v5u@`e5 v]5uumu U5 @RA@vEWteufE& AA vA_ee@ 5u.5- -  'ff p%A@xff ږ% eu A@v5u%  w 5s@ QU 5 v]5uumu s@t@m3ss s@ QAEWt@PUA55UUK7 fw DtE Q@wEWp`@w  >dX4,U47B~NNJ*p  % te &>e^f&tð à % x R4 6   ( V\tPE@P7,U7& "0*Wp $ Wp $`Wp %Wp @ &5u   Wpufehd e @ E% % %5 wI II ! K% 50&   xۖ%  O/2vJrJ u5vwXJwTJ\7d7PPPP \A,: %7H ,: %70 7 (] vf& ec vf& eH e X . e? vf H  H & e? vf& De&  % Fwlw XE 33 e%wHw 4D4444e%ErI v5u (WpDenE4 tt JVD>V076V 䎃 eu -$2ww xJeE GGeFe 1teXJ wvw b7 r7 nw^w J7 ZwLw 8<    6(*ww &ww ww ww ww %% #  & %77wzw fj    d-`  X  l D(w*w  D%"7!7! r @%   L z7ww %    %Ϸ      vϷpwXw DH %Jw8 & %7. ee%w L- e%  e%ww L-  we%%Lw w-L-e%% wpw \ ^w^^7 _ w 67 ^7 _w:w &5 5ߐ#w Ul_`J / -WWߐEL_JWWW@0!@9%@tWfevhWm`W %..N&fev N+%57a2W%*W7 $W@ @w , @  -VVwt^ w  d]4 ^^ & T^ e7 H^5@^ >^ 4^ & $ &^ & % 5^`J b1E]ww z@ }f5 ~f0 f  vt3 wt4w\ VV5  eu @pHU|]  El]wh]b]w D XX@ U %t3 s3 @t3A vE@3 Wp " 5  / 5_5  Մ`et5`  w$w DN& ! He & % U@ww DC 5 5  <lU_T5 eE5tE5@-_l vE@Am@ @-_  5U@& / 5_4 _x@ U ttE5AWt @`AE@`5tE@`4@tE4 v4t 5  5& / 55@ b1_5JmrsA 3`s`s  5_rEH 5  e   l"_  vE@ww D & f& AWpf eww rD 8%  ! NK  _ ! K% Ne?&4&2! Le     e  2&2f&. e.2e vf ! K% 4&4f&0 e04e vf ! K%?f&, e, ! K%t.t0t, 3U4ww DCB %2%4Ne4e vf2e vf ! Le L U 88  &.f e%.! K%  &0f e%0! K%5],ew ]_ ?&,f e% ,?! K%t.t0t,E4\;7V;N6 b1ww z* 2t25.B-BNNm! K%_X4t450B-B`0_D  %%k50C@`5 f`f` ~% ff ~I p `N! NK 5 & eU 6% t0@5`t.ff ~%N! K% $!w6w "-]-^- ^Ne n߂ R~^SS l Zed2 ,  w V& ΗWE: \ ~ E]ߐW I~w h BW  R~wZ rfWp ew 4 Df& p<f& f& Nef&Q& T f ,eee@ ee@ ee@ w el r    rd 5w @Fem ` @   % l@`` @ wZ w ~*D 7re %0xwb* w J*CEWpBe0RUq q%w"*ʋ2 2  25PU25& f ܖ%r55 5, 55ʕr w \)AEWpDe0R%5f ܖ%f ܖ%f ܖ%3 f ܖ% w(w (RPJ 5 U@ / 5 s%%s s3 3   wt( "5@ b1Ew D(DEWpBe0R v x65vr22rer 4 jd do7^oZo07Ro Po Rߐw'w '2o_EWpBe0R@o2 6o2 ,o2"o0 oE,o2ʋ_ n5_ 5 _ %R_ 4 _$nn0 UA?n_r _ v2  r 54 _$5 ve@ 2rvf&u5&%G Emn0 2tn pm  p v @m1 EtUA5U8m5 4  7 xmIU0m5v5 u Lmvf@Zm1YPm"mvA@2m1[(mw%v2 _U7l b_w J%l_E5WpBe0Rl2 l2 l25~l7 zl5@l_l5 55?h 5E5 bl5 EPl5 ʋ&ʕ#:l5  v @ l1v2r  %kl  &&f Xe % k% kker k[k_%U 5xkrk5@  P d xzer 7 ,k7k b6k 4B%kA f&v 2r$jA f&vee@ ee@ 2re@ 2r rjUjw"5j5 vw "fjEE Lj0Dj :jw"w "RAEWpCe0R@m 2 xu@ ' x@  w0"@@5 !N@ &f ܖ%%% 55  u@ @ @ w t! w:iwp! w X!DEWpBeR% iw4!ʋtEWt @\UA52Uhn7 / @& (ܖ%5 r E%A5  5,  55 ʕ2 2 2 2r5 ,&0 %_ _Zw DCEWpBeR%5& (ܖ%& (ܖ% & (ܖ%5 & (ܖ% ww DC nR5 5 U@ / 5 _2 2 r2 2   "5@ b1Eww DEWpBeR5 x6vr22rer 4 4. f7f|f07tf rf Dߐww LfPf_E5WpBeRt42 2 22ʋ5 U7 fe b%nRE%@%e,'e Wp %< Wp <%, Wp %< Wp <,r%% _ _v2  r U v2  r 5 5 ve@ 2rvf&u5&%2 0 45  d d Et\@]5<twddv5 u vf@4  vAt Wp %< Wp <%, Wp %< Wp <,r\4w cccE5WpBeR%c zc5,I2 2 25Hc7 Bc5[55@, @ 47 c c 3 b% b%ber  w5 5E@%5ʋ5ʕN f1 Xe U@ + xer %nR  x  l v2r _Hw 2DEWpBeR%E X pj ߐ,&0 %ww Dav5uEWpBeR%nR7,, A@ 2r  @mAm@ 2ree@ 2rrrw&w nRAEWpCeR@m 1 xu@ & x@  w@@5 !N@ &f (ܖ%%% 55  u@ @ @ w DWp6CeS% we bS @5e H! e e5SlNe x6A vA]7TewRe RRJe S @ m eme@ 2.r00\.2,w $ DuE R% O?&&# Xe P WpURf Xܖ%5@$$ !5$ $@E%3 3  3 3h2 wfw RDC tE R%5 & Xܖ% & Xܖ%& Xܖ%5 & Xܖ%2ww D AWtEWpBeR2 ,  5 U@ / 5 ߐr2 r2 2   "5@ b1EwVw BDEtE5 5RAWpBeR5! x6fe v>e^f&@@e p 4 < 6  202 N `ߐww AWpeRuU@0 @ b@_~@ Re4ށ5@AWpeR @%p _v4 t U v4 t 5 5 ve@ 4 t vf&u5&%- +@  3 5@ U@U <,w@ v5 u vAr vf@2  w  AWpCeR@ RH%  5<5 3 5_E ? x5$ h2 "3 3" b N `w5 55P$_%T %er $&&f~2 He & &2 He ( +(#2 He * Q*I2 Hes2 H U5% 5$ N2 Hۖ%5@$N2 Hۖ%@ 5 xe2m r _|AWpeR!_|  _|2  _|v2r_u _|w <DEtE RWpeR!8v2 r v" 2 r   !vl"@ 2ree@ v2 r ww  @ Ree5@U <,5 5 %'%'w@em0 2.m033.<,5 5 %'5N| X  w  @tE5 RAWpCeR@m ) xu@  x@  wN@5 !N@ &f Xܖ%%% 55$ u@0 @0$@0 w D5 me  f a a  @ H xv_E5 @, @fe N+%5##& N+%5  w  ``t  @w A@v_NE w w n A@v_NfE T wB w ~*AWp`DeS% wj*t w L*DWp`CeS%    p 1BT BTK3Vw*w )FT 2w)e4 ^ w ) AWp`BeSV _ xNy X _ E% ' +% %%2 2 0~9 Xٖ%e& b1_6_  rU E@ ' D+% %%34_ E%@ ' +% %% 8 U4 BT& VeHVe e @VeVe( e e>51Ap 2 Ve51 Ap@0 @0 @@0 fe  @0 0 "@ @(U___f Xٖ%q5f7 Xe 2 2 0e& b1 BT@04 @ #0   t@mU  rCt@m5  @ 0 __ 6 b1 w&w ~& DE @tE5%AWp`CeS  `X 0w4&2 `Xzt5%=  N X _052@2@@@5_&p- Xe  BT5 A ru@tmV5 _zt __ww DAWptCmVeHpE4`E%E%&  4 4 0e& b1wdE5 % aX 2 2 r 2  r y "e5 #0  ,t,.pt.2( @ @5@f&& "e &> He@5ApUN b2 "_*N& &] Xe@Ap@Ape5 N b_*@Ap@Ape5 %%<22 "@Ap@p@p@ _*0  ,t,.pt.@ _* + % @f&& HeU @A p@0 @2_ "(_ _j @_ D_ E_ Q_ R_& Xٖ%_ A D_ P_ R_w DEtE5Wp`BeSE `5X@%2U bwp x6 5Ce 3034  3  ,,.. 0 _w  AWtEWp`eSuDe@m * xu@  x@  w@5 N@E&f ܖ%%% 5 @E @mXu@ Wtp@ pP@ @ w DC  & e  L x ٖ% &d Z @e &0 e^ ey& & @f&e tee" Xww D5 0  202r x  zxz4 |4 ~ s 3&  . 23  " 8 V5"V ,WE,lV,nWE @%r "&f %,+(+ @w|w hD %V%WE %Vl %WEn J   2  2 f& b %50 5t5@t-r AWp CCmexAWp Baex, ,",w4 p 4pf& % w vD5 @E5Wp a | ~  | ~wF5 5AWt BttPA]p@ @0& N N "@N V5"V.,WE*,lV&,nWE" f& %0),)= N N "5 )(N @w @ DArWp Caexx w&w  @t5@E55t550_%k_AWp Caexbl@ 5u5 ex;bl@ 5 ,u (,$,%5t@=Neafeaff 7 e e 5-r'' ww DC Be  %f'b'@ed _2 x& % "AEWp `e t5  U E 5  wV5  & ܖ%5 %&&`e ex %@5 5  & ܖ%5 %@&<&`e ex %U(ffE ܖ%5sw ~*<Aa  ” mA 55 DE!wEED5)5! wr |XW-b   nwW- #B    tb 0 U ~EEuP(E$U E@U@E5A 4@UUAa  ” mH5A  5ene_2 w(NAa8Hpppppppp.wd(BE? eCE eCa@E x5e55@le}C l e 5@DcNa ^UNa UU Na  5Na    U `8Na   |e)Na " Na  LA `eb   *wZ5wTU@a 5E@a 5 & ef   EU P5f e5  e e  B 5   P@afPPQ5 5    5 C B A  `HBXRI.(>H8I &&ff P5 wH}w5 D7w 5 ^w5  Be 6w5  "e 50e e   5  55EA UU 0w\5E d5 E &E?5w w~5 "5r e B e5 5> e 5&e e 5  5 e 5e e 5w8Da55* <5  "03$1,e $%5`)e $e $  "$ $5& $$ 5 5 Le 5e |e r5  5 e v5 e de \5l  Ba5 5F 5@8e 5@"  wF   w85E@aU  @a@ (    U5@&  B  U5&f&A fe \&DP U  U5A  UEE 5Q7QwUw@aU 5 5 Pw8@aU 5 @ E KE UU5Ew  5 i [AA W 8]@a W 8J@afc     ` AaBau- a h h   Aa Aaa  !  AaBaR B@a =AW ZW 5e UET5@ (e 54 e e R55  e 5e e   5  UwF >_6 6 @aAa   Ba5 r@r@B  e  W- W-55 e  Pu @f@a    ua@a$ $$$@a& N & N  N N S C B A  eNaV-· wwn um fua5Pe       NaV- @aP    =0&@ad& dN & dN dC N eN eu-w : :5  :70w% # fe& %5@@ # x fe& %5-  Ri^X / Bi :i2iu &fe&& fe e 5  7 h h7 h^X b1   &fe %5w _rw %_%_%__ x2.11BSD5Nef f f _ f f f e _ 0_0_0_0__FTNeff f f e5 @_-T ~% _wS _@7ff f f e 5  wNFFFNeff f f e5wEwEN f C\7f f f (e4N f 0N ff fe 8N f @N f H f f f Pew@ _-w %VQ xPDP115Nef f f / fe T W vf&f f f pe Ef f f Pew@ -w DDm4$ r e0@$ r ww |% 6f f f (ew^@ -w :%ID xDDCfe%"z7   v-p-f-`-= \-V- !  B-<-!f f f (ew@ -w  5 %  % wj   ff %5   f f %5@w  5  % w   ffe %5@w  5 %  % w   ff %5   f f %5@w 2 5  % w    ffe %5@w 5 N 2 5 =   u- w  }Nff %5  N f f \%5@ @m @w F5 N 2 5  =  w& }  Nff %5@w  5 }-  u- w  }Nff %5   Nf f %5@w f 5  }-  wT }   N ff %5@w uu  0b e -?eWp}C@@= ;0b.)%5ffe %5  fe& %5@ee -P?ς@@= wVw B(( @B eu5 (fe& ff (eww C5 2!  eB-= AeWpD}C@= <@@m52!* %eD@-5fe %5 Be& %5@ eDeB-<ӂ@= w6w "uu   f  e-PeWp}C@@= ; f. )%5ffe %5 fe& %5@ee-^Pς@@= wfw RC5 @  55 % % w$;5 __t@  x@0- >h@@0-(4^Nefefe& `e M@p-F@0-?Nefefe& `e@p-+%J$Ne& h B& %5eBfe %5eJJeJ~: _z   @= @-  _jer} _jw DC efee& `e @3&3 ww z@5>@,$$E  @4,4  ` Wp " " 5  V5555l$h$U 7}}} w w ~*Tt f t?t7te-Pjwf*w R*8 J & /  ( 6 ,t7(tT%Tt 0   t?t7t  b1n0 8w)w )D@ _p pD  /   ps 3  8   x  b1_p(s  @  % _p r 3   AAe? vu Hdse vN ! NK 3 ڹ 3 3 U  8 x& & & f De5 e u U ff@E&& && Oe7 pHAAE 5`u`u wF@ 8A @6t! . ff tt&&& Oe7^ݵ`u %7 Ew'w 'D! NK 4 &&& e  b1&   9N e b1.U Nwx&w d&D & / wL&w 8&D & /  b1w &w %D b1w%w %D 9 & /   &&& e&! K%4  b1wf%w R%D f  0!% e-ew.%w %D & /  ' 4 e vf ! K%  &! K%E 3   b1w$w $Dn@ 2  e! K%3 3! b1w.$  b1    / w #  w#w #  N % wmw# 7 mw # @tE5% mSAWpjDeT5 N & / 5  4 UN& E b1r99@E@- t]t] w"AEt5<&f& e% %`L]w n"D tE5WpjBeTEt% +@\2 3U5AWp TUAWpeTf / %`@w!_C b1 w !Dex&  &(*(.r @t 3$   `fe  %wJ!w 6!DCe N& ݖ%fE ٖ%5 @t&? eN& ݖ% %Z7V7`&e ex %w w D EtE5E5AWpjCeT% |j5  U bw> AWp B`e  e v@55 @mAm@ 'r # 5u  4   A@v t ll@ #W ll@ @mAm@ W  55   x64  && et5AWpeTf bi __Pw >i*5 AWpBeT aAWpjeTu@5E b1 % xh^ hEtE4  et  evt  E4tU@45U N f& lef U  ww g h_h5e5<%hY& i\ Xe5@6 2tU 5%g&  Xe 1tU 555 rg% lg1 (U1111m11w ~17 x1 n1f1f1 4 7 g7 g7g b ww f(01Wt@7$1-1115 1t]1410 v t%0e % 70 000Et]0 ww DC f  :   @  EE@ -  tEWt@PU tEWt@PUA1tU= 05wXw DDletU 5E? v@ 1ww 7 ne WpBT<WpT 22  `evC  :    A @2T %ww p  AWtEWpjeTuff fff e w<w (D5  WtEWpjCeT `& Ֆ% @wEWp `@5 5 `& Ֆ%A@w  c @tU 5E% %%b = f" Xe AWpjEUw>5@ P$@ ($AWpjUU  N w<(088 @HP Xjump to 0forced from console 7RPPz  (: $&"ȕ1ȋ55@  /etc/init-00000& B~~_.pxՀ^NՐ՘^Nըհ^NRNRNRN^N^N@9;">`8JRNRNRN^NRNRNRN^NRNRNRN^N6ƖRNRNRN^N^N  (08^N6Pm^N^N^N@@RN^NH^NRNRNRNRNRNRNPm^NRNRNRNRNRNRNPm^NRNRNRNRNRNRNPm^NRNRNRNRNRN^NRN^NpxPPX^NHրՈՐPP`^NH֘ՠըPPh^NHְմ^NF^N^NRNRNRNRNRN^NRN^NRNRNRNRNRNRNPm^NRNRNPPRN^NHRN^NPPRN^NH@9;PP֐I^NH">RNRNPPRN^NHRNPPp^NHRNRNPPRN^NHRNRNRNPPRN^NHRNPPN^NH6RNRNPPRN^NHRNRNRNRNRNRN^NH^NxրֈRN^N^NPP֠^NHRNRNRNRNRNRNRN^NRNRNRNRNRN^NH^N  ^N er (08@HPX`hp e e e e ex e e# e\ e\ e e e e e e e e e e e e e e e[ e e ( e08@ eH ePXhN e e` e e5 e e e e!8"|"" e e ehp e ex eX e e ehN e e# e e e (08ٝtimeout table overflow.44file##%%%%%%%%%%%%%%h& & &n&h& & &h&n&n&n&n&h&n&&&&&&&&,&,&&&,&,&%&&&&&&((&&((&f(f(f(f(&'D(f(D(\)\)\)\)\)\)l)\)\)\)issig .core+n,,,--r---ureadcuwritec\2d2\2\2j2\2d2sleepwakeupsetrunremrq77| ub_mapZBBBCC(JBJ^JzJJra: !disk structs rara%da is entire disk: %s rarasa %o state %d ra: Err %d ra: state %d ign ra: fatal err %o ra%d !ONLINE ra%d: OFFLINE rastatus %o ra: op %o ra%d: %c%c%d%c size=%D ra: %s err, softhardctlrM_F_BUSADDR %odisk xfr, unit %d grp x%x hdr x%xSDI unit %d hdr x%xsmall disk unit %d cyl %d?, unit %d format %o, event 0%o malloc: size = 0short of swap mfree: addr = 0%s: overflow, lost %u clicks at 0%o short of swap zN UVpWrwip sync rwip: %d SHLOCKEXLOCK] U_pWL`v`      babaaaZcRca>bbbabaabbbaaaZcRcka6 = %o aps = %o pc = %o, ps = %o __ovno = %d cpuerr = %o trap type %o trapparity %o parityTrap to 0: Random interrupt ignored ddddddd22xxx}}}}Rgpggggjk(kTklkkk$l@lXltllmn~vvuuJvvvd}j}j}~t}j}j}^ ttyrub "nn(w\z"pRN^NfnRNRNRNRNRNRNRNRNRNRN"nn(w\z"pRN^NfnRNRNRNRNRNRNRNRNRNRNRNRNRNRNRNRNRNRNRNRNbad free countfile system full %s: write failed, file system full no inodes free %s: create/symlink failed, %s bad block %D, ino %d %s: %s dup biodone̤4@no imtinodefree inode isn'tiputnamei: null cache inomangled entryi_size too smallnamei: duplicating cache%s: bad dir ino %u at offset %ld: %s wdir: newblkwdir: compact1wdir: compact2hole in dircheckpath: .. not a directory fs = %s update: rofs modbad block %D, bad blockbad countno fs on dev %u/%u |ŎŌŌŎ| 00xpxp%da using labelonly geometry: %s xp%d: write locked xpcs2=%b er1=%b er2=%b DLTWCEUPE NED NEM PGE MXF MDPEORIRCLRPATBAIDCKUNSOPI DTE WLE IAE AOE HCRCHCEECHWCFFERPARRMRILRILFBSESKIDPE IVC LSC LBCDVCMDPExp%d%c: soft ecc sn%D  (\  rdZJ06666>bltn.....rename: lnk dirrename: lost dir entryrename: mangled dir Accounting resumed Accounting suspended execexec: EFAULTinit diedexitprocno procsnewproc vfork SEG5xitimesnmidesc_iobasebuffersmsgbufclist > 8ksyncing disks... %d done halting dumping to dev %o, offset %D dump device not ready (EFAULT) arguments invalid (EINVAL) I/O error (EIO) unknown error (%d) succeeded hbrrrrrrb0123456789ABCDEFpanic: %s %s: table is full %s%d%c: hard error sn%D >j4| | Zi(i| | ~ 00\~hk%d: not ready hk%d: write locked hkcs2=%b ds=%b er=%b DLTWCEUPE NED NEM PGE MDS UFEORIRSCLRBAIRLSSVALCDAPIP WRL DDTDRDYVVDROTSPLSACLOOFFDRADCKUNSOPI DTE WLE IDAE COE HRVCBSEECHDTYEFMTEDRPARNXFSKIILFhk%d%c: soft ecc sn %D swsizswtypiinit phys mem = %D avail mem = %D user mem = %D hard err: swapsorry, pid %d killed in %s: no swap space out of swap space;; c@bbrr*tu%d: not online tu%d: no write ring tu%d: can't change density in mid-tape tu%d: hard error bn %D er=%b ds=%b CORCRCUNSOPI CTE NEF CSITM FCE NSGPEFLRCINCVPEDPARFMTCPARRMRILRILFATAERRPIP MOL WRL EOT DPRDRYSSCPESSDWNIDBTMBOTSLA` `H"*  @Nte%d: not online te%d: no write ring te%d: can't change density in mid-tape te%d: hard error bn%D er=%b ILCEOFCRE PAE BGL EOT RLE BTENXMSELRBOTCH7SDWNWRLRWSTURtmintrte%d: lost interrupt b  $DDDDTTTts%d: not online ts%d: no write ring ts%d: init failure tssr=%b SCUPESPE RMR NXM NBA A17 A16SSROFLFC1FC0TC2TC1TC0-ts%d: hard error bn%D xs0=%bTMKRLSLET RLL WLE NEF ILC ILAMOTONLIESVCKPEDWLKBOTEOT xs1=%bDLT-COR CRS TIG DBF SCK -IPRSYNIPOIEDPOSPOLUNCMTE xs2=%bOPMSIPBPE CAF - WCF - DTP xs3=%bLMXOPIREVCRFDCKNOILXSRIB tsintrts%d: set char. failure $mmrw&Cf,6FTjxR p8Vtstep%d init failed: sa 0x%x tms%d,%d: fatal error 0%o tms: no drive descriptors tms%d: random intr ignored tms%d: intr unknown state %d ignored tms%d init failed tms%d,%d: hard error bn%ld tms%d,%d: sa 0%o state %d tms%d,%d bad ioctl tms%d,%d: hard error bn%ld: OFFLINE tms%d,%d: hard error: OFFLINE tms%d,%d: invalid cmd endcode = %o status=%o tms%d,%d: hard err bn%ld status:0%o flags:0%o tms%d,%d unknown packet tms%d,%d: %s err softhardctlr err event 0%o host memory access err, event 0%o, addr 0%o tape transfer err unit %d grp 0x%x event 0%o STI err unit %d event 0%o STI Drive ErrorLog unit %d event 0%o STI Formatter ErrorLog unit %d event 0%o unknown err %d,%d format 0%o event 0%o %x ,2222I/O errorno disk labeldisk label corrupted%s%d%c: overlaps open part (%c) ,@PHXTp4|JRX (V8Ldx,JPX`pxJxZhRflr`ftextxallocrlrl%da is entire disk: %s rlcs=%b da=%b CERRDRENXM DLHNF CRC OPICRDYIERW_HSELSEEK_HSELGS_RESETSEEK_DIRrlmp=%b da=%b WDEHCEWLE STIMO SPE WGE VCHK DSEDTYPHSELCOHOBHRW_HSELSEEK_HSELGS_RESETSEEK_DIRrl%d: !status cs=%b da=%b CERRDRENXM DLHNF CRC OPICRDYIERW_HSELSEEK_HSELGS_RESETSEEK_DIR2.11 BSD UNIX #77: Sun Oct 29 00:10:29 PDT 1995 sms1@sms.sms.iipo.gtegsc.com:/usr/src/sys/GENERIC <&PT 4`QQ!UXV!coremapswapmap# $p7$\7 $nE%$n6.#6$6<#E#M$hR$0bX$7a# e$2!l$`Jt$d6#!# $H#!# # ## $T6# $`6$lJ$dX## !$ f$d7$z7 #!# $0!')"." 4 7$< B(H&M:R"WZc!Vjo#x#~$Q$.R$T$TRZX"P"$`Q$P#$pJ"p"$nJ$rJ #b$U$7#"B+"x1$\J8#.D#,Q"p\"| d$l7n"w"̇~$5"f"Z"""#""z$D&J","b"""h""^"#$#-#8$7@"G"\O"W$E`"Fh"o$l6y$7"D#r$xJ$6$6""P"ڽ" "`#0"""."" ""($R07">"H"rO"(W"_$\6i#p#x"" "8"""("(""0"0"#6"~""" """l *" 3"v)9#!BK"W#`"g$nRo$Rw$P6$D" "D"z#F"0""l""x""" "."#"8("-"3"x:"D"P"DY" `"g"o(x"`~"H"|""("""" ""$x7"h"`"L" "X "4"[""")"00# 5"="C$5M"T"Z"c"j"Pq"|""""""""""" "`""""""8)"04"p="F"TQ"^"g"8o"px"`""p"h""X""8"h"r"$" "0" $Q #H #x $ Q" #- $Q6 $Q@ $QI "S "Z "@b "j "r "z " " $Q " $0Q $7 $7 $Z7 " "x " " "H "X "p " " $Q" "- "3 "; #B " H "xO "bW "^ $Hf $Hn "t "&{ $nH " " " " "l "( # "pW " U "X "zN "V "DV "Z $5! #\ + "3 ": "J $PO "~U "\ "d "o "&v "0 " " " # # $"! " "# "# "# $v7 #B $n7  " # " " "H " " $P* "4 "> "xG "PO "X "c $Qm "Xx "6 "0 " "h "h "NK "L "x6 "7 "V # $R6 #d " ^X "K " " "@ $*: "x) $J6/ "fI3 ": #C $HK $HT "] "4g #p $f6y $H  " " # " "` $,! "b #| $h6 "RN "hN " $&! " " e$ZJ #R"^N"'"o2"8"Z?"(F" M#n U ]"d"j"r$5{"\"]"_## ""@"X"h$5"P"\"("%"h"ރ"`""h!")$5-"84$8<$8F"IP$7W"8a$X6j";s"<~"H"D"9" ="=" B"I"pE"BD"@9"`8"F"E"J" @ "">"P"O%"+":"D"6]K"xR"Z# b"j"$4q"y"""6 "XX#$T""":"t""8""p" ""!"*"6$T=$TE"L#U$5^"e"l$L6s$N6{$$!"P4"x$^J"~" """"h".$D$(!"H"@"H$b6""r4%#-";"F"Q"@^" i" q"z"2"X"""""3"82"!"""!"|""5 "8"""!")"/0$78"@@#K"(R"Y"d$So"u" |"$"""X"j("2""$"T""|"""""""2"F """<#"+"3"<"|cE" W"8f"@s"0"""P"""(""X"H"#"#("@3$R=$vJH"Q"8]"d"j" t"}"(#"P"`""p$FT"x$BT#$S""#"*"6"A"K\"k"u"@""`""8"$VR"0""H"`"$R"H" "X"P"X$"h-5="E"hO"`X"d$Rk"u#n ~".g# "m"(w"f"Pm"f"F"\z"rf"Le"y"n# "0"e""p&"n1"n;""nD"L"tW"o`"~k"|s"b~|"e"he$0R"# !""#v $7"0#"("<""&"-"N+"""("/"H7"?"I"Q"H["1d"o"0w"n/$V6"",""*-"n"\"""[""$"N""#"b1" "0"b^8"@"H"P"xY"`$Tg"n$.!w"~$I$I#~",""""n"|"N"""""f "6$J "*$*J2$T9"B"K"T"]"pd$5n prtvy| 2X "+/37<HJLRY]behlq8uzT.^0 !%+/v3:AFHJLNPR" W ] hknq~w~`x n~(0 F&/T;PE&OX^djpsvy" ~" 000 $+29EJOTY0aei rz~0#d0$TX  "N    ( #/ B U X [ ^ d g k o u X{              ^       8 6  H!!!!"!'!,!1! 6!;!@!E!K!Q! W!]!c!i!m!q!t!z!!!!!!!!!!!!.!!!B!!!! !!".!8!r"B "h """#")"."P5" 9">"`E"K"R"T"V"X"Z"\"^"4e"l",s"z"X"""""T""R""J"|"H"@"P"X""V"("p# # ## #&#,#0#3#9#?#D#Q#V#b#0p#w#{#####$`V#.##### ##############$0$ $,$(8$xD$P$[$$g$s$$$N+$.$D$$~$$$$$$ $$$$ %% %)%1%5%9%">%B% F% J%N%R%V%Z%a% h%n%t%z%%%%%%%%%%%2% &&$&+&2&"7&;&A& L&W&b&e&r4j&q&"v&|&~&&@&r4&N&&&&&&&&&&&&&B&~& ' ' ' +'7' E' Q' \' g' q'lw'}'''''''''t'b'''8'L'd'x''''''((( (((TX((("(((1(6(;(=(?(A(C(E(H(M( R(W(\(c(k(q(t(w(z(~((((((((\(((((((((d((( ((( ) ))))")().)#6)^;) ?)C)G)M)P)S)`)e)k)o)q)w)})))))) ) ))))))))) ))))*** * * * *)*2*8*<*A*H* K*#O*# S*[*b*@h*o*P w*" *" *" *" *" *" *" *" *"& *", *"2 *"8 *"> *"D *"J *+++ +++ +(+-+2+7+@+E+M+P+S+Y+^+b+g+l+@t+w+z+++++" ++++++++++++++"+"+p+",, , ,,`8, ,@$,NK*,., 4,<,B,F, J,ZP,V,\,b,jf,:j,n,r,tw,^|,,,,,,NK,,H,,,,,,,,,,,,,,, , ,NK,,~,,,----- ---6-&-VX0-8-^V?-B-E-H-K-N-T-X-]-b-g-l-q-v-{------ -------NK---------- -- .. .).4.4>.A.D.G.J.Q.Y.\. _. b.l.p.t.x.|.`....$XV....." .... . ...."..NK.RN/@////)/zN5/\@/N/"& V/a/f/i/m/o/r/u/x//////// //////// /h//////x/000 0 00\00'0/0205080;0>0A0" F0`M0 S0 Y0a0d0g0j0m0|r0w0|0p000Le00"000000 0 00000000 1"1" 111<11&1-1115191">1̇J1T1^_1n1z1B1 111011 1111"1"11r1111122 222"2B$2'2",222 62 ;2A2G2M2S2W2^2 e2o2hz2 2222 222222222222222222222,23X 333 33D$3D.363>3D3O3X3&`3Jg3Zm3t3}3B333333z333F333l3:3:34X 4j4,4H'46.474C4J4DZ4>c4lq4fy4\4&4444(4@444~464h4^445x55|55j'5.575@5H5S5~^5k5u5b555F55455555v55@56X 666%60-656=6F6R6\6f6"o6z66466466:66*6@66B667 77<7H!7+7"47<7XE7RP7[7<b7hi7o7x77N7N77T7T777>77777787H778 888 8/898:@80H8P8(W8a8j8u8:{8H8t88888888V88888$84899F9H 9T+999:D9O9\9g9p9}9p99h999 999999N9X9v99 ::n:!:':0:<B:,Q:l^:l:x::x:L:8::::\:>:; ; ;r ;+;3;l<;&D;L;2W;:c;q; };;;;;;;~;;V;;v;L;<<|<,"<-<5<=<F<ZN<BX<a<<m<t<|<<,<B<<^<<<T<<D<<<<<<==t=,=%=,=,5=>=G=dP=FW=__iosize_avenrun_boottime_buf_callout_cdevsw_cons_dumpdev_dumplo_end_file_freemem_hz_inode_msgbuf_namecache_nbuf_ncallout_nchstats_nclist_nfile_ninode_nkl11_nproc_nswap_ntext_panicstr_physmem_proc_swapdev_swapmap_text_time_total_ucb_clist_version_xitdescBCBADCGOODHTHTBAHTCS1HTCS2HTFCHTTCHTWCPSTEXTZEROTOYCSRZERO_Dmatrix_Fops_HKADDR_HTADDR_RLADDR_TMADDR_TS_ubadr___sysctl__cinvall__coremap__dlabelbase__dlabelnum__iobase__ioget__iomap__iostart__ioumr__ovno__swapmap__ubmap_access_acct_acctp_acctresume_acctsuspend_acctwatch_addupc_adjdelta_adjtime_alloc_allproc_b_to_q_backup_badblock_bcmp_bcopy_bdevsw_bdwrite_bflush_bfreelist_bhinit_binit_binval_biodone_biowait_blkatoff_blkflush_bmap_boot_bootcsr_bootdev_boothowto_bpaddr_bread_breada_brelse_bufhash_bwrite_bzero_callfree_calltodo_catq_cexp_cfree_cfreecount_cfreelist_chdir_chdirec_checkpath_chflags_chflags1_chk_chmod_chmod1_choverlay_chown_chown1_chroot_chrtoblk_chrtoblktbl_chtbuf_cinit_clear_clkstart_close_closef_clrbuf_clstaddr_cmask_cnaddr_cnattach_cnclose_cnioctl_cnopen_cnputc_cnread_cnrint_cnstart_cnwrite_cnxint_compress_conf_int_copen_copy_copyiin_copyin_copyinstr_copyiout_copyout_copyoutstr_copystr_core_coremap_cpu2str_cpu_sysctl_cputype_creat_ctmbuf_ctsbuf_curpri_cwaiting_delay_dirbad_dirbadentry_dirchk_dirempty_direnter_dirremove_dirrewrite_disklabelalloc_disksort_dkcksum_dkoverlapchk_doboot_donice_dump_dumpsys_dup_dup2_dupit_endvfork_entergroup_estabur_etext_execv_execve_execve1_exit_expand_falloc_fchdir_fchflags_fchmod_fchown_fcntl_fetchi_ffs_fgetown_fileNFILE_fill_eproc_fill_from_u_fioctl_fioword_flock_fmove_forceclose_fork_fork1_fperr_fpp_fptrap_free_freeproc_fserr_fset_fsetown_fstat_fsync_ftruncate_fubyte_fuibyte_fuiword_fuword_getblk_getc_getdd_getdtablesize_geteblk_getegid_geterror_geteuid_getf_getfs_getgid_getgroups_gethostid_gethostname_getinode_getitimer_getmdev_getmemc_getnewbuf_getpagesize_getpgrp_getpid_getppid_getpriority_getrlimit_getrusage_gettimeofday_gettoy_getuid_getxfile_gldav_groupmember_grow_gsignal_halt_hardclock_harderr_hk_hk6_sizes_hk7_sizes_hk_cyl_hk_offset_hk_pack_hk_sizes_hk_type_hkattach_hkecc_hkintr_hkopen_hkroot_hksize_hkstart_hkstrategy_hktab_hkustart_hkutab_hostid_hostname_hostnamelen_htattach_htclose_htcommand_htinit_htintr_htioctl_htopen_htstart_htstrategy_httab_hw_sysctl_hzto_ialloc_icode_idle_ifind_iflush_ifree_ifreeh_ifreet_iget_igrab_ihead_ihinit_ilock_incore_indirtrunc_inferior_initdisklabels_initflags_ino_close_ino_ioctl_ino_lock_ino_rw_ino_select_ino_stat_ino_unlock_inodeNINODE_inodeops_insque_ioctl_ioctldisklabel_ipc_iput_irele_isdisk_iskmemdev_issig_itimerfix_itrunc_iunlock_iupdat_ka6_kdj11_kdsa6_kern_sysctl_kill_killpg_killpg1_lastf_lastiv_lbolt_leap_leavegroup_linesw_link_loadav_locc_lock_log_log_open_logclose_logioctl_logopen_logpri_logread_logselect_logsoftc_logwakeup_longjmp_lseek_lstat_main_maknode_malloc_malloc3_mapalloc_mapfree_mapin_mastertemplate_maxmem_maxslp_mem_parity_memlock_mfree_mkdir_mknod_mmrw_mount_mountfs_mpid_mx_namei_nblkdev_nchash_nchhead_nchinit_nchinval_nchrdev_nchsize_nchtail_ndays_ndflush_ndqb_netoff_newproc_nextc_nextinodeid_nextiv_nldisp_nmidesc_nodev_nonet_noop_noproc_nostk_nosys_nselcoll_nsysent_nulldev_nullioctl_nullmodem_open_openi_owait_panic_partab_pdpfec_pfind_phys_physio_pidhash_pipe_pipe_rw_pipe_select_pipedev_pipeops_pqinit_prf_printf_printn_procNPROC_procxmt_profil_psig_psignal_ptrace_putc_putchar_putmemc_q22bae_q_to_b_qquota_qs_raVec_ra_com_ra_disks_ra_error_ra_sc_raattach_rablock_raclose_radfltlbl_radisksetup_ragetcp_ragetdd_ragetinfo_rainit_raintr_raioctl_ramsgclear_ramsginit_raopen_raroot_rarsp_rarspring_rasize_rastart_rastrategy_rawrw_rdwri_read_readdisklabel_readlink_readp_readv_reboot_regloc_remque_remrq_rename_restfp_restormap_resume_rexit_rh70_rl_rl_dk_rlattach_rlclose_rldfltlbl_rlfh_rlgetinfo_rlgss_rlgsts_rlintr_rlio_rlioctl_rlopen_rlroot_rlseek_rlsize_rlstart_rlstrategy_rltab_rlutab_rmdir_rootdev_rootdir_ruadd_rucvt_runin_runout_runrun_rwip_rwuio_saccess_savacctp_savemap_saveregs_savfp_sbrk_scanc_sched_schedcpu_securelevel_seg5_select_selscan_seltrue_selwait_selwakeup_sendsig_sep_id_setdisklabel_setgroups_sethostid_sethostname_setitimer_setjmp_setpgrp_setpri_setpriority_setquota_setregid_setreuid_setrlimit_setrq_setrun_setsigvec_setthetime_settimeofday_sigblock_sigpause_sigreturn_sigsetmask_sigstack_sigvec_sleep_slpque_smount_socketops_socls_soctl_softclock_softspace_sorw_sosel_spgrp_startup_stat_stat1_stop_strlen_stst_subyte_suibyte_suiword_sureg_suser_suword_swap_swapin_swapout_swkill_swtch_syioctl_symlink_sync_syncip_syopen_syread_sysacct_syscall_sysctl_clockrate_sysctl_doproc_sysctl_file_sysctl_inode_sysctl_int_sysctl_long_sysctl_rdint_sysctl_rdlong_sysctl_rdstring_sysctl_rdstruct_sysctl_string_sysctl_struct_sysctl_text_syselect_sysent_sywrite_szicode_tablefull_te_softc_textNTEXT_timeout_timevaladd_tkini_tm2t_tmattach_tmclose_tmcommand_tmdens_tmintr_tmioctl_tmopen_tmsVec_tms_info_tmsattach_tmscp_tmscp_cp_wait_tmscp_softc_tmscpclose_tmscpcommand_tmscperror_tmscpfatalerr_tmscpgetcp_tmscpioctl_tmscpopen_tmscprsp_tmscpstepfailed_tmscpstrategy_tmserror_tmseteof_tmsginit_tmsintr_tmsstart_tmstart_tmstrategy_tmtab_tmtimer_toyclk_tprintf_trap_trsingle_truncate_ts_softc_tsattach_tsclose_tscommand_tsinit_tsintr_tsioctl_tsmsg1_tsmsg2_tsopen_tsseteof_tsstart_tsstrategy_tstab_ttbreakc_tthiwat_ttioctl_ttlowat_ttnread_ttread_ttrstrt_ttselect_ttstart_ttwakeup_ttwrite_ttyblock_ttychars_ttycheckoutq_ttyclose_ttydefaults_ttyecho_ttyflush_ttyinput_ttylclose_ttymodem_ttyopen_ttyout_ttyoutput_ttypend_ttyretype_ttyrub_ttyrubo_ttywait_ttywflush_tu_softc_tvfix_tz_u_u_ualdiv_ualsh_ub_map_ub_wantmr_ubinit_ubmap_ucall_ufalloc_ufs_mountedon_ufs_setattr_uiofmove_uiomove_uldiv_ulsh_umask_umount_unlink_unmount1_unputc_unselect_unsleep_untimeout_update_updatepri_updlock_uprintf_ureadc_utimes_uwritec_vattr_null_vcopyin_vcopyout_vfork_vhangup_vm_sysctl_vmmeter_vmtotal_wait1_wait4_waittime_wakeup_write_writedisklabel_writep_writev_xalloc_xccdec_xexpand_xfree_xhead_xinit_xitimes_xlock_xp_controller_xp_drive_xp_offset_xpattach_xpclose_xpdfltlbl_xpecc_xpgetinfo_xpintr_xpioctl_xpopen_xproot_xpsize_xpslave_xpstart_xpstrategy_xptab_xpustart_xputab_xtail_xumount_xuncore_xunlock_xuntext_xwait_zombprocaaaaa1a1a2ac0ac1ac2ac3accacctbufacpactionaddraddraddraddraddradjustadradraexpagainagndataiovaiovaitvalimallallocbufanyaparegargargvasasasignatimevalatvatvatzauioaverunnablebbbadi1badinsbapbasebbbbbbpbbufbcdbdevbexpbitbitbitbitbitbitsblarrayblknoblknoblknoblknoblknobnbnbnbnbnbnbnobnobnoboot.obootoptboundsbpbpbpbpbpbpbpbr.obr4br5br6br7bregbsdbsignbufbufbuflenbuflenbytecccccccallcall1catchfaultcccccecfargcfnamecfuncchancheckchkuvclass2class3clkinfoclock.oclrflgclrflgcls2datcls3datcmdcmdcmdcmdcncncncncnrintcntcntcntcnxintcollcomcomcomconf.ocons.ocontentscopycleanupcopyfaultcopysetupcoreaddrcountcountcountcountcpcpcpcretcs2csncsvctlrctlrctlrctrctypedddd_sizedaddrdatadatadatadayflagsdblknodbufdensdensdevdevdevdevdevdh.odhu.odhv.odidiedidopendidopendiffdirbufdirbufdirbufdirtemplatediskdiskdiskdiskdkbad.odlpdlpdo_panicdocachedocmpdoingdirectorydoingzombdoingzombdoingzombdosubdpdpdpdpartdr.odrivedrivedrivedrivedsdsdsizedummydumpdz.oeintstkemsgemtendendendsearchendusefulendvecentryoffsetinblockentryoffsetinblockepepepeprocererrerrerrorerrorerrorerrorerrorerrorerrorerrorerrorerrorerrorerrorerrorerrorewhereexdataffactorfbpfcountfcountfdesfeafecferr1ferr2ffuiwordffuwordfirstfirstfiuvflagflagflagflagflagflagflagsflagsflagsflagsflagsflagsfmtfmtfnfnamefnamefnamefollowfoundfpfpfpfpexceptfppfpsrfreecorefregfsfsfaultfsrcfsuwordfungidgidgidhardboothardclockhardldivhardlremhardprobehashhashhiwathiwathk.ohkintrhowht.ohtintrhtopshtunitiiiiiii.absxi.addxi.cfcci.clrxi.cmpxi.divxi.ldcjxi.ldcyxi.ldexpi.ldfpsi.ldxi.modxi.muli.mulxi.negxi.setdi.setfi.setii.setli.stcxji.stcxyi.stexpi.stfpsi.ststi.stxi.subxi.tstxibitsibitsic2ihinageindirindxingreslock.oinitinit_main.oinit_sysent.oinitoyinoinoinoinobasinstrintstkioconf.oioctlioflagioflagioflgiovipipipipippisdotdotisvforkiteritmpjjjunkk_comkern_acct.okern_clock.okern_descrip.okern_exec.okern_exit.okern_fork.okern_mman.okern_pdp.okern_proc.okern_prot.okern_resource.okern_sig.okern_subr.okern_synch.okern_sysctl.okern_time.okern_xxx.okernelmapkindlllabellabellabelpartlastlastlast_attachedlastblocklastbnlastiblocklastlbnlbnlbnldivlenlenlenlenlenlenlenlengthlengthlevellevellevellevellibc_bcmp.olibc_bcopy.olibc_bzero.olibc_ffs.olibc_insque.olibc_ldiv.olibc_lmul.olibc_lrem.olibc_remque.olibc_strlen.olibc_udiv.olibc_uldiv.olibc_ulsh.olimrdplimudplmulloclocallocallabellockparentlonghostidlplp.olqsavelremlsizemm.extm.lngimachdep.omachdep2.omaddmakeentrymapmapmaskmaskmaskmaskmaskmaxlenmaxsizemaxszmch_backup.omch_click.omch_copy.omch_csv.omch_dump.omch_dzpdma.omch_fpsim.omch_profile.omch_start.omch_trap.omch_vars.omch_xxx.omdaysmem.omod0mod0fmod0rmod0ramod0rxmod1mod2mod242mod24dmod24fmod24imod3mod4mod5mod6mod7modctlmodctl2moddatmodemodemodemodempmpmpmpmpmsgmsgmtgetmtgetmtimevalmtopmtopnnnnnnanamenamenamenamenameidnamelennargcnbnbnbnbpnbusyncncncollncpndndonendpndpndpndpndpneneedcloseneededneedienegretnewentrysizenewflagsnewlennewlennewpnewpnewparentnewsizenfdnfoundnhpnlinknoaddnofaultnormnpsnpxnpxnreadnsntnumdirpassesnuminumidnxpoobitsobitsobpobufocmdoffoffsetoffsetoffsetoffsetoffsetoffsetogidolddensolddensoldlenoldlenpoldlenpoldpoldpoldparentoldsigolpononononce_thruoonstackopenmaskopenmaskosizeospouidoutpriovovaovdoverlayovflagovfloovheadovhndlrovhndlr1ovhndlr2ovhndlr3ovhndlr4ovhndlr5ovhndlr6ovhndlr7ovhndlr8ovhndlr9ovhndlraovhndlrbovhndlrcovhndlrdovhndlreovhndlrfovmaxppppaddrpaddrparam.oparentinopartpartpartpartmaskpathpathlenpcpcpctmppdevpdppgrppgrpphysendpipipidcheckedpippnewpoppowrdownpowruppppqprbufprevoffpripspspsizepsizeqqqpquota_kern.oquota_subr.oquota_sys.oquota_ufs.orr0r1rara.orablknoraintrram.oraprdflgrdisplyrecalremresresidresidresidresidretretretretretaretbretryretryreturnmaskretvalretvalrk.orl.orlintrronlyroutrprpmrurururu2ruidruidruprvrwrwrwrwflgrx.ossssssssss5s_sizesaddrsaretsavecolsavekdsa6savelensavepssbscscscscscb.osecseg5seg5seg5seg5seg5seg5seg5segasegdsegfaultsegflgsegmentsepsepsetasetabsfshshargsi.osigsigsigbitssignosizsizesizesizesizepsizepsizesslotfreespaceslotneededslotoffsetslotsizeslotstatusslowuldivsnsnsnsnsourcesovdataspspspspacefreespcspssr0sr1sretsssssspssrststartstartstartstartstatestatestatusstrstrstratstratstratsubr_log.osubr_prf.osubr_rmap.osubr_xxx.osupsvgidsvuidswsizesys_generic.osys_inode.osys_pipe.osys_process.osyscallsyscalls.osystszszptt1t1t2t_flagstatabtaddrtargettbuftdatatdptempteunitteunittickstiptmtmtm.otmintrtmopstmstmstmscp.otmscpaddrtmsintrtmsopstntntntntotaltoy.otoy24toyloadtoytimetptptptptqtqtraptrap.otrap1trap2trapinstststststs.ots11ts11tsintrtsopsttptty.otty_conf.otty_pty.otty_subr.otty_tb.otty_tty.ottydttydttypttypttypttypttyptvtvtypetypeu_sizeualdivualshuapuapuar0ubub_firstubaddrubpubpucpudivufs_alloc.oufs_bio.oufs_bmap.oufs_disksubr.oufs_dsort.oufs_fio.oufs_inode.oufs_mount.oufs_namei.oufs_subr.oufs_syscalls.ouiduiduiouiouldivulshumundefvarunflounitunitunitunitunitunitunitunitunmapunwindupuremvaddrvalvalpvaluevaluevattrvattrvecvectorvers.ovm_proc.ovm_sched.ovm_swap.ovm_swp.ovm_text.owaitwaitforwcwcwcountwherewherewhichwrongxxxx1x1xcxcxdxdxic2xic2xicp2xofloxorsignxp.oxpintrxppxrwxrwzerodivzjmp~__sysctl~_ioget~_iomap~acct~acctwatch~adjtime~bhinit~binit~boot~chdir~chdirec~chflags~chflags1~chmod~chmod1~chown~chown1~chroot~cinit~clkstart~cnattach~cnclose~cnioctl~cnopen~cnputc~cnread~cnrint~cnstart~cnwrite~cnxint~compress~copen~cpu2str~cpu_sysctl~creat~disklabelalloc~dkcksum~dkoverlapchk~donice~dumpsys~endvfork~entergroup~execv~execve~execve1~exit~expand~fchdir~fchflags~fchmod~fchown~fetchi~fill_eproc~fill_from_u~fork~fork1~fperr~fsync~ftruncate~getdd~getegid~geteuid~getgid~getgroups~gethostid~gethostname~getinode~getitimer~getmdev~getmemc~getpgrp~getpid~getppid~getpriority~getrlimit~getrusage~gettimeofday~getuid~getxfile~gldav~groupmember~harderr~hkattach~hkecc~hkintr~hkopen~hkroot~hksize~hkstart~hkstrategy~hkustart~htattach~htclose~htcommand~htinit~htintr~htioctl~htopen~htstart~htstrategy~hw_sysctl~initdisklabels~ioctl~ioctldisklabel~itimerfix~kern_sysctl~leavegroup~link~lock~log~logclose~logioctl~logopen~logpri~logread~logselect~logwakeup~lseek~lstat~main~maknode~mem_parity~mkdir~mknod~mmrw~mountfs~newproc~nostk~open~owait~panic~phys~physio~prf~printf~printn~procxmt~ptrace~putchar~putmemc~qquota~rawrw~read~readdisklabel~readlink~readv~reboot~rename~rexit~rlattach~rlclose~rldfltlbl~rlfh~rlgetinfo~rlgss~rlgsts~rlintr~rlio~rlioctl~rlopen~rlroot~rlseek~rlsize~rlstart~rlstrategy~rmdir~ruadd~rucvt~rwuio~saccess~select~selscan~seltrue~selwakeup~setdisklabel~setgroups~sethostid~sethostname~setitimer~setpgrp~setpriority~setquota~setregid~setreuid~setrlimit~setthetime~settimeofday~smount~socls~soctl~sorw~sosel~startup~stat~stat1~swap~swapin~swapout~swkill~symlink~sync~sysacct~sysctl_clockrate~sysctl_doproc~sysctl_file~sysctl_inode~sysctl_int~sysctl_long~sysctl_rdint~sysctl_rdlong~sysctl_rdstring~sysctl_rdstruct~sysctl_string~sysctl_struct~sysctl_text~tablefull~timevaladd~tkini~tmattach~tmclose~tmcommand~tmintr~tmioctl~tmopen~tmsVec~tmsattach~tmscpclose~tmscpcommand~tmscpgetcp~tmscpioctl~tmscpopen~tmscprsp~tmscpstrategy~tmserror~tmseteof~tmsginit~tmsintr~tmsstart~tmstart~tmstrategy~tmtimer~tprintf~truncate~tsattach~tsclose~tscommand~tsinit~tsintr~tsioctl~tsopen~tsseteof~tsstart~tsstrategy~tvfix~ubinit~ucall~umask~umount~unlink~unmount1~unselect~uprintf~utimes~vfork~vm_sysctl~wait1~wait4~write~writedisklabel~writev~xalloc~xccdec~xexpand~xfree~xinit~xlock~xumount~xuncore~xunlock~xuntext~xwait05l7000/user07l[]_0왕0왚0l{wqmgc^ZTPJF@<62,(" {uqjf_[VRMIC?:61-'# ~xtnkeb\YSPJGA;5<7rra9d Krrrra9d Krra9d Krra9d Krra9d Krra9d Krra9d Krra9d rra9d Krra9d Krra9d Krra9d Krra9d Krra9d Krra9d Krra9d Krra9d Krra9d Krra9d Krra9d rrl0e rrl0c rrl0a rmt81 Qnmt81`U ttyl1 rl0h`rl0e`ttyS0 rl0c`rl0a`rra10f Urra10e Tra10g`Vrra9g Nrra9f Mrra9e Lrra9d Kra9e`Lra9d`Kra9a`Hrra8f Erra8d Crra8c Bra8g`Frmt76 Lra8c`Bmt72`H rra2d rra2a ra2g`ttypf  ptype  ptypd ptypc rra1e rra1b ra2e`ttyS7 ttyS3 mt64`@ ra1c` rmt8 ttypb ptyp7  ptyp5  ttyp4  ttyp0 rra0g rra0d rra0b ra0a`tty null \~zuqlhb^XTNJD@:60,'# |xsoie_[VRMIDC<92/(% }zspig`^WTMJC@970rra10b rra10b Qrra10b Qrra10b Qrra10b rra10b rra10b Qrra10b Qrra10b Qrra10b Qrra10b rra10b rra10b rra10b rra10b Qrra10b rra10b rra10b rra10b rra10b Qrra10b Qrra10b Qrra10b Qrra10b Qrra10b rra10b Qrra10b Qrra10b Qrra10bklog mt89`Y mt81`Q rmt77 Mnmt73`M rl0f`mt65`A ingreslock rra10h Wrra10b Qra10e`Tra10b`Qrra9c Jrra9a Hra9h`Ora9f`Mra9c`Jra9b`Irra8e Drmt88 Xnmt88`\ nmt80`T mt80`P ra8d`Crra2f ttypc ptypb rra1g rra1h rra1c ra1h`ra1f` ra2f`ra2d`ra2a`drum`ra1a`ttyp9 ttyp5  ptyp3  ttyp1  ptyp0 mt8` rra0h ra0e`mem lzvplfb\XRNHD>:40*&   zvpleaZVPLGC>:51+'!  rrl0g rrl0h rrl0d rmt93 ]rmt89 Yrmt69 Ermt65 Arl0g`mt73`I rl0b`ttyS2 rra10d Srra10c Rra10h`Wra10d`Sra10c`Rra10a`Prra9b Ira9g`NttyS1 rra8h Gra8h`Gra8e`Drmt92 \rmt84 Trmt80 Pnrmt64 Dnmt72`L mt68`D ra8b`Arra2g rra2c rra1f ttyS6 ttyS5 rmt12 ttypa ptyp9 ptyp8  ttyp8  ttyp6  ptyp4  ttyp3  ptyp2  ttyp2  nmt0` mt0` rra0c ra0h`ra0g`ra0f`ra0d`ra0c`console \{wqmhd_[VRMIC?95/+%!}ysoie_[UQKGArrl0f rrl0b rmt85 Unmt89`] rmt73 Inmt65`E rl0d`rra10g Vrra10a Pra10f`Urra9h Orra8g Frra8b Arra8a @ra8f`Emt88`X rmt72 Hrmt64 @rra2h rra2e rra2b ra2h`ptypf  ttype  ttypd rra1d rra1a ra1g`ra1e` ra2c`ra2b`ttyS4 ra8a`@ra1d` ra1b` rmt4 ptypa ttyp7  ptyp6  ptyp1  rmt0 nmt8` rra0f rra0e rra0a kmem 0<lѤY0왕0왚00>lrC/13570X0X0<x%wZZZZZZZ7:w::N:tEtp<` 7:<:K  :&f   :w D:D& Wp < w8:w $:D& Wp < w:w :D Wp  @ee 9%wZ2w F2D ̋7= . < ̥/ˋ ˥/ !=N& 5Nf  K= . N  ̋@w1w 1D e = . W-Ct`55A@wj1 5   eA@v5u@-A-uu   ff= De@t`55 b V^@t5,g5,g%A@vmTmV@ 4\t^@ 4=`b |@tpgpg@ 5=@ &A@v Ct@m55  ff= %_^ w /D  C >><4f> .e e4E%@ <N :55 5 5Ne  s-ef :wN/w :/D 2#>JE55 3v5uff He5u  ,A@vlTlV@ 2\r^ed2`b |CmedlL 2-@ w.w .D '> .I%Wp<CeC˵ ff ,e5u˵^\vf@   sXsZA@vlTlV@ 3\s^3 b w-w - % _ _#_AWp<DeC̵o b_> &Z&X ,ev4\t^̵^\vf&& e5uvmTmV@ 4\t^ed4`b7 $J | &Z&X +eu̵A mXmZ@ 4 > t @@Z@m4b Iw,tb b@med4` beZt X ` `w d,  5 BeN  wN, %@w *,D % @0C = @ ȥ @0-%0ClC/13570X0X0Wp<BeCʵʵʵrbr` |A r 2`\r`^r \w+A lXlZ@ 2 > r @@Z5C e = ~@w ,+D%C@  | @-*%Wp<BeCʵʵrbr` A r 2`\r`^r \w*w *5 AWp<C  %.> fAWp<CeCD ̥̋(̥( <>7eH>1 < f :ԕ( < r3 5 AWp ue5` ̥0̥9ԥ, X> . w)5 AWp ue5` ̥0̥9̥) )sPsR $̥,5 AWp ue5` ̥0̥9ssPsRԥ)%P%R  3 T3 V̋@ & z 5 >f  @ U 3 X3 Z3 b3 \3 ^@e_w (D % Wp<CeC˵w(˵  w j(> fwn(w Z(N> . wT(w @(=> . @E / x=> .N > . Nf ff ? .e>>>>>>>w 'BAA WpDe<@B-9 m 2 m&3? .eNe 5 Ce @t@`e5 ˥0˥7  mH w,'w '  w'w 'g ff #ee0@$ fe #e  w&w &Dh r e0@# r w&w & E?54@tE5 vu5&@ 5@ 5@E5`A vBE`@ 5u%5 A@v5uumu C? fA@ # E}}w%w % @ed5@^ \@edp`@b@(@*@.f  %@P@&fP? .e w*%ffed 9% (-@"V,WE ,lV ,nWE  @P@&ft?w $Ded̵w$^ \ed4`b&VWEVlWEn3 p 3p&  %N? .  w ,$D 5 rWp Baex5x@ @w$w #D5 _AWp Caex%Z  UA@bl@ 5uex5 9u-1  ,bl@ 5 !u ,,5t@= Neafea? .%e 5-r 5-rw#w "D w"&  Rb& 0u  &    w "f  w"w ~"D @bf  0u  f   w@"w ,"D P5 5?5 _PUp@p@b p@b  pBtU%U8!%U0%@U= =>N B]5@5 5@L  @&f? .eN @ % @ .w!&  5@5 Nefe&` 6%@5P__@mbw DEE  w w ~ f  w| w h D w^ &  R 4 b&   w  D P5 5 5@L%@U_% @@U p w@A]Ug @ff @ .e@ % :@ . &  @555Nefe&` 6%tAWt@PEWt @\@@b p@p%_@Up@55@;_5@mb_w D   @ 5 N&  @   whw TD 5 w>@ J@YE5@t5`@ pYY5Nefef 6%@ AA]pX @ X5BteXNefeX 6%Jr2 NefeX 6%@p@p@@ X5&  5R 4 b& @  _w f  ww D5P J@5 Nefe&` 6% Yp Yp Y0b% %%% Y% YP% YF AUxY=5] WpNYWpfYWpfYWpfXfP@ .e@ % @ .% Y X5Wp5X8 w% Y |WpAXmb@w BD  @ 5 4 bN&  @   w w D55PWpBe,Y w@ @@@_" 55Nefee 6%E% f@ .es5 E% f@ .es5@E%@ f@ .e f "% N@ . _ @0@r@t@m@  f "% Nf@ .%_ @t@m0@ " R2R2 2  %f "%2 _!w &DWpCe,Y3 3 3 3P %& "%ww DWpCe,YNefee 6%s se 3Nefee 6%ss e383 sspUpU 3  5@ @5( 3 5 3 e@U @ 5 E%4  @&@ .% wNf&@ .e w D55PWpCe,Ye2^ 2\"r2bNefe&` 6%rr %!"f "%  w "4bw D WpCe,Y  w  @ 55 3 3 3PsNU%& "%w D5P5 5A5\5^@p@5@ @@ A@ AAEp A@  Af A,A .e@  A r y$A ff neu ff euA r5A ruNefe&` 6%@p@AWtAmp@p@b  p@tU5%XU8[ 0   @  AfIA .%w _%  @ _%  `   s!_%%U0}55@@ @&fffffaA .ebw N  ww D5\5^5P ff eu ff euNefe&` 6% A@t AWt@P@]2 rb 2CtU%UU5 ff&P&A .e w"bw N  ww D 5P5 AAWpBeANefe&` 6% &^&\ Der &^&\ Vevr2brr@t2%U U @ `  @5Et5 @ t@]U@t@]U3@tU @ `(Wt@2,5t\3 v st\ 5 +5@ @tU 5E &ffA .ew. lr 2  _~)bw DedR%P: 3 ^+& ),rWp ` xWp `@4|T4~V w zea&P&1B .ew b@5P5WpDeA A@ a Q5  @tU 5E% %% NfXB .%5@ aP@ a(@tU 5@ aWtEHww DedWpmP @5A sxsz(*(.(sp*f& ff es,s0s2 ww D5P pBt@m 5<[t@m 5[M@tU 35  55@ NvB .%w5 5t@m p[t@m p<[Aup @ f&&^&\ euAup @ f&&^&\ euA 5r5A 5ruNefe&` 6%@t3@t@]3 s sb 3s@tU5%UUs]5 ffffB .e _@-b_D-w N  w w DP5 5B@t`1|[.@t` 0 \[@55@5 @t` \[@t`1|[5\5^@ 5@@t` \[U=5@5@ @t` \[U=5B ff euB ff euA r5A ruNefe&` 6%@p@AWtA]p@p@b  p@t` \[AWt@PU%U%U55@ @&ffffB .ew bw N  w w D5P B5\5^` ff  eu` ff , euA r 5A r uh  E?% hhh 5Nefe&` 6%@t @m2@t@m2rb 2@tU5%U%UJ55  ffffB .ew\ bw B N  w@ w , D ed555P w @ CAWpBeh@"iU  6%  6% Nefee 6%s  6% s@ 6%  4NC . @"i@t@mt $i  &i `4%&  %_2@0-Rr RWp ` x zReaff.C .e_2RWp Am@4|T4~V _2w DtmPt0 $i0 &i wtw `DP 4 UC .%w@Wpf:h& WpA,==1~2B=6%'A =,.pB =($ "@$ nZ~httmtsramhkrarkrlrxsixpbrtmsDEFAULTdevlabel: bad fnc %d Cputype is not 93 or 94. No TOY present Current TOY: Toyset> Toyset0123456789ABCDEF[_cnull path .%s not found bn < 0 bn ovf %D bn void %D %s: !directory,mode %o size: %D ip %o lseek No file slotsBad device Unknown device Bad offset or ctlr, unit, part out of bounds Can't write files Exit called%s Trap in %s,bus errorillegal instructionbpt/traceiotpower failemtsys/trapweird at loc %o registers: r0=%o, r1=%o, ps=%o, nps=%o %s%d csr[0%o]: Bad PSL mode%s%d,%d: error reading labelsector %s%d,%d disklabel missing or corrupt %s: error writing labelsector warning: partition '%c' overlaps '%c' ht%d,%d err: cs2=%o, er=%o (FATAL ERROR) P` ` tm%d,%d err: er=%o cs=%o (FATAL ERROR) P ts%d,%d err sr=%o xs0=%o xs1=%o xs2=%o xs3=%o (FATAL ERROR) @tms%d: step %d failed sa=0%o tms%d STCONtms%d,%d ONLINtms%d: Fatal error sa=%o tms%d,%d: I/O err 0%o op=0%o mod=0%o && '(' &xptype=0%o xptype[%d]=0%o xp%d: unknown type 0%o xp%d,%d err cy=%d tr=%d sc=%d cs2=%o er1=%o RK%d,%d err cy=%d sc=%d, er=%o, ds=%o rl%d,%d err cy=%d, hd=%d, sc=%d, rlcs=%o, rlmp=%o rl%d,%d%c bad partition # or size = 0 Can't get rl%d,%d sts br%d,%d !ready br%d err: cy=%d tr=%d sc=%d er=%o ds=%o hk%d,%d err: cy=%d tr=%d sc=%d cs2=%d er=%o si%d,%d err cy=%d hd=%d sc=%d cnr=%o, err=%o hra%d STCON err ra%d,%d%c bad partition # or size = 0 ra%d,%d: !online ra%d: rsp %x op %x ignored ra%d,%d: err op=%x sts=%x ra%d: rasa=%o RA(%o) failed step %d. retrying ra%d,%d M_OP_GTUNT failed 0QlYa+*z*z0set line /dev/ttyS7 set modem hayes set speed 9600 set flow xon set file names literal set send pack 128 set receive pack 128 set block 2 set window 3 0Sl膠)/c/c0shemp.sms.iipo.gtegsc.com root curly.sms.iipo.gtegsc.com root moe.sms.iipo.gtegsc.com root moe.iipo.gtegsc.com root sms.sms.iipo.gtegsc.com root 0Ul3~ #%'04040Current Patch Level: 277 2.11 BSD ============ NOTE -- This would have been the third release of 2.10BSD; but since the filesystem has changed and a coldstart is required this release was instead called: 2.11BSD Work on this release has been on going since the initial release of 2.10.1BSD in January 1989. This release, is in celebration of the 20th anniversary of the PDP-11. This release incorporates all fixes and changes posted to the group comp.bugs.2bsd on the newsnet since 2.10.1BSD was released. Present in this release are several more missing pieces from the 4.3BSD distribution: 1) the kernel logger (/dev/klog) 2) the namei cache 3) readv(2)/writev(2) as system calls rather than emulation/compatibility routines 4) the shadow password implementation released for 4.3BSD 5) a TMSCP (TK50/TU81) driver with standalone support (bootblock and standalone driver) 6) a couple more network drivers have ported or made to work: if_vv and if_acc 7) the portable ascii archive file format (ar(1), ar(5)) has been implemented. 8) last, but most importantly, long filenames! This last is the reason a coldstart kit is necessary. The on-disc directory structure has been ported from 4.3BSD (along with the utilities that know about on-disc directories via the raw filesystem: fsck, ncheck, icheck, dcheck, etc.) and is not compatible with previous versions of UNIX for the PDP-11. A limited amount of backward compatibility is present in a version of dump(8) which can read old filesystems. restor(8) automagically converts old dump tapes to the new format on input. MAXNAMLEN is now 63 instead of 14. It is possible the limit could be higher, but with MAXPATHLEN at 256 a MAXNAMLEN of 63 was judged sufficient. MANY other fixes and changes have also been made, see the "Changes To The System" document which describes the changes made to both the kernel and the application programs. Steven M. Schultz Contel Federal Systems 31717 La Tienda Drive Westlake Village CA 91359 sms@wlv.imsd.contel.com Below is the original VERSION file distributed with 2.10.1BSD ----------------------------------------------------------------------- NOTE -- This is the second release of 2.10BSD; most of the changes are part of the addition of supervisor space networking in the kernel, although there are other changes. To give some idea of the dates involved, distribution of 2.10BSD by the USENIX Assoc. started in fall of 1987. Distribution of this source started in January of 1989. Keith Bostic Casey Leedom Cyrus Rahman Steven Schultz 0Yl פ . .0echo 'erase, kill ^U, intr ^C' stty dec stty erase PATH=/etc:/usr/ucb:/bin:/usr/bin:/usr/new export PATH HOME=/ export HOME export TERM 0[l㕤?''0unset noglob set path=(/etc /usr/ucb /bin /usr/bin /usr/local /usr/new) umask 26 stty dec erase ^H kill ^U eof ^D set prompt="[\!] root--> " if ( "$TERM" == dialup || "$TERM" == network) then setenv TERM vt100 echo -n "Terminal ($TERM)? " set argv = "$<" if ( "$argv" != '' ) setenv TERM "$argv" endif biff y 0]l樠M/Ѻ/њ0set history=30 set path=(/etc /usr/ucb /bin /usr/bin /usr/new /usr/local) if ($?prompt) then set prompt="\!% " endif set filec set mail=( 0 /usr/spool/mail/$USER ) set cdpath=( ~ /usr/spool/mqueue) set prompt="\!% root--> " alias mail /usr/ucb/Mail alias pwd 'echo $cwd' alias h history alias q5 'tail -5 /usr/spool/mqueue/syslog' 0_l! ! ܚ0se hold 0alB\$ //0 7w݁ W _"    5 5 7z@qwr ( R!eEդ )etE7 E@@qe:T~5 b  :؀`l<  7 T @:ؑ : " ÝtU  we t7  *  t7<: fv7r>83 7r2@P3:U ˋboot0cl?\$ //07w݁ W _    ( R!eEդ )etE7 E@@qe:T~5 `  :؀`l<  7  >:ؑ : " tU   e8 t7&  *  t7<: fvr`t&5 E?% 53 3:t 3` r tPs:boot0el>\$ //07w݁ W _   |v ( R!eEդ )etE7 E@@qe:T~5 `  :؀`l<  7 x >:ؑ : " tU  e, t7  *  t7<: fvr@43 r @Pe#:9ˋboot0gl=\$  //07w݁ W _   |v ( R!eEդ )etE7 E@@qe:T~5 `  :؀`l<  7 x >:ؑ : " tU  e, t7  *  t7<: fvr`43 r @Pe#:9ˋboot0il<\$  //07w݁ W _   |v ( R!eEդ )etE7 E@@qe:T~5 `  :؀`l<  7 x >:ؑ : " tU  e, t7  *  t7<: fvr43 r @Pe#:9ˋboot0kl<\$  //07w݁ W _   |v ( R!eEդ )etE7 E@@qe:T~5 `  :؀`l<  7 x >:ؑ : " tU  e, t7  *  t7<: fvr43 r0@Pe#:9ˋboot0ml;\$ //07w݁ W _    ( R!eEդ )etE7 E@@qe:T~5 `  :؀`l<  7  >:ؑ : " (ÝtU eB t70 & *  t7<: fvr |ŰtE  tUt EtP8Űt@Pe$:U ̋boot0ol:\$ //07w݁ W _   p ( R!eEդ )etE7 E@@qe:T~5 `  :؀`l<  7  >:ؑ : " tU  e8 t7&  *  t7<: fvr t@P,t P$3:ˋboot0ql9\$ //07w݁ W _     0 RFJ N @ ( R!eEդ )etE7 E@@qe:T~5 b  :؀`l<  7 T @:ؑ : " tU we t7  *  t7<:  :آ!@N@HL"B   Fboot0sl8\$ //07w݁ W _   |v ( R!eEդ )etE7 E@@qe:T~5 `  :؀`l<  7 x >:ؑ : " tU  e, t7  *  t7<: fvr43 r@Pe#:9ˋboot0ul9\$ //07w݁ W _   U 1 ( R!eEդ )etE7 E@@qe:T~5 `  :؀`l<  7 r >:ؑ : "  tU e& t7  *  t7<: fvrf rv,3"e:ˋboot0wl9\$ //07w݁ W _   |v ( R!eEդ )etE7 E@@qe:T~5 `  :؀`l<  7 x >:ؑ : " tU  e, t7  *  t7<: fvrs43 r!@Pe#:9ˋboot0yl, <R0_R0_0l e7cce7 /П f  7Ÿ%  w P# 1 &@& ƒ%  1 Ne& 2@& ƒ% @ 1  Ne2  777~ `1 t Ơ @-&Ԡ@& ƒ% ֠ 1 Ne& 1  - v1   w$w   Y%ppu@ 5F5@DN& $ 55_@5@ 5F+5 '@ 5F@Apfff ew\@p( 5F"5  5F@0fff e@0Nf $ 5 _e}-@YE@-Q˥@%$KN&&& $e =@ 5F E@-,@%$$ &&f $e E%_NNf # %_Neˋ_w B5  @@ 5% C wА%  %̂ 13  5F%  %5% %̂  < r y2%Q & Ye <3% -% 5FNfe Z%Ĉ 5 _pNfe T% _p%_p%_p@_ 5 5  Ne  ` % Ne  ` Cc % bNȁ @ %  1 @1wҭ%̂_%ȁ_ _% _%:3 & ; Ye <3% # Ye3__%% _%:3 & ; Ye <3%L\_[_ *_   _  _ <  _ _ _N̂ %7z_ _   _Nȁ %_& & %_ _Z _ :_C%̂%_N @ %_|-_v% %!%*_v% 5F[Nȁ @ %Q >&5%p%p+%%   ( \%pLN&%fIK7 e (%-L%fZ\O %_%ȁ 5F% j Ye3N %_%;Nȁ % _%] 1_ % J& &J| 1e_ 1 _w \Du5@ 5F5%5 %6%"_ %_ N5& & ,eNf % & ` /%N *1Nf %< 8 *1@UR%N& 5& & ,e@Nf %5w" & ֕5& ̕ /%N *1Nf %55 ff %N *1@w%ZN& v& 5 5%% 5%% %: Nf& %5ǀ%(%F% % 2 /%%'%%%% &&j Ye4  %%P%  &j Ye4-ȁ*@@m@ 5%)% %%!!%% %K%L%  f̂& e5 ff& e5_ @5%    e  25  5F,5%%@   @& @&@&@&ס e @A p@5 5/E ܤ ֤ Τ ʤ5Ȥ - ?% 2& ߚ2 V @ r y@ >& %+%I %ȁ_  5F_ %_ Nf %_  C5 '+d N 8! _: @5%' 5  pf& %e_: 5C%%, b| t p5n` -`b?R% 2& @2b V  >& _: f_5 -f?% _2& V_R2f%@%%% b 5 -b?z%  l2& `2b V 0~l <R0_R0_0ȁ5@e5 ! U? U 5p55%ȁ55 %+ %, %I%J%:5 % %p%$%p%pp5u 5F%uuNf %5%ȁ-n_: 55u-fYu_: u-_: 5G & v&A%=% 95+5@ f # AAE@ 5V@  # AE@ u@ 5_: ff %_: u+ -%% 4 1 4 N) _R(_ %p_: -5 --?v% _J d `_: 2-_T J )D < 856( -()?% 2& 2) V +_: (_: @ % _: %$- %  _:  42_: %#_:  _N@ 5 [ N [ N/_p $ %    e N8 NA_pJ _: NV $  @5 % _: _:      %%  [  [ R      Z_p _  _& _ _ __ _ pu-_" _" _ _ _ O r y: _x ?C_ 5 _V _f (@e 0 _: _  _P _ _ _ _X 5 - @?% __J2fE_Tw H~B 5F%6 %5 %a%Z% w"~fȁe e  5Ffȁe e  %  fff e N <=w }D 5F w}%( Nf&e T%  <=%$%( Nf&e T%  <= 5F% r yl% >& %P_( j xL%  * \ *4 # % _"%,_"p _"%p,N̂& %e =_$ * _"%-Ԛe@@ ̂& # & %   _ _"   _  _"   __"w B{D% %!0%,% % % % Nf& % wzNf&& %&  5F%5 %6 %Z%%a e @ e @ Nf& " & %w \zD% !%%& &  =e @e @wz% %!%$%(%(w yDC  %%% &j Ye & %% _X p& % ,'_l%% %$^ 1 wx &# Ye f Y &( Ye < ȁ& % %5  u-  N  % 䂷 $@   p& % w ,wD%dw,w&   &$ Yew vDC%% Ϣ 50_ 50  _ xr%4%%_33%;%_s%*֢  Г ȓ ē_ -$ ?% 2& ߚ V _%#_  8! tπ5t2 %3%_03%%%9_%l 05%I5Nfڢ<%%N3 5 %C [ 55 5 NA@vf %Nfff e %8%:% 1wtw t u-J@%% ---  13u-Nff f & eN f ffN >&5NffeL ewtw tD= :8  [ -%%#%:& hZ [  5F %%# ws 5Fw dsD_|# xt% vN _#  42_#  % e ; 42, j +d \ X5VH -H+?:% 2& (2+ V  1   x^ #Ĥ #_#ʤΤ_# $ ߲ 5 -$?% 2& ~2$ V %VR 1M%& %H% * 5 -*?ڎ% 2& Ȏ2* V  _D! 1wqw qD ,0 wpw pD wpN& $ %%% %w pDB >%8%4 3 x) %% % %%%%%   w p Ń%%  t-w oD% %@%B% %%% %%50 wlo% 55EU%%% %P % w o D L- e N3 1 wn%XN Fz Bz w nD %$ %%%(%%#wrnw ^nD 5F#% fw>n w &nDC >& , 5F%%  Ewm r y !           U  w pm%  xw^m@ NG 1 w ,mCB N_ wm x :* vu5@?Wp ; h FxBxffԣ e *x t e ,Ny ~ % C * e NAe r  Y5A r5K5 @ @m u- A b @m e 5 5 @ @mH-@ @m5 u-AupA- uAupu A r@-v vNff e v5 vNm u- 5 ,v v A a@- A `& * e N u-_'w j  N N wvjw bjCB 5    ť 1 w4j4-4- 54t5 tew iD >& %% 0wi w iD *(   A *8 +V ,_ H2 IV J_٥ 1 <%)$ hZ k && ; Ye4 %A  [ @e5 %% @ 5F_.%% _.f& b/e_/ &  s5& s ,e& ,eN *1_/& & ,e& & ,e& , r5& r ,e&  & &̂ %B_/ " 5 6 :_,_.,rer& f ,ef&& ,e & f /%N *1f&& ,eN _>- %@ 5F=%%  e@ȟ5 >&   f& /%wew eD Nf& %e  f %N wNew :e5  N fe T%B  5F = ҟރw҃7 Ѓ7΃̃ %: %  7%7Q & Ye <2N  @ % N ȁ %5   &, /%w wwww dw d /WpaC  /%WpaC `oʂ Zo  /%Wpawc WpaAf /% z *1 w rcN wpcw \c@  x N, w:cw &cN8> ewcw c Ёʁ@> %Nff f fff> e b \ T P5N@ -@ ?2% >& > V w|bw hbED FH %wRbw >b(@e05.@e@-.M 1 E%b 1 5 E r ywa `%~ N >% Ne x:Ne 7 lNe x: fe % ¦ `w ʦѦ _v2_8Ne x: fe: zA1 Y5 b=f p' H5 @5 87t@e2@-.C 1 .7 d  R ff2 >e7 *7 6N. <=. "  2 5u%g  ff& ,eF% ̂& ;%%  ̂& &&n $e& %Z & % >& f Nl Nfu %T~T~_v2 % " Y 4Ne x:Ne F  Y4Ne& 4  Y 4 444 =.e._v2 v n& Y  ! &  $%&: Ye=. 8 4 .  % Y v`@ 4t Ne x: Yi iNe 4 .f. & Ye   Y & & $#%&&  Ye4%_5&  _5 Ys *4 "4 .t.4 _5  *1_v2Ne x:Ne_8Ne x:Nefe_P3 & & /_T3  7h_v2 @.& & YeA.1_v2 _2 _3 _3 5F@e2@-. 1 .D..f. "&_5 _5 _63 Ne x: fe2_P3 _X3  & & & _5 _f7 _3  %_3ݦ_2 _"7 _z3  vz _v2 _07 _7_2 _H7 _t3 _7 (5 5 5_3 _3 _6 _7Ne x:Ne% _*5 _2 _7 Ne x: Ne_P3 _5 _x7 _7 p j7yyy_3 _t6 _3 _7_3 _86 _ 3 _7Ne x: fe)_P3w pZ w w w&   w w w& EtPw8Zw $ZDԐ w ߘw w& wZw YAA r@  ̂& %%a%P?%n. D0- _>DN hZ _C _C_B%)%_B & ٖ%&& ; Ye_?u-@@4_DD% [ %  *  *_B%,%J %Ȩ 14 qe5`qe5` q%%  Z_B%, %+%J%I$ [  [ %%%Ie.eJ 55%_C%_C&&e $Te_A%_C _C_A%  &  wQ%%  %.%L%%  [  [   &&% Ye4 [  [ _\?%._\?%L_\?_\?ҟ _u- FZ@m_ZAu-_VA_PA _jA _@ ; 85%%   5F% <  x _B   _B _B _HA  _bA  _B  _@ _B   _A _bA  _A _bA  _C _HA _jA _C _B  _C _bA _B  _>D_Cw ROD _zH %$_H3 &5Ne&f DX% B Bae ;u3%% 5%_$O%` &ef $Tep %(%0_O  hZ  %     -%%  &j Ye 0wEf U%5  %(%%# A1l %( Ne NRBe FZ&& %N N%*%/@ @a% 5 @ @a Q  u-u-%*%  C [    FZ5%*  c 5` c5 e@ @ae53N 5%1" f $ %  f@&j Ye <53@5u- FZ@m u-@@533%% %*# Z u-%*B * = FZ&& 2 %+ *%( hZ5 Ԁ [ )@A p54t FZ4N&  _ Ow BD  "%% F55   d s  QwvB Q 5w NB@ @me,55 De,_hS%*_dS%h5 Ce,O K%*G%BAp,p( < N T AfAA r &AfAA r  eC- u-u5ueD- HA1@ @m5DC(@p@0@pAefAf rp <5 _R N&_Rw@w @D eD-w@w x@DC@ r y l6 _BU`_BUCpL_BU@ @_BUP_BU x_BU% \ ZX  v1Q %+%u r r%+%u 5  &t f v     t    1wj?     %  %%u%+_T% _zT _JT _BT _VT    _`T @w >DC%155%) 5 55 %@ r y%: wR>%:% 5 55 umumu %_,Xttuu fffe ,e   & 1fffe N5 fffe 0A@@ A 5@u@uMuMu]u]A@5xuxA@5v5u@ &A@v _V  _XV _V _XV _V  _V_XV _V  _V_XV   _ W_XV Y_Vw X& L%*%.F%B =%(9%3%*&eAfVp^ AABtp<( <%( 5 @ `, 5 @ `5,@ `0,DB " `0,w;w : YLt4 tt w:w : Yttw:w :5 lYwmfY-dY`Y %3 1 e`?TH`?X`??d`?N_?TX_?f_??_?t`? t`` ````?` ?`T,aFa?ba?ba?aT?a?a?a ?b?:b?`bb bb b b  b?b? b ?b ? bb bb b b  b? c? c ? c ? c``Fa?ba?ba?a ` ?`?a ?b?:b?`b\c?|c ?cT?c?d ?0d`Fa?ba?a?:b?`bpd?d ?dT?d?e ?>e?`?|e ?e?e ?f^fpf` f```?` ?fT,aFa?ba?ba?aT?a?a?a ?f?:b?`bb bb b b  b?b? b ?b ? bb bb b b  b? c? c ? c ? c?N_? N_?TX_? TX_?f_? f_?r_? r_??_? ?_??f? ?f??g?g?(g??8g??Dg??Pg?g?g??g ?g ?g? ?2h ?Lh? ?Vh?fh??ph?h ?h?h ?h??h?? h? ?h? ? h? ?h?? h? ? h??h?? h??h? ?h??h?? h??h?h??hhh i?Bi?Bi?li?li ?i ?i??ijj j j j  jjj j j j j j  j?,j ?,j6j6j 6jTBjTBj TBjTj TjTbjTbjT bjT?tjT ?tjjj j?j ?j?jT?jj jj jj jj j?k ?k?k ?kT?&kT ?&kBk Bk Bk  BkRk Rk Rk  Rk?lk? lk ?lk ? lk~k ~kk k k  kT?kT? kT ?kT ? k?k ?k?k? k ?k ? kjj jjj j j j  j ?l?,j6j6j 6jTBjTBj TBjTjTbjTbjT bjT?tjjj j?jj j j  jBk Bk Bk  BkRk Rk Rk  Rk?lk? lk ?lk ? lk~k ~kk k k  kT?kT? kT ?kT ? k?k? k ?k ? k?lk? lk ?lk ? lkT?kT? kT ?kT ? k?l? l ?l ? l:l:l:l :l:lj j?,j j  jTbjT@l?^l ?zlT?tj?j?l ?lj j  j jBk Bk Bk  BkRk Rk Rk  Rk?lk? lk ?lk ? lk~k ~k ~k  ~kk k k  kT?kT? kT ?kT ? k?k? k ?k ? kl ll mm m m  m ,m 4m ?BmLm Lm?hm ?hm?m ?mm?mnT?"n>n?Znjj jzn j j  jn?n?njj j  j6j6j  6j?N_?N_TBjTBj T BjTj?TX_?TX_?f_?f_jj  j?j??_??_n nn n n  nn n n  nn nn n n  no o o o?o? o?.o? .o? .o?  .o?Bo? Bo? Bo?  BoTVoT Vo TVo T Vo?Tzo?T zo? Tzo? T zo??o?? o? ?o? ? ojj jjj j j j  jo o6j 6j 6j?N_?f_??_o o o  oo o o  on n n  no o o  o?Bo? Bo? Bo?  BoTVoT Vo TVo T Vo?Tzo?T zo? Tzo? T zo??o?? o? ?o? ? o?p? p? p?  p??p??p?p?p?p ?*p?@p?Rp ?Rpjptpp?p? ?p?p??p?p??pjqBtBt ~q!~q%q&qbqcqPq(r)r*s+s0t,s-s.r7r0r1vsFBtGBtH,uIzuJuKvL,uN(vU(vOufp3rw4w8w9w:w;w[wRxSxTxVbxWbxXbxr\}sumtxuxvxwxxxkxy,xz,x{,x|Dx}Dx~DxwTwfwX|X| X|!X|PxFX|GX|NzO |UzK}L}~tj,~878"8#8$8%8(8)8+8Q08<,~=,~>,~?,~@,~A,~B,~C,~D,~E,~H8I8O8jJ(z)z7z0z:8&  @ppC`pLw DC+ 5 > a  r5 w: w U5ff %̥a &  $e 3     U̥r 33w D  5 & & $e5u A@w5 5 5@ 5`u`u w ^DE5_% _F _F5`uu '& & $e5u%%w @A 5`u`u  5u 5  5 u  5 u tmL CE 54E N  A@ f& & $e5u %%    %%%_ą5 ڎ5 5 E4N ff & $e W _ą%_8%_8_ą  @A  @C@Aw  2fef ԕ%5 *w w D*\5% %-%+ 5 55 55  B5eA5 %%.55  B5eA5 % %E%e$%+%-  Wp B`e%  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& e5 55w, 6 m 7b'")w D 3 8EtU4 4 w && e& & %ReR$( @  1  "@! @#E B Ew "  %w pw w  D Lԋw W f r @  W f r@  @ m7 (7(gw w D85U5_V5P_V ' m'@e4 ,5Ne &   uN 4USt%&5h&2 ڎ5d&> ڎ5& & % 45@e-4  % U5EU  wRE   @A  v @Aw D5"E@e44fef ԕ% ڎU4 4  fef ԕ%5 w ww7x& PЋ w FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St%2 # U   & % S U _~ @_w DE%%"5   & % U wv w ^D55@ ڎ  3 8 4 4 4 4 4 ww~w  $$&5+ # &5e-##e % & #    * ww  5f * 7# f * 7"wX@ mZ#7X#&N#%e w  8# *#    * e-#ww D "&5 e %w"  5 e-"w > ww  N ww rDCDpC  f wZw FN 8wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  !³U7!U7!³!!Ae vB!7 !  !%! 55 a  a!PE -H!% w$  `e vWt vw!@ `e @  %  e U?  `e 7 U?  a7   ?  U ew dDz E wZw FD5 8 5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E% m%w w7|*'$!      7& At& BF7!VW-7B& & e Ӌ " &7 & e ӕ-ӕ0B~ӕ.  ӕ0~ B~"&7 & Le ӕ-0 ӕ. B~ӕet ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .lu$Bw* J@B V_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& V z   5 , @ :% & f E V  (˥-%0     ,:% &  V 8 5E& z   5 , @ :% & f E V  w&w Nefef 5& Țe C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& eww  fff 5& eww  5 %O N  = ̳555Ne5& e555'0Ne5 B& e57 Be0" 5%55 5 B5@B e̳ a=%̳7̳w %5 B5Ne& e55e0%7`Jʕ0%̳ʕ1  %̳˕0 ʥ9 6@~ <=@A>?DEBC=EDCB 'R:j"P@Arg countrMissing temp filewCan't create %s.globl fltused .globl .data rMissing temp filepossibly too much dataIllegal use of voidcompiler botch: callmov r%d,-(sp) mov%s r%d,%s(sp) f-tst%s r%d fIllegal operation on structureNo code table for op: %s(%d) type: %dNo code table for op %d.data L%d:%o;%o;%o;%o .text .data L%d:%o;%o;%o;%o .text movb r%d,r%d Register overflow: simplify expressionr%d*clr r%d tst r%d sxt r%d adcsbcclrsxt$%oUnimplemented structure assignmentmov -(r%d),-(sp) mov r%d,r0 mov $%o,r1 L%d:mov -(r0),-(sp) dec r1 jne L%d .byte %o %o; %o %o; %o; %o; %o %o; %o Illegal initializationregister overflow: compiler errormov r%d,r%d mov r%d,r%d mov%.1s r%d,r%d R"R"\"f"f"f"f"f"F"@"@"!t!#!t!J!#"#######n" #@$J$$$J$$$$$$$$$$$$p$&&&'8'8'J'J'\'\'D'8'8'D'cmp r0,$%o jhi L%d asl r0 jmp *L%d(r0) .data L%d:mov r0,r1 clr r0 div $%o,r0 asl r1 jmp *L%d(r1) .data L%d:=??AACCEE=AA??EECC<=BCDEBCDE=??@ACCDE=A?EC<=<=<=r1d1T1d1^178J8f88889P9999$%o$L%dIllegal use of register(r%d)r%dCompiler error: pnameIllegal use of register(r%d)%s+%s(r%d)-compiler error: bad pnameL%d%sNo match' for op %dbotch: peculiar type %djbr L%d sub $%o,r0 L%d L%d .text jbr L%d L%d .text L%d:jbr L%d tst r0 cmp r0,$%o jeq L%d Duplicate case (%d)pow2 botchcfcc jbr L%d L%d: L%d ashc $0,r%d L%d:tst (sp)+ cmp (sp)+,(sp)+ add $%o,sp %d: %s %d: -%s%oStack overflow botchIntermediate file error%o .byte %o, .text .data .bss .globl %s jmp cret .comm %s,%o .=.+%o .even jsr r5,csv tst -(sp) sub $%o,sp mov $L%d,r0 jsr pc,mcount .data L%d:%s+1 .text %s ~%s=L%d ~%s=%o ~%s=r%d Expression input botchashc $0,r0 cfcc jgt L%d jlt L%d jbr L%d %s: %s: ~~%s: Binary expression botch.bss L%d:.=.+%o .text mov $L%d,r0 Illegal structure operationunimplemented structure assignmentmov (r1)+,(r0)+ mov r2,-(sp) mov $%o,r2 L%d:mov (r1)+,(r0)+ dec r2 jne L%d mov (sp)+,r2 Illegal indirection|CDD|CvCpCC(DJDfDxDDDDDE"E6GRGnG~GrKKLbLMM(UFUUUWWWWXFloating %% not definedUnimplemented field operatordivide checkC error: constDivide checkDivide checkOut of space-- c1<<888888888@BDFHJLORTVX[gsvy|¯ůɯ̯Яӯ֯ٯܯ߯ !$')/5:@EO[ep}ͰϰѰ԰װٰ۰ݰmovclrcmptstaddsubincdecmuldivasrashaslbicbic $1,bitbit $1,bisbis $1,xornegcom*$ashclmulldivlremuldivulremualdivualremultofulshualshalmulaldivalremudivuremjeqjnejlejgtjltjgejlosjhijlojhis/nopjbrjpljmijmi L%d jnejmi L%d jeqjNZPNR<VZ=VZ>VZ?VZ@VZAVZBVZCVZDVZEVZ(^fF^f)bjGbj^fbj ^f!bj*nnHnn+rrIrr,rrJrrrr-zvKzv.z~Lz~/7UQ0N1O%&bc[\RS««TȫȫVWXuvwxyzΫΫ{ԫԫ|}ګګ~ꫀ<=>"&?*.@.*A&"B28C<@D@ptrptr->intlong->ptrfield assign>>>>=keywordnameshort constantstringfloatdoublelong constantlong constant*r++*--r()++pre--pre++post--post!un&*-~.+-*/%>><<&|^->int->doubledouble->int&&||&~double->longlong->doubleinteger->longlong->integer==!=<=<>=>p>=p+=-=*=/=%=>>=<<=&=|=^==& for tests*/%&= ~*=/=%=?<<<<=\/\//\/\,call1call2callmcallgotojump condbranch condset nregsload valueptr->integerint->charforce registerbranchlabelnlabelrlabel=structure= (struct setup)/%/=%=*/%*=/=%=u_long->double>>>>=longjmp botch longjmp botch ((((( AAAAAABBBBBB ̖dox|fe|gVcbslLԖuؖDO–XU=(\0lb hmegikmR0[R0[0 ^  e7cce7 / rO  7%  Ww :Z%p@& S e #s  W` }@& <P& & % ._>?=& & % -_@A="& / % _]_& \ % __ * % +_ nF7 %* \F%/7  _h_\  _|7 |_j d_ _%  ߚ ` 0P{ | p7 j7B %_%[@_[_5/&_d60|_d _Z  _   _ _l _ _   n _h_\ _ _ _  _  _ _   ^_h_\w zS 7 27 0 5 h5 5 |D%0Ԑ| %_>%a%f%Af%Fc% v` 0P% vmm@ vv7w| 0%aW7 7`\w`Zw T C-%%N  0 * &%. '_> 4h7 w0R%e%E/ , %% N   ߶ ` 0PԐ%+%-| 6%x%X%  f  b %N %l%L% @ : 6` 0P N %_T%  - %   v W  @_fw P B@-@wP7 t @w PD7 | " z fp Le'7!P  J  L L7 > wxP L " 7!    r  L  w P 7 N  %' % % @7 wOw OCL_ 7 B_  | x` 0P   70 c  \\ @ : 6` 0P r y DA >  %0%7te`   ` 0P %7x  X     " &wN     '     $ & w dN P5L@e5@eT5 _r ʥ nʋ!  *?%(ʕ  ʕ  F/ % G @ ! < ,!?d \ (R  J  ,!ʕ 2  & T 81 d e ?HeB%<M  W _  r yʥ _X %_ _V ?e `%_ %[Zd$Q O "%eFd@ ?_% %%d %_4%Z_45 R.  _  _  _ _   _   tE5R%%@%ZN hN huPu-PRu-PR_j 5 _j _$ _$ _ !r ds_* _   e    %(%1Ce _  __ _ _  _ _%/_ #_ _  0li hmegikmR0[R0[0_  _p _ _%_%RR 2_@e@-a  Wee}R_r uN %R 5 % %! @N 5 _@N r y%ddaN`NN h_r  & & & &  d e ?edNF ?|ev<%B_r %=     2( d h NL !wI    2NN h_%u  $7 NL !w H&Nefe 7 55 5 5 Ne& fef "% _ff d e _f E% FE% e$ htend_E%  & V1 &dE% '  & &1 &$%%$   ,1 &; _%d%  F& %e# h% J _   N F5  f % f( d e ?e$ h_& &  _ _ _Z __ _ _ __ _ _ _ __ _V _ __%4  f >"% _ &_5 %%D-,{ 5 N ^&&  te 5@tE5E @5% %%5% _ %F%O%%I%J f p$%_5%PF%D- E%,  55%% <% 6%  - % 55 % %%%  5 au]%D-5 % %% %_%% _ 5% _% @  _ % 55R _5 D%%]%_54%>&%!%% % %%  %%% c%%5 %25 %)   & & : d e  & & : d e  D-%% _%% (@ 5@ ! 5% %@  5  I I5%%   Nff e ff e55 %%5 % .% %% r %  & & & m d e "%  5@&@&ff d e ?e N&  e?ew=w =DC5 , B5 & SEE@ ,, %, w= ! F  w < @ j N f& & f& d e w<@  5  w l_( z_' _' ,% %27 J E%  T-q LeE B L_>&%P 7 T-%  L%q LeN )%5 L H% _&%% 7    $7 lw2w r2e"r Le PJj R7 L׷ ~ Le 2  I IX׆ R7 h7H%   \p< Le IH m@ L% I7,w1w p1 @eA P~u5 @E%0 5 Ne J5%   %C  )N F5e   @e  Ne J5@A &u5 >7%  %ֵ  5%_+7%&%1%8% v  '& m 5_+% Nfe D, _+@E%0%f N& fe )%i 5 " 57  Ne ?eeP h% %tp,%% @  @Ap 40& & & fh d e  (GN ! 5? %   L% t5% !_* _* _* %w!%  upN L%!  @ @  up@wV.w B.@_f,<  %  %=x  N& N& & )%% ' L e p, ) e  .%   % % @@K L%N L % wF-w 2-D P  w-w -V < 7 ; Q _D27V "  (G `%  $7wX- Nis L%wf w,d "J   %7 F v _82 xP  I   % %@e5" = v%Ne L%_-E=  35 6%aX Z x> 0 Ц f F%  I* l%;  f F% & I  Lf F% %_- %%_-T_.L D >f F% J%%jз Ў I I ~ I_.77 I 7&   & F% , I I_. L_d. L_d.jϔ d`ό ZV5 L I l Id R%_-%n_-f , & F%, I$_- . %_-   _-%*eη I_-μ 5 3   & & & n d e  (GN ! dp_. d  ^  <%_-7<.,$  _`0_-  H_. _- X%:_-7 ʋ  C2 ʕ 0@ x r͎_b1 _-w ' r%_37D "  (G N% @%e͎ I Ie I I %'7 V5 "  %N !7 "  (G %   % I   F%N ! I Ie I n Ih I w&w & F%N "  0% %  w&$  $7 w f& z75 I7  IN I 5 Le &9 L%e-< Lx Iwrfw%w %^0 x7 p#3E%0 e K`˥3 \F7J- N~XeR ?HeB,*˕ P h$ (G˕ !˕  6   ˥˥>    %,iR L%w$w $z  R7-l fiU L%w$w v$   e '-(@̥  |̋X  ̥  & 6   %,w$e  w #DC ̥ & O% e % w#w #@   x@@&&~ Lew#w b#D % & %7wH#w 4# D fef ;%5Nefe 7 & NE%`w"w "5  5 @0 @0 @0 D% % 5,@-% P _ 9 x -2%%$ ޵  7 5%   @p@p    f 9 7 f 9 A1p  d V .ݡ% w  w~!      % %   %  % + =@w % % ~ :%6Zwf $% - Cʋ @-   CʋJ !2: 0   !5= @0 7 % _;@-< l_;7 @e7w7 % 5 u fe ;% % R7wJw$ Z  =? jed`Ae@  !A1 @ @` AaH  @ae-www z%@w *F w C % ~ <7% N JD-5%  7%G% 555 5 5 5 5 zh @e55 N & ff % $ 5o 5 Nf NE%5wm@_>%N fe |C 5%_> 5 C5 95`  55@tAE@P5@t5&@E%0@ @aA lp@t550E550E5P@E% %  % %    ) F-4˥ >% ;% -  %  C&3 _? C   w ˥ N S:6  O5 @ l ,@ lA AaH @t5u-@E%0u-@E%08 5@ @a @ @aA lp" @  !55 @ @mA AaH u-sˋ%%˥% ˥ s- _^=ˋE%@E%, s % ˕ _>%   _>5 % _A J5 f7F%95 6 p5ff NE%5 -l{-  8 !3@{wm2  ff NE%5umum R%L  @<2 &e se % \F3 5 b5%P w0%  K7RN-JF@@ _B &  )%_B% C !ؽ Խp Le  )%5 L  K p Le  L ,% % "   ˕s &  )%@ 55  6 _^=P_^=w jD ! P~ 3 3 n3 3 3  M e ww D 7 5  _C _DD *_*DN& |C 5%_C@w5` \5 @tU  %)N& |C 5% % _$Eֻ _$E *Fҷk x h b , ;% F %5` 5 @tU =%  d%<z r7zѷn D%   7 X aL5` .5 @tU05  ʺ_Cw H/ wLw 8 BDCG e r`7  FE%0% % ED-7 6 %%N m%"7 e%%%N m\%7 RԄ V @wpw \i N $7wXw D|  w>w * @5%50 @E%%w w D5 wtEE@Pw DEtE@PUww  f G ffg Lewrw ^D%h%%!%%   %   & G x L%ww D% L ^%  _8I _\I I _H _"I _I a #_hI d_I& G  5 & G & L%   s Lew˥  ˋ & Le˥  L    vf&& Le&& Le&& &  & G   &&&  _ZH& G & _TH& G  & G d _THw No L%ww Np" L%ww D5w F4 Jw n@ 5  FAAB `A f&fe eE%0E%   fe re W-Pl @w%E  x % @@ T w tN J Ewrw ^ 7д%1 b%;, C̋ 0@  ̥̋ %0pw w 7 % ww v  ߐ ` 0P% %  %  74ww z  wxw d T " ?ZeT$ hB>&   && & & f d e  (G !ww  %;+ e " ?eP hԳAp n h (G !J Iw w l ^^DeX 0G& J F" N S! D B& &O 5& &O t&* ʋ_ &O @ ʋ&E 1 &O & &O @  5   Ww w D `` ̋ r,@w &  @ppC`pLw J DC+ 5 (U a  r5 w: w U5ff R%̥a &  Re 3     U̥r 33 9 E5 @@l ww ( D 3 "YEtU4 4 w w D Lԋw  Jҋ~ @@W f r @  W f r@  @ w V D85U5_jQ5P_jQ  m@e4 ,5Ne & W  uN W4USt%` 5l T5x T5& & R% 45@e-4  % U5EU  w( E w  D  +   r= wB w5 a U5ff R%ށ̥a &  Re 3     U̥r 33w D5"E@e44fef Z% TU4 4  fef Z%5 w w w7  ы A@PЋ w FD:5UE5Hw* _T5uNfe & Z% _TbNe & W  uN W)U5| m- 5 & Z%St%l  W U   & Z% S U _hS @_lSw DE%%"5   & Z% U wv w ^D55@ T  U 3 "Y 4 4 4 4 4 ww~w  $` 5+ f &5e-He %P & n    W ww  5f W 70 f W 7wX@ m7` %Pe w       W e-ww D ` 5 e %Pw  5 e-hw (U Vww  N Zww rDCDpC W PW wZw FN "YwJ ~5 & E        ~5>wlYwfw Net@f We  w6w.w  pXU7bVU7XXVVNAe vB:7 <  2%, 55 a  a!PE -%V w$ Y `e vWt vw@ `e @  Y%e U? `e 7rVU?f” a7X PR?JFU ew dD&E wZw FD5 "Y 5N W!w5A vBB-  }ee@ !ۃ `!ւ ` `mj& E%\mV%w w7*'$!     ޳ 7Գ& Aij& BF7!W-^7w 8uDAB %u f& & e w5 5  W- W00~u5  .luXBw* J@B |_\@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& @S z   5 , @ :% & f E @S  (˥-%0     ,:% &  @S 8 5E& z   5 , @ :% & f E @S  w   #).5:@ILTX[_ g l!<j PxB\2|intcharfloatdoublestructlongunsignedunionshortvoidautoexternstaticregistergotoreturnifwhileelseswitchcasebreakcontinuedodefaultforsizeoftypedefenumasm-uArg countrCan't find %swwCan't create tempBBIllegal #Illegal #Nonterminated commentUnknown characterNumber syntaxBNBB0B1N100Long character constantNonterminated string%s undefined; func. %s(none)Expression overflowexpression overflowExpression syntax:rrxx~rr~##N"(#|#F#N#.$#####N"N"N"N"N"N"N"N"N"N"######$$$ $Disallowed conversionIllegal conditionalCall of non-functionIllegal indirectionIllegal lvalueIllegal structure refIllegal use of void objectIncompatible structuresmixed pointer assignmentillegal combination of pointer and integer, op =illegal combination of pointer and integer, op :Illegal conversionAmbiguous structure reference for %s%s not member of cited struct/unionIllegal conversionIllegal type of operand%s:%d: warning: %s:%d: c0 internal error: TblockOut of spaceToo much declaring in an expressionout of spaceLvalue requiredDivide checkConstant required/0//////d/j/Z.p..0(2j11l0|001182v.l7776Illegal storage classBSInappropriate parametersBSBBSBNBSNDeclaration syntaxBSBBSBToo many }'sExternal definition syntaxBBSBBNSCompound statement requiredBNBBNNo auto. aggregate initialization0-length row: %sNo strings in automaticNo field initializationIllegal enum constant for %sBSBNToo many initializers: %sUndefined structure initializationToo many structure initializersBunion initialization non-portableBNB%s multiply definedUnexpected EOFBNMissing '}'BFCase not in switchSwitch table overflowDefault not in switchMore than 1 'default'Inappropriate 'else'Unknown keywordStatement syntaxIllegal use of voidStatement syntaxBNNNN0Not an argument: %sBNBN%s undefinednames %s and %s conflictBSN88888 9898888888 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 98D6ETDtype clashConflict in storage classPerverse modifier on 'enum'Type clashMisplaced 'unsigned'Misplaced 'long'Bad structure/union/enum name%s redeclaredNegative field widthBad func. storage className required in declarationstructure redeclarationToo many structure membersBBNBBBNBNBIllegal enumeration %sRank too largeNull dimensionType is too complicatedField too longBad type for fieldDeclaration syntax%s redeclaredJJJJJKJJJJJIllegal indirectionBNNNB1N0BNBNBIllegal use of type nameBNNSNBNNNBNNBNFBNNNBNNNIllegal use of typeBNBNBNBNNBNBNIllegal use of void objectUndefined structureCompiler error (length)very large data structureBreak/continue errorWrite error on tempBotch in outcode<>8xxxx88888bb[o[xp\f~\ep[gJ\cV\s[l[L[u[D[O[X[U0l↤ DR0CR0C0invalid repetition count in DATA statement nonconstant initializer too many initializers bad impldoblock 0%o attempt to initialize adjustable array initialization of string of nonconstant length nonconstant implied DO parameter noncharacter type initialized with string incompatible types in initialization setdata: impossible type %d 1-dim subscript in EQUIVALENCE nonconstant subscript in equivalence adjustable in equivalence bad storage class in equivalence inconsistent equivalence bad alignment forced by equivalence attempt to extend common %s backward inconsistent common usage eqvcommon: impossible vstg %d elseif out of place else out of place endif out of place nesting too deep control stack empty assignment to a non-variable statement function amid executables redeclaration of statement function non-variable argument in statement function definition pause/stop argument must be constant pause/stop argument must be integer or string nested loops with variable %s bad type on do variable bad type on DO parameter too few DO parameters too many DO parameters zero DO increment DO range never executed noninteger assign variable invalid type of arithmetic if expression RETURN statement in main or block data alternate return in nonsubroutine assigned goto variable must be integer invalid complex constant mkconv of impossible type %d cpexpr: impossible tag %d frexpr: impossible tag %d fixtype: impossible tag %d fixexpr: invalid tag %d left side of assignment must be variable addr of addr shorten: invalid tag %d Dummy procedure not declared EXTERNAL. Code may be wrong. invalid class code for function no substring of function call recursive call mkfunct: impossible recursion mkfunct: impossible vprocclass %d disagreement of argument types in statement function call statement function definition and argument list differ substring of noncharacter %s more than 7 subscripts subscripts on scalar variable wrong number of subscripts on %s subscript on variable %s out of range mkaddr: impossible storage tag %d no qualifiers on parameter name used as variable adjustable automatic array attempt to use undefined variable attempted division by zero mkexpr: impossible opcode %d nonarithmetic operand of arithmetic operator nonarithmetic operand of negation NOT of nonlogical nonlogical operand of logical operator illegal comparison order comparison of complex data comparison of nonarithmetic data concatenation of nonchar data impossible conversion. possible compiler bug impossible conversion cktype: impossible opcode %d fold: invalid unary operator %d consnegop: impossible type %d conspower: invalid type %d integer ** negative power inline mod of noninteger sgn(nonconstant) conssgn(type %d) integer**negative complex division by zero statement cannot be reached unclassifiable statement label %s already defined there is a branch to label %s from outside block misplaced entry statement length must be an integer constant too many equivalences too few initializers can only save static variables cannot make %s parameter inconsistent storage classes illegal branch to inner block, statement %s implicit item must be single letter declaration among executables no backward DO loops too many alternate returns computed GOTO list too long characters out of order in implicit:%c-%c intrcall: bad intrgroup %d bad number of arguments to intrinsic %s bad argument type to intrinsic %s intraddr: %s is not intrinsic cannot pass %s as actual intraddr: impossible f1=%d unlabeled format statement bad format number bad end= clause bad err= clause iostat must be an integer variable impossible iostmt %d invalid control %s for statement unknown iocontrol %s illegal positional iocontrol illegal * iocontrol iocontrol %s repeated attempt to i/o array of unknown size non-left side in READ list function in READ list attempt to use internal unit array of unknown size bad unit specifier bad REC= clause bad format descriptor unformatted internal 0l鐤 DR0CR0C0I/O not allowed direct list-directed I/O not allowed bad unit in open bad file in open bad recl bad unit in close statement inquire by unit or by file, not both must inquire by unit or by file bad unit in I/O motion statement non-character control clause impossible inquire parameter %s includes nested too deep impossible lexstate %d illegal continuation card ignored nondigit in statement number field unbalanced quotes; closing quote supplied %dH too big unbalanced parentheses, statement skipped name %s too long, truncated to %d bad bit identifier invalid binary character -O%d: too many register variables invalid flag -I%c invalid flag %c arg count %d missing END statement cannot open intermediate file %s writing error too many digits in floating constant hash table full too many statement numbers too many external symbols improper use of builtin %s popstack: stack empty out of memory memname: invalid vstg %d missing end statement DO loop or BLOCK IF not closed missing statement number %s invalid entry name external name already used retval: impossible type %d noncharacter entry of character function mismatched character entry lengths character entry of noncharacter function local variable %s never used adjustable dimension on non-argument adjustable leng on nonargument common alignment adjustable array in common incompatible lengths for common block %s automatic variable of nonconstant length mktmpn: invalid type %d adjustable length %s cannot be a common block name incompatible common declaration incompatible storage declarations incompatible or duplicate type declaration lengtype: invalid type %d incompatible type-length combination incompatible use of intrinsic function invalid intrinsic declaration unknown intrinsic function invalid external declaration only variables may be arrays only last bound may be asterisk putconst: bad tag %d putconst: bad type %d non-logical expression in IF statement invalid goto label computed goto index must be integer putx: invalid opcode %d putx: impossible tag %d putop: impossible conversion putop: invalid opcode %d putpower: bad call putcx1: bad tag %d putcx1 of invalid opcode %d putch1: bad character conversion putch1: invalid opcode %d putch1: bad tag %d putaddr: invalid vstg %d adjustable character function 0l4d H,.024R0BR0B0ق@4 e7cce7@ 1_ C_ I_ O? U5 da pb u/ w& @& le @6"e @6~"7 "z"n"@;> @e5% & fW le(4w 4*"""" 2"47 !!s! & @&z le!!# & f le@ 7j>@ 7\>@ 7N> .N  % N=2! ǖ%N8! ǖ% 8 5 = N @w & &  le  5 w $ @N ww p Xf 5 & f lewPw <@ L@ L@ Lw0w   %H?@5  & &  leN = ww DCBҔ ww DCB  ww DC Bm @m5u- u-  ̢@  C-˥   C-̢ew2̄ ̥   w DC w  w  EUtww DC lfb` 2ww DC dl !˥ ˋ2dldlwtw `DC nl !˥ ˋ_nl 2nlnlw H,.024R0BR0B0@   5@7Ou@ 5@ b 5%A @ v A p 8@  v@_%7 6_% -     & & % le7 _% &_%7 _%& & B le $_% 7 >P7 & %.  f" _%Nefe & &  le7 `  <_%7 R_%& _%& _%% E% r7H_%U  vEu5t5  & & le_%U_% v5 EU0  & &4 le_% T lT& ؖ%_%5 4dA vE%EU@=A vE% AA WpU >P)A vE% AA Wp UaA vE%  & fN le &  7dG_% 5EU@p5 @Apu @Apu @Ap ue  f  7FF& \ A1_%7 7 O7 O_%& \ 7F_%7 JS_%7 BS_%:St0 l.St0l "S_%St0l St0l S_%7 8F_%R7S_%%}RR R0l_%A v5 & f& 2%&l leA v5 FEE1PU_%aG  f& %7E_%F_%74R_%&,R&R R e_%&RRR e_%%2GabFzZF  & &  le7 E:F7D_% &  & &  le  xf_%7 D_% &  7D_% &  & \ 7~D_%7tD_%&& f%7\D_%& f%7DD_%& f%7,D_%& f%7D_%%  & f%7C7C_%&& f%7C_%& f%7C_%& f%7C_%& f%7C_%& f%7xC_% & f%7bC_%& f%7JC_%@C_%6C_%,C_%"C_% C_%C_%C_%B_% & & & nce7B_%&& & nce7B_% & & ^ && nce7B_%&& 6 && nce7xB_%7 pB_% vE% K7JB_% :H7:B_% :H7,B_%a$D c_% ށ_%&  7 @_%& : _%& _%7 A_%&&& ep_%l& & & e_%l& & & e_%%}JLl@L& $ && e & &  le_% _%& : 7_%  & _% *_% X_% X_%%}K lK& , & % & &  le_%7 ^K7>_%  &   7>_%   &  & \ 7Z> &  7J>_%%}JJ J0l7 ,>_%7 $>_%>_% &  7>_% &  & \ 7=_%  & % ж_%F_%7 F_% _% F: _% <;_% <;_% <;_% <;_% <;_% <;_% <;_% <;_% <;_% <;_% <;_%8F_%.F_%$F_%F_%F_%F_%  F:  F: _%  F:   F: _% F: _% _%& F: _% & F: _%& F: _% & F: _% 7F<_% 6 F:  F: 6_%*E_% E_%E_% E_%E  F:  F: _%D  F:   F: _% &  7;_% &  & \ 7t;_%& 7^;_% &  7L;_% &  7:;_% &  &  7;_% &  &  7:l &  &  7:^ &  &  7:P &  & \ 7:B &  & \ 7:4 &  & 7p:% &  & 7R:& 7>:     xl_ w:_ w 7 &7 $N & ww ww vGG &@ Gwhw T -GG G|G vGp @& x 1|0 7 l n% h & & * leK%1FE%$>E BE%"K%(E%K-,E(Et E Eoe EF p & D leww x m7 )7DDDDDDD%D  wF%DD7& & \ le7 %m mԔ-XD7RDNDjfeB-b X )78D%m"D@ 7D-:47 .DD7 DDw D7CeB55 @ E %& IxI%aw>%c%C%* 8 2@ E % % LC% s-Zҕ  0-8 @ E% %% Ґ% ҕ - Yw-BU B Bd %B Bw-B D>@ E% %_6*%   @ E % %_6*   B Bw-B BG;>0G_:*s;> -;> -A_)7 A7 As;>;> e f& xArA Feee@ 7`Aw^A %sڂ_:*ZA4& &  le7 .A7 ,Aw У 7 A7 A7 Am-;>'̥'̥"\5˕A-@@-  5& &  lee -@І 7@m@wR f n  t̕  b̕̕ ̕ -j@Ň@-̥\-V@  0 ̥h̥H_.C-_.;>_/e5 @ 5e@-e5;>eupu`AWp u B-B-_/ʥ*d?ʥ/ʥ( ʥ,ʥ=ʥ._/@m-r?& f leV?5  f n  t̕  b̕̕ ̕ @ _- ̥\  0 ̥( >̥) > > ̥=>̥,> ~ ;>e _-_-w . >& &  le\>_v0d>e-^>MiT>IN>fC(?2>e ̥ ̥̥( >1=%=We>S̥) = -=݆-===>;>0= = =-==d==o!= <7x=%--~=~=(t=/\= f=;>.H=7 N=ww D=;>w0=e5 Ds@ 5xs = ̢̋̋ < <eB-w z  0 Ds %d e Ds 0Ds 0xse wDw 0<$ ~<ar< h<b< \<@a7b0=7 / w v/ !&<*</<5-<<1<<+*; S-e.;a-;;I;;>_4, 7T-e;@7-%I- ;%J- ; ;-x; 5 } . -V;eu>;H; 8;_1@ 7&;@_1;;>_4a-;:,=:( :_1:;>:;> : :-::@a7.= -%.F!a % -:~:(v: .e7h:,_1%l.a leL.7-%B.A(:=l- B* O# X Z  b o x z 9a93 _1& & ) le_19= 9 @-& & = le n9@a7t-%% _1 _1>9;>_25 5 5 "9_5.9_5 _59e-88;>8;>^T} Xd8e8>8d8-88 8+- v8 r8n8;> w`8 55 P8-N8J8D8;> \308;> $8-"88au- 8@a7,= _1  _1_1w lD& &  le EU < wD v5 vE%& & 1w Ne %5 N ڸ fff ^e 2wƙw 7 =H*7 z47 =Wp1 % %ww www u"@E%" 5& .  f;N  u Ne wE%> ; 6 4d % 2U&  &    \  %& < L& & "AE% K ME% vE% )%^, vEf < 5f $ &  N& & d le .M_;w ~D  vEu%6t5N 4 %& f%5% E% FEU@t##f& %4N J  M5%66ff %& %&& ef%5&& . e >wzw f 5;5 55& 4 %& & R(e& |5#v5& %&R x & (e&  H5 D5>5  .Mwԑw D EU   & f% N 44& j %&&4 'e&  wfw R 5 x_^@ vEft5  K F%_r@ r4  vE% _r@E%0 - ( 4d .4  K& & { le z%5 2U b%5 K M 3 .M3N F% K  F% K_V?& &  le@+ vEft5  K  F%5 & &  le 2 2  f& h%  F%   5|_BE%!  4d  2U KY vEft5 K M7 vE%  KE% vEft5 && Ɩ% 55 H& &  le7 1 & L%f F%  1 & &  le %1 & &  lesV1_Q1%~&rw7<1 sd7)1817& 1 ie7 17 1( Ks j % >ww  vEt5  K F% & & 7 le  vE%  K  F% & & I le F B vEt5  K& & [ le & % F% F  F  F  F 2' K& j % >wPw <j. vEt5 " K F%f F & K& j % > & & e lewҋw   & &  le K F%  & &  le  G% wdw P~' vEt5  K F%$ Kf j % > & &  leww $ K@EtE Pf %& f% M4N&  ww D& j% K Kf F% vE% & &  lew@w ,AWpD%)E% vEt5 K K& AWpf%  le & %f F%ww AWpD% vE%  Kf F%f F wrw ^D EUEtE PwBw .D H3 w"w  Htt%%  W-EU w؇w ćD H3 ww D H53ww  H4 4  5vf&@&  r UU4t w@w ,D Hf %3N  ww DC vEu vEuE%C5t5<E%6t50%% H5t5  4425t5  32 3& & : le  .M .Mww  5EUEU@ww ̅DC % & &T le vEuD wE%% He vEfe& jqe .M+t5 %  % D%&$ f%%  K %  %2w ΄ f f%@EtE Pww  f! f%ww D  wE5%E && @ t x' vE%  | & x 3 K3 K3 K35 @& > &  3  @& &  u K3 K3E K3 K3& fr lew :D#E K x' vE%   .M  ,w5 .M .M .M .M  .M e & &E lew pD  x,' vEt5 FwJ M4E ۃ& &E le N  vE% NU "Zw ΁D E%wāE% & &E leE5 M45A vEu%@E%& &  le .M ,  M4 vEu 5 @E% E%ff f%E% Nff k%5% @  x:'  K@& & f%4@EtE P_Nu-E%5t505t505t55t55t5"5t5@t##f&@t##&% f J  M45t5!f J ff %&%$)*)f . e_P%% @E%_P%E%_P5t5_Pu- Nf J  M4u-_P v_Nu-_PNf k%5%% @E%_P%E%_P5t5_Pu- Nf J  M4u-_Pf_PN vEf k%5@E%_P@E%_P@f J  MA1 D_P@E%_P@E%!_P& &  le_P vEu_Pw N}D vE%   x|' J w.}E & &E leE    >   J  K S vE% S4 vE% .M .MEU  S4 vE%w 4|5 _&U@_"U E5%9 vE%$ J   F@?   vE% ra+    2U%%% 5  \  M4 @wN{w 6{D 4d raw.{w {D  vEuo5EtE P v58e ~5EUps Ep U Ge   |5EUEU`A 6P r3  vE% vE%  h & & . leEp U % & fi le  & &  le .M wy e vE%&  4T 5 vE@ _W x' ra5f f% vEEWtEJP  K2 πN& z% W & &  le@ u  & &  le@   vEf d &  vEf lew jx @  55 5 A vEu@ 5@5 _rY _zY @53 M5A vEfA vE%$A vE% @E%@E% s3 @E36@A vEf < 3N & f% M3E3% & &  leKu _XX  & & 6 lexf \ 7jN K Mf J 5 F  N8& f%5" .M  ݀Ne @wZvw FvDE%&"%.45@5 D J\5>A vE%  wu5,  K EUEUEU s& ~%3N 4dN ra \ f%3 .M4   JA vE% & fe %&n le,  K4  %& f%& f%3 .M3 M3 M3 ςw t X R p-6k D l:wztw ftD5  J\  wZtE  & & & nce "ZU w tD  0!8k 5wt -w sN J\ (-ٮN 4dC vEt5  |p8k-ppjf 9wsw sD& `%55 O5F@ K MA Aa1%.& &  le). +& & }-#& e P%& le_^u  р  _^ @ @a5 @t@m Kf f%@ @a& f%5 ݀@ Kf f%5 ` _ 5 vE%  K vEWt@##f& %5f f%5f f%5 % vE%  z%& & f%f f%5@wfqw RqD @5@ W_la vEt5 S )@E%GC vEt5 8@4, _la4,_la .M& fe %& le& |%_na5 5 E%E% vE%  K55  vEf < 5f & f%5@ Kf f%5E%  vEt5 N K& %& f%f f%50 |%x  N%&f & %&fe "%&0) vEf e 5E?UNf f%f f%w ow nD  vE@ _b x' vE%_be   |5EUEU`A 6P r4 Ep U  EU vE% vE%EU  vEEWtEKP vEEWtEKP vEEWt EKP3 & %3  K3* 8& vEN vEf7) e&  vEf  lewjmw Vm EU@EtE PEU% Et E Ptwmw lD vE%3   %& &e *%&/ leN .MN .MN .M .M wl K EU vEEWtEKP3sss w 4lD v5` v5 e v5)EU v5 rf jEt E P vE@ & x' vE% vE% & &P le 0, U whk vE%  vE%5@5 @E%@5  & &b le vEff ٖ%54N .Mw jD v5N vE%  vE%; v54 rf 5j 5j  vE% & &~ le Nf& ؖ%w jw iD;>e ewiw iDC  vEuE5 %% vEuE55 Nff k%5% _k@ &_nk x'E%E%I vEft5 < _h _h_NkE%_h vEft5 _h _h j& &  le % EU@EE?2P@EtE P2%  % m( vEft5 ' ,_bk%% .M & f%wg%E%E%E%E% vEft5 _g%& f%5 ώfE%_g vEft5 _gf& `_e _g _g&E%0,E% vEft5     .M _zhE% rE%_g vEft5 _g  _bkE%_gE%_gE%_g vEft5 _g& f%5 ώf_~h%_gE%_g _0h%_gE% _gu _g _g  _gE%E%_g    %  .M_h% .M_h& f le_g .M %% .M _hw dDCB % D% A  1% %&% % %%!  &_m x't5 t5 w@d& &  le t5& &  %& & , %%& & ? % % %%  & & g t5t5 %%& & { t5t5& &  % %  _8l& &  _Hl_8l _k% t5 t5 % _bl% % %%_bl% _bl& &  _Hl_8l& &$ _Hlw bD6E5 vEu vEu@ c D a !^ &L& fB le vEu 5EU@EtE=P@0@ "_p xL(   3 wa@ A 3s r    & @  .M@    ,,,,@ A f&EEf&@\\xNx2v &v55NNm 5A1AAm f& 6ؖ%A15 } u-5 } u-_ o5t5 _nfe e_ o% $f&f& e 5 5 5 %Nf 5effef jqeeffef jqeNefefeff sw ^DC @  x( Ȝ 4 w^% 5t5  @  x(4   345t5  w X^D vE@  x(  4tw,^4 4 44&  vEfc lew ]DA vCE  x( & &  lew]4@ &  le   Jt5 A @  5u Ne&fe se5 Ne&& seA @v5u vNefefeNe&w \DC B @  - E o _t_&u@  x(bl@ twh\324 @  x( 324 @ ҂ x( Te  sr5 2sJ45@  x( S & Hy%5t5  S& &  le@  x(",,5 @  _t x)"   32  4 _t %%  w ~ZDE% & &  le vE@ + x)     44wZ44 &  vEf lew YD5 vEuA vEu@E%_&xA vEft5 _&x@ % " .M5t5  і%w{  te83  & d 5Nfe  & d 5Nf f% N5_R{%_5t5<_|@EtE=P frE% f%5@EtE=P: vEu%n uNf J _V{& EW le& fe J%&s _|w Q @a  Ap %)0fe % #EEl7PhEtExV7PR EtE?@7P<8wRQe  w 0QA vE% AA vE%& fe V%& le@7 E e x3 vE%B vE%+8~ vE%/.j vEWp e.u%@e Ne  @& d 5#& fe v%& le & E lewOw O@ _ځ x3@ \  N <   & f% & f% && Fǖ%&f |ɖ%& de& f% & & 8e& f% .MwO@@& f%EUP@ K@ .M@@& f% w N J ~1 f wpNw \NE%'  @֡1Ρ ¡ 1f & & | lewMw MzE%l  ȅ^1V J ELN wBLw .LDCE%& &  le .M .M0 vE% % & &  le& ؄% "T& X &  wKw K @ v5EUEp U0 EU e@   & " lew:K 5Nf  3 @E%    & & G leu @0 4d w J  f ؖ% & ff nce NU E KN,& & f%Nf & f%5f vE% f%Ƙ RE% N& r &  C N|& N & f% f%f & & ڗ: v5 N&& &   v5W  & 4%&ؗ& & Ne&  & r && b &f V & e& e& R N Kf  N .MwCw C_5 _, K& & & & Te& & f%Ζ v5_>& %&& x & e&  vn& e& P N \5 & & f nce "Zf    m 0  % [ E  .M n 7 ʕ"ĕ& vE%E%7 %h-_wAw A  & & f nce "Z5C vEt5 & &  le N Hf  wzAw fADCB N M5A vEft5<& &  leN .M& &f &ff   &f ȗew@w @N & %&ff e& N w@w @D% & &  le % % & &  le   w2@% w @ & & f nce "Z vEt5 & &  le *w?w ? 7N4w?w ?N M B< \ 727 0w?w z?Nf f% N wh?w T?Nf f% wH?w 4?N Kf & f% N w?w ?D K vEft5ew>w >D vEft5# Ke vEWt@##f& n% f%3& vEft5  vEf@ e w6>w ">D E% & &E} le EU vEu%@EtE P K3EUP u3& %3 vEu@ _ xr4 _,_ vWpeDkuDkI}-B@ ; xf4f&AA &%$ "Ne&& % @3 .Mw<@04eu-%fG `}@@ 6 xl4@4,4,@pNe&@& %@40@00% @ # ޫ ڸ @ T x4&&f $e_Ɠ5 @ta0&fj 8$e u-_Ɠf&&: 8&&( #e_Ɠ&  vEf lw :5   !@ @aAp %Nef @ @a0 %Nef w~:w j: /킟i (    Nz5J ǖ%~5 X% r7( w:w 9i ( w9w 9 w9w 9n ( w9w 9D M vCE%% & &  le .M Ng (   wh9w T9No ( wR9w >9D vCEE% & &  le& Ю % ; (  $ (  f ( w8w 8Np ( w8w 8N  w8w 8N  N N N  w|8w h8 C vEt5 & &  le5N J   p5    @m  D- N w7w 7DE _` x4 x4؊%  (   _ ( && P%    # (  vEu@  F _ x4 vEt5 ,_ :_ _ vEt5  vEt5  .M_ vE% _ _ vEt5  vEt5 f vE% Y vX HT vEt5E vEt5_ vEt5)5 Ne& d  h vEf J    vEff _ rw\5E5 &_t& f  le& Ю & &E$w 4D E _8 _ !_ȝE 53 & &E[ le   vE%_ _ΞE%E vEuf vEu%&t505t505t55t5 %5t5  E%E%E% vEuft5 _ vEu vEu@ T x*5 J m. x5;'4#@ 2 x5:8@  x539 @ N4f ( _@ & & = leE%  vEf <  & f% 5   Ю  f %Z vE%_%X_E%_E%_E%_EU  J 4_ vE AN4@5f (  .M w1w r1N Mf J 5 % %n ( Nw41w 1@E%!C vEt5 @u5 W  & & u le@5A vEu f < 55 N Kf &  Nf 4 A@v5uAE  W-ނ W-N KfQ f < 5 N Kf L &  Nf 4 5  Nf 4 A@v5u W ڂN Kf & f%f ̪ & f%  ff %N .M N .MN .Mw"/w /  <  N& f & w.w .D 5 Ne& d Ne& d  h &  vEft5   &  f % .M wP.w <. 5  fef %& Ю  f %w.w .D U Q x<5 vEft5 F; \    <   &  vEft5)   <  Ҩ & w^-E & &E leE5%%  :%    vEf < N& d 5 A vEuN& d 5 A vEu@ \ Y _" _  _( _ .MC5 N .MN .M _ f  & f% &  f & f% & eN hf &f f% & %NN %% fN f &f%i5t5 Nf Z 5N hf & f% & N f05t5 Nf Z 5N hf " & f% & N f &_%N f & f%f : &f . & Je& f% & N hf " & f%f &f & e&_5t5 Nf Z 5N Kf ~ & f% h & N Kf &_N h 0 & A vEft5N  N h& Be 5_& f le_.w (D5 E5Ne& d Ne& d   &f f% \ & R &f ne&% f%5 N  f % ώ  w(w 'DE _ x\5 Fw' E  p xB5 : K <  & E%% vEft5  , vEft5  & &  le 잖% <  Z & f% r& &E le& &E le_w & 5  fef %& Ю  f %wn&w Z&D 5 E%_$E% _$& g vEt5 c \,XE%O vEt5 @ 9,5fe& %& Ю fe& |%& Ю  f %P ( E%&5 . e  f % .M w%w $D 5 E%_| vEt5 b [,WE%N vEt5 ? 8,4fe& P%& Ю fe& 4%& Ю E &3 (   f %&5 . e4& %4 rw#w #DC5  f5 f 4ٖ%5 f 4ٖ%55 Nefeff ef 8% J ff&5 e   f %w#w #DE%E%  f&& ew"w "DCBE%'E% N f & eN f & e .M [@ 5 K5AWt f& %@& f%A1 K5A f& 䙖%@& f%A1 Kf N & v  Kf e w!w !D vEu@ 5N4 vE%  5 5 #E% vEt5    K55  vE@ _ xb5 @ NfU N$ (  .Mw @t@]U @ & T% @t@]U( (  vE%NU$ ( N@t@]U& NN]  NN]  vEf ̹   NU# ( NfU _į _į_ _įN& @_¯&  vEf  le_įw .D vEu%Lr@ 5N45 E% 5  5 5 Gu@@E% vE%q J  F@ vE% H  ™ &  f \ 5u % <E% & & % le w vEft5  < 5 vE% & %5t5 f5  @5& Ю 5  f Θ & Ю %  J    ( u_b@E%!  vE%   vE%   Ю W vEft5 ,F vE%  ԩ9E%3  , vEf < 5f &  f Ю  vEf % 5 u _N Ne u  ( @ J  "5 u Ne  Nd (  @_p  ( w fD vEuE% 55   f < 5 f < 5N Kf \ & f%5f @ &f 4 &f ذe& f%5 N5@f & u% @f Ε & - N Kf & u  ff %N ,N ,Ne wN w @ 5N4  UNa ( ww De& & ww f  wrw ^Dp& ԋwTw @N N w<w ( ( N N ww De  %ww D4 l S vE% J  vE%   ; (  N( ( ww nwzw f wjw VNfe J % Nefe J w2w  @   ( N ( (  $ (  @   ( N ( (  $ (  P ( ww N5f ǖ%ww tDe% &5f e 5f ǖ%wHw 4ff5f ew(w Ce%5f   ;5f e ww % N5 ǖ%ww @ * x5AWpe6PN  5 t Ė% twhN5N5N5& f lew N5( ǖ%ff eww    N5 ǖ%fff 6̅ 4 e ww ww  ww %i6N j@    5 j%h_f nh >M5 Xh N ( N 2 E (  7 @_0@7 % NhLh&  %>h %7th5 h&  %5 @ f %e @- vE%  vE% E% f %e _G5 )@t` @t` K M@t`& &  &  "  M K ܐ & &    0@ H &  @ ww r @ ȕ_35& @,@_% Ă@ EE&_ " N w|w h  @   @   ( N  ( (  P ( Fw,w w$w 6e   @=%xeD 6@.5 vE%3 m&6fe Ė%Nee E%&56 ee-eƂ?6x wh vE% vE@ Ă x5  vEf ̹ 5 f)6fe eN/626w D#D6f   %% ,&K6f eww  NP6f ǖ%wxw b&0u  W-0uT6f ffc6f ew$w  Np6f ǖ%ww  %   % & " w&  @ppC`pL 9 E5 @@l w%ww @D*\5% %-%+ 5 55 55  B5eA5 ;>%.55  B5eA5 ;> %E%e$%+%-  Wp B`e;>  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& e5 55w 6 m 7hs"Hw N D LԋwF w 2 De LN 4e~6e  4e6 Be v Nfe Ŗ%w w -vs@ 6w N6t Ė%tw z u@t52t54t@ 5tNefef BŖ% (3A@u5Btr4t22t@ Aupt fef BŖ% u-u-u-@w w BuNefef і%=@@w w ~ D% 5     |@wP 4- mnVlw e& 7 z7zgwn ywf w D85U5_5P_ nz mdz@e4 ,5Ne & |  uN 4USt%wlYwfw Net@f e  w6w.w  B uU74 uU7* u( u Ae vB 7   % 55 a  a!PE -Ʀ% u w$  `e vWt vw@ `e @  %lhe U?VV `e 7D uU?8 a7* "$?U ew dDE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `Tmdp& E%VpmPp%w w7l*'$!     o 7o& Ao& BF7!oW-l7o& & e Ӌ 4@8@ &7Vo& e Doӕ->oӕ0B~*oӕ.  ӕ0~ B~4@8@&7n & Le nӕ-0 nӕ.n B~ӕen ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .lu:@Bw* J@B V_l@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff <e w5  @ 0   Wp `e0w DCB P  5 , :% & E& " z   5 , @ :% & f E "  (˥-%0     ,:% &  " 8 5E& z   5 , @ :% & f E "  w&w Nefef 5& e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @ww fff 5& eww  fff 5& eww  5 %O N  = u555Ne5& ^e5fu55'0Ne5 B& ^e57i Be0" 5%fu55 5 B5@B eu a=%u7Duw %fu5 B5Ne& ^e55e0%fu7I`Jʕ0%uʕ1  %u˕0 ʥ9 6@~ _ _ _ 6_ _  _ t_ _ _ _ _ _ r_ v_ _ _ 0_ _ *_ _ _ _ h_ _ N_ _ _ w h C & &  le b~CCwJw 6 %hC %hC & &  leF*@  AA v5& @f& %%& lee-PC҂   ` ww B  (C N wtw ` %8#& % >#   t '47BwB '7%I#N#C#B ǖ% @7 @ Y#A ǖ%]#A ww De   | v5 Et5A  & & & &( le w>EU Ep U@ EUEUU w %N@ 7և& F"%& %`#@ N  @ n#@ ǖ%N  @   N f  5% 5 5 %@w@w:w 6 <%7(%  ,%7  @ \ 7@s s $33 % % l@ @EtE PEp U@ N f& ؖ%%? Nww %"@G% @z }@& ^d% 4L N$  ٖ%7: K *  jj  jj  % ? %?  ww D  x#?؅ KEtE P&  w& &D lew ~ % | r& ٖ%55 d^ >N& غ   xw.w  .%>_%>_@ @    e vDE N>7F>%   7w% >'% & & ` le)  7 Jw F& & % & & -= jj " 1jj@ pjj% & =  7r= 7h=EUZ= @ =J= c 33t5EU = 7= = % %   ٖ%7pEU d3@5@ v5 2 u @56@ v5' eU  vE% &    c 2% u @ w vE%%|w Z l@t7l#\@wLw 8 v#BX @__ v5  vE% vE% v5 & e .%& le_ vE%_ vE%k vE%   vE A#@5& :: e  'f f A m:m:@ ee@ f& ef& ,e7:w:N  $u5f&  .Ж%& ewmR:wmN:w H:- vE%$ vE% vE%e   |EU vE%Z vE%Q #E%A vEft5  &  le vE% " E% vEft5  &  lee-*9_N RWp 5aJWp @aau5  :  88ee@ f& *ef& Je78w8 ff XΖ%& ewm|8wmx8w r8 -8ww 6P!AA vEN@f&f %& xee-8ۂww pD vEWt@5#5# T P@J vEt5 f&fe De #E% vEt5 f&fe eA@w E%w ~ 6P_E% _ _ v5 4d vEu A# f&&& je  : & < leA A# f&A A# f&A A# m m@ ee@ f& ef& e4 t2 6P r2 % 55 @t5#5#%@5@E%@f&fe ` & N letm tmt  _e e-p5_ww 6PIE% @  '  !4- 4-|# %  & & :%&j le4- 4-4 44 4 e-4w2w 4f  74ww DC% )@E%A vEft5 @55& &  le t5#5# A# f& A# f& A# mzmz@ ee@ f& Lef& le7VzwTz EUEtE P% ff W%2EU E E2Pff& e7`yw`yw yyy  f& W%2ww D % & & le% @E%A vEft5 @55$=& &  le Y vEA-#% 5,5,}N w@ vE!uuN&f ٖ%Uw Nf 4ٖ%ww rDC # &   |55 EU @w8@E% &  le w A v5  & f  leEU f  @& \ A1 ww DCB _%  v5 vE% EU .M_ # v5  Et E P` vE@ @ U & &-J v5  EtE P vE% 2 0 T%4( vE % f& &%  & &P lewrw ^DC 8 x #%wJ%  & &  le%%% 2/%%& &| lew D v5EUp vE%  & & le v5EU v5Ep U  vE%  & & lee ~  & & lew w D v5EU vE%  & &  le v5Ep U  vE%  & &  lewzw fD v5!EU@te 54} R%A15 Q vE% & &> le_@t@mO@ @- @ .M@0  & & \ le Q%AWtAm1@t@m0 u-@t@m 6Q%@e5_@t@m @t@m K f% P% f%E%@t@m@t@m0  + ٖ%AWtAm1@t@m @ @t@m K@& f%A1_@t@m P%@t@m @t@m& xS & f% f% ɀE% @@0  * ٖ%A1@ww 7 Xr +7 Pr6P +7 ns7 G7 qww n($xG 7 *7 *g7 h7 h7 hq7 b*7 g q7 */$q7 *7 >q7 q7 q7 .q***7 p7 pg7 qq qF @0 0 e-p*@:5 .M)5 @t` .M@t` .M " .M .M .M  2 e-)Â7 )F)h)) @ u $ 7 )7 )7 p7 p7 )7 )7 f7 p7 )5 @ 0 jj % 7 o (za& & za&  eni& ( eza&  e wxw df & #u- !f f , leu @ A pe^f&@ wb5 & A @ 5uEUt @ 4A a r @-fffAWp eaf Te5-  ll@ 5 u  & &B le&  vEf]w zAWp DeaAWp Cea @A f&& & b$e4t @A f&&& $e4t s33s #u@!r- =L@p  pr r u  wN w D σ  wxw dD   wVw BDC  .ME%6& & , le .Mw E% vEft5  5& & & le .M (5 ,Nefe & & E leffff e  .M u-w <_;5@E%_BD    & &\ le v5 0mp 0m _ K M5@E%_A vEft5 _t / K M5@E%_A vEft5 _@4 4N .M  K M5@E%_A vEft5 _@44N .MU J:F:22   4,4, 4, 4,79_$ $  .ME_ u@@ _^ _^ ra5r~l~ vEWt@##f& e5u vE% f&fe eff p]%@& f%A15@E%e}w }@7,}7,}5 & & q le N K "Z5 887 l}7 j}A vE% .@E%AA vEft5 @& &  le_A vEWt@##f&@ vE%  Wp@HPFP  Wp @aaf&@@ vE%  vE%   vEWt@##f&@ f&f e@w& &  leN .M777 {7 { 6_8 w BA vEu% 2 % 107R@f ̹ sӕ ̋%s7+@55A vEuA vEu% >% ; 5 & &  le@t##f& PZ%A1 5EtE=P% ; )@55/% % Nf k%% & &  lewNeffef jqe@ _ xh$4Nff ffsz5Q efff|Q e5 2Nff ffs52Q e@t@a0&fQ e @t5l#5l#u u-_@5A 5 u u 5 * ff ffeu sp4P e@@m$jP ǖ% u-@ AA@5@ _ ff ffeu s3 P e $O ǖ%& f<_w DE% v5U    Ne w .Mw jD d 3 $ 73$ 6  f& h3 e dfeN3 e  _ x$ 2"oo$2 e xNffe1 e%1 w>o<   Cg}#|)Cs44#2CqCCUe!\ qUh*DEFLKJIHMONQPR_#cdefg4\eDEFLDEFLKJUMONQPRDEFLMONQPRmDEFLKJIHMONQPRDEFLKJIHMONQPRDEFLKJIHMONQPR 5+FV:C[$?,(AE@! X"'%678/3)Y=&BZ;U Q>1WG<DTDEFLKJIHMONQPRRSDEFLKJIH^MONQPRDEFLKMONQPRx{|}eeeeeeeebeeee8FC?AE@=B>GDbQ@%{zt2'%p%%%%%%%% o.2%% 9)ww9%%$Dnw%K%  2%9w%www99www9w9sih>>hb^9$%V U$T9Z99E%Owwwwwwwwww CN9>?>-4JD% %w%ww9 w99$D!w$$9w9wDw"9999ww99(&( '  )*2%#$  " +T ,!sji>   ##%&&(),++--....334"55**87799::;;<=>A?@@BBCDDEE FFFFFFFFFFFFFF00HHHHHH''''II//GGGGGG1222JJKKKKKKKKM6LLLLLLLLLLLOPPPP$$RSSUUTTNN!QVVVVVVVVVVVVVVWcccYeee\\XXffggggh^Za]_bb[[ii```kkkkkkjjjjd  %;D,(A+8!$#'*5)20?1-./9C4>"6G B=`aH:@&37,MMMMMMMTREQII OPIQIMIIIMIIKIIJQIYIIIQQRSTMIMIQJQIRMIRIFJMQRSXWVUTZ\[^]_JJMMQJMMMMMJMJMMJMKJQLJMJJMJIMJJMMMMJMQRMI JMPEJIMLQJKJMJJJJJJLJMMJ  !"$%'z8zzzzLz,-./01234567zs&WYZ?+s  88>cBDFKa_q;ACEJpon   cc^eHNtX@[<|l)*=Gbuwy(9 dfhkjIMOQSUVr\]~mgPT`vx:ikRS22H%P$Db%4Zjx%%%%%%%%%*T^hr|">Tjz%%&>%%\%%%%%%%P%%\x&6J%R%%Zz%8%%%Xb%%j&%.@%^%%%h4Ldz<d%l% .D^x%%% %8%%% . F %%4!@!Z!%!!!!!!"""*"%2"%F"P"Z"d"n"x""""""%"""%""""#0#F#%%N#\#j#z########$8$J$%h$~$$%$$$$%0%%L%j%%%Error on line %d of %s: %s yacc stack overflowError on line %d of %s: %s syntax errorr (L(b((s(I)J=K,M+O-P*Q/R$N:LO!UT!VX!Y]! c! j!Zn!_r![v!]z!\~!^!W!X!!!!!!!!!!!! !"! "$"#"& "'&"%*"(0")<"*E"+L",U"-Z"2c"k"3s"5}"4"6"7"8"9":";"<"=">"?"@"A"B"C"D"E"G"H"`#arCannot open file %sfunctionand.or.not.true.false.eq.ne.lt.le.gt.ge.neqv.eqv.assignautomaticbackspaceblockdatacallcharacterclosecommoncomplexcontinuedatadimensiondoubleprecisiondoublecomplexelseifelseendfileendifendentryequivalenceexternalformatfunctiongotoimplicitincludeinquireintrinsicintegerlogicalopenparameterpauseprintprogrampunchreadrealreturnrewindsavestaticstopsubroutinethenundefinedwritedecodeencodePPp$PTPhPPPMAIN_MAIN %sMAINBLOCK DATA %s: entry %s: .bss_BLNK__ _BLNK_nx$,, %s %05ld %05ld %d %d %d /lib/f77_stringsvvhWarning on line %d of %s: Error on line %d of %s: f77 compiler error line %d of %s: Error on line %d of %s: Execution error %sDeclaration error for %s: %s Declaration error %s unrecognizable error switch .&/&4&8&<&@&G&K&P&U& \&c&h&n&t&{&&&&&&&&Z99T9j9`9p9v9v9unitfmterrendiostatrecreclfilestatusaccessformblankexistopenednumbernamednamesequentialdirectformattedunformattednextrecf_backf_rewf_enddo_liodo_fiodo_uiouflf_openf_closf_inqu 4LrLLLLMnL~MNMMMMMMpM NhN2NpN,NPN,N,Q,Q,QPQPPPPPPOQQQQQQPP&P&P&PPRP,QPPPPSSR>SvS>S^S4S^S4SVBWVWdWaaaaababbaabaeeii&gvggjkkggjgggggggjjgggggvggggnkgggnkggggglllllVllllltl*mllllllblblpmpmpmVmbllmmmmblblNmmblblblblbl~pp,onFoXopoppppppppppppopnnnpppppojoopoqqqqqqqqqqqqqq6r6rZrZrPrPrrrrrrrss t tttatan?datan@atan2Adatan2BsinhCdsinhDcoshEdcoshFtanhGdtanhHlgeIlgtKlleMlltOigetbtQiandSieorUinotWiorYishft[iputbt]r_intd_intr_nintd_ninth_ninti_ninth_dnnti_dnntr_absh_absi_absd_absc_absz_absh_modi_modr_modd_modr_signh_signi_signd_signr_dimh_dimi_dimd_dimd_prod h_len i_len h_indx i_indxr_imagd_imagr_cnjgd_cnjgr_sqrtd_sqrtc_sqrtz_sqrtr_expd_expc_expz_expr_logd_logc_logz_logr_lg10d_lg10r_sind_sinc_sinz_sinr_cosd_cosc_cosz_cosr_tand_tanr_asind_asinr_acosd_acosr_atan d_atan r_atn2 d_atn2 r_sinh d_sinh r_cosh d_cosh r_tanh d_tanh hl_ge l_ge hl_gt l_gt hl_le l_le hl_lt l_lth_getbiti_getbith_iandi_iandh_ieori_ieorh_noti_noth_iori_iorh_ishfti_ishfth_putbiti_putbitsqrtexplogsincostanasinacosatanatan2sinhcoshtanhZ{}}F||zLLLLځځځځځځځځځځځځv؈s_stops_paus()*+%65<="?<A>=@ddPFH.,aZ0/1&-rғ 6hv88**2NĔĔĔ0֘֘ddddИttttlt:PPPPzz::H R```088TT\\Txxx@dd~ڢΨ¨¨ίzzzzzzί_%ss_copys_cmps_cat22(DDƾƾƾƾƾDL%d: %d.;%d. %d. L%ld %d.%c .even _%sv.%dL%dq.%d%s: .globl _%s .comm _%s,%ld. MAIN_MAIN_%o%s+%o%s%o~%s = %s ~~: .byte %o%c%s . = .+30000. . = .+%ld. %s: : Unknown error: %d<7D7N7h7x7777777788*868L8X8d8v88888888 9929?9U9d9p999999::/:N:o:::::;';F;V;m;;;;;<<:<\'>RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ((((( AAAAAABBBBBB tfufud~oxHfVeHg"c.sXlXLuDOXU=(\0$lʤ B&(*R0YR0Y0 e7cce7.h 6% /f  7X%  X& % w AA rd5%22AAe vCp`eu@ E5 5% + % 7NA vffff eww  . ,&& % _* %  %^ww @e7A WpDeD- A e r5 WpDe@a7CKss ~~@ 7vwr@@7!b&& X vf& eD7> .ww  $ & & & ew 5ea w  EQ$wH: emonstartup: no space for monitor buffer(s) monstartup: no space for monitor buffer(s) mon.outmonitor: buffer too smallmonitor: buffer too smallmcount: counter overflow h)I(9H$T # ""X( ."4 ;"hG"P Z a e k r y ~".  "^_environ___progname_strrchr_exit_mainstart_etext_monstartup_monitor__cleanup__exitcsv_sbrk_writeminbrkcret_moncontrol_creat_closeldiv_profil_errnox_normx_errormcount0(l[ 8  R0|R0|0 1  e7cce7F  / "  7%  *w <-% @+ e 5 %@- n e %@& !% @ b%% *Nen " %@& !% @ b%% *Nen "  ,777 @en7@e7      d 8 V   F . F<  _( b%%9 b%%L b%%c b%%t b%% b%% b%% b%%| b%%h b%%f b%%V b%%H b%%46 b%%&K b%%] b%%q b%%etE b%% *wt*w `*   @ x Ln̕4 44 ?w*̕44 +  t4L&  4  t44   4 4 34 %%1 w r) n h d $% % %:  w>)% %  b%  *Ԑ    $%1w (D %9 Wp C`e%0 w(w (_   ~" _ % "  ._ 1a ~" V   R 7%d4'E@ t@  ~" %d ~"  , e  ̥̥ ~"w'   ~"  ~" w \' B$ ' ԋ"̥,5 ̥*  Ԥ(, N %2 jw 'w & D ̋ w& ԋ%D ԋ D%D @w &t @`@`E r9C e %j  #ew`&w L&  wH&n  Ҕˋ˥ ˥ ˥ ˥ Pt @`@`E r9 e u n ҢӋӥb Ӌede%j  DLˋ˥0ӥ9 w d%  %  ̥  r 1 4  f>̥̥̥ 34  r C ,0 ˥,   5 @4C  ̥  ˋ˥   w$w l$7 _ ̥̥̥ $ ! ˥ , r   r̥(ʥ#˥  04 ̥7̥4S2.*1&#    40  ˥ (00  l P̥̥   _, w"w "D#w"˥& N  " ̕44 ̥w f"D̥ ' ˕3 3 3  33w"w !D̥A>B ,: 8 5 2 ( 632 w!ʥʥ ˥˥˥! ʥ,@ D " 52 005s5r " N @  _ w j ̥%  ʥ & l   w0 w  DC%& N$ "   8 ,̥ww 4C5  0_ xd_< NP  'q Z@m -00 z  w*P h ̕ q P 0& 7P   4 J_N& & 4%P Zq ZNq  AmWp!e NP Nm  q  q P 8 P q  ̥P h  P h ̥̥P h  00_b̥_xP h  P h _xCq Z #0-lz 8  R0|R0|0P h  (P h _rq Z _rq P 0& 7A dP   1 ̕0_ _r_rq Zq _rq fe 0&  q Z _P Y q Qq fe h HP Z  00_bNP  0q   1 ̕d0P % q P  %4  N& & 4%P Nq  ̥ q ZUWp!1  L x  dP  & &_ NP  ̥ _ _P Z2 P 5 8 7r_f N& & 4%P C @P ! :P fe 0&  P 8 &#000̕ >fe %4 _b  d  q   P h _0_00 P q ̥fEP h IP h  ̕q P 0& Qq h Uq h ̕7sP   4 ]P h ̕`q h ̕q P 0& 7P   4 lN& 4%_`_  c   q P h P q if    && Z%-- 000p  ̕404 Z P _0_` _`~ _f _f rw D ,ʥʥWp @@`4^ 2wZw F 5 v   b@̥:˥7 4 1  8&&   %,43t3   @ww +̥' Z !˥0-  ` ̕.40 w<w ( 5 @ 5` D-% ww D        ! w q &P eew D̥̋r̥(w~r̥-( w PD wRw :B@ ʥ ʋ @    ԋww D   (00ww D̥ ww D vD a-7aw|a- ,% l b%  *e7aw ( Wp!1 % 77Vww AWp!De C  Ԓ˥( r5 ӥ,$ww D  ZAmWp!1 CWp!@* Wp!e N& h Wp!1 @e  & h 7FWp!1 N&  ̋'̥(r5ԥ*CWp!@$ Wp!1 7 @e ww @ P 7ww B P ̥,̋q ԥ,  ̥ ̥ w~w jDNWp!e f h wV @e!w .D̥r0 4 eww  , %' N!  N! ww D̋ wӋ̥-(̥*-(+̋ԥr̥0̥4Wp!1w T _ZNq  5_`NP  %%  CP    ӕ,q 7 re077   r@e077    %A1 ww l _j%% ̝44 rf07^@e5P+̥&˥  5p3 @0tD  @p@w.̥̥̥ # ˥˥˥ ̒   00 w.w D = ˥8   )  5& Z%     w˥ w zAWp!De ̥$  Wp!e @ w\ Z & h w .DC ԥ$ӥ$w  ˥7 te`˥0 ̥7 te`̥0̥+ ˥+ ԢӋ@ ͂ xB- B-B-B-B-B-B-B-B-ކB-ڃw P DC˥$    Ҕw4 w DCԢ w Ӌw D 78w  w D̥* ̥(̥- ( 5 ԋ +̥)w w N w N h w l D 5(̥sp wT w :  l%  #  V% D& x" w w DC+ 5 *( a  r5 w: w U5ff %%̥a &  %e 3     U̥r 33%w w fef -%5 w w D 3 $,EtU4 4 w w D Lԋw w z u@t5 5 @ 5p Nefef #% (3A@u5Btr 2 @ Aupp  fef #% u-u-u-@w mn#lw, e& 7 7zgww v D85U5_L%5P_L% 8 m.@e4 ,5Ne & *  uN *4USt%5 '5 '5& & %% 45@e-4  % U5EU  wHE w &D5"E@e44fef -% 'U4 4  fef -%5 w w(w"7v Ћ P ы A@Pw FD:5UE5Hw* _'5uNfe & -% _'bNe & *  uN *)U5| m- 5 & -%St% L * U   & -% S U _j& @_n&w DE%%"5   & -% U wv w ^D55@ '  ( 3 $, 4 4 4 4 4 ww~w  ,$5+ &5e-e % &     * ww  5f * 7 f * 7DwX@ mv7tj%e w  T F    * e-*ww D 5 e %w  5 e-w *( )ww  N -ww rDCDpC * R* wZw FN $,wJ ~5 & E        ~5>wlYwfw Net@f *e  w6w.w   U7 U7  Ae vB7   % 55 a  a!PE -d%  w$ , `e vWt vw2@ `e @  ,% e U? `e 7 U? a7 ?U ew dDE wZw FD5 $, 5N *!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%ٷmه%w w7V*'$!       7& A& BF7!W-17w 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_/@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& B& z   5 , @ :% & f E B&  (˥-%0     ,:% &  B& 8 5E& z   5 , @ :% & f E B&  w  $(- 2 6 :>E I M Q UY]aeimquy} !"#$%&'()*+,-./01  NJjbrjeqjnejlejgejltjgtjlojhijlosjhisjpljmijmp.globlmovclrcomincdecnegtstasraslsxtcmpaddsubbitbicbismuldivashxor.text.data.bss.evenmovfmovofmovfoaddfsubfdivfmulfclrfcmpfnegftstfcfccsobjsrswab.endrC2: can't find %s wC2: can't create %s %d iterations %d jumps to jumps %d inst. after jumps %d jumps to .+2 %d redundant labels %d cross-jumps %d code motions %d branches reversed %d redundant moves %d simplified addresses %d loops inverted %d redundant jumps %d common seqs before jmp's %d skips over jumps %d sob's added %d redundant tst's %d literals eliminated %dK core C2: Sorry, input line too long L%d:%s:%sb %s L%d L%d sob %s,L%d %s (pc),,`,,``,n<<<<<<< 6666  h`     ( 0 $0$-1$177777$0$-400$-177400$-10$177770,$0$0(sp)+,(sp)+$-1$177777$-1$177777$0$0$0$1$1C Optimizer: out of space $0(sp) .d.o.xr/f/er.gL/cX/s.l.L.u.D.O.X.U09ls @a R0R00 2 j e7cce7 / $  7%  &+w `. Ƴ%  &e   & &ew.w . -  "7 w-:  ,:%   &  f' - ۃ ݀5E&w -D t  @  -r  d h e^ 7`*7T 7N !_6 @m70 ?, S7   '%5 dW ̱BƱR 5F 5: .    p pӕ ӕ)  R7 Lwx,   7j F &+ )  7س 7ijp L -_  : r r 7 %^X RL p:Vw +D 7 ԥ#* 7 -  & -  &mȵ 7  | x %\|wX+ԯ^  -R  &ԥ= -:  &ԥ=4 - ւ & - ̂ &ԥ N 7 _7  & ? @ ȕ/3v5&j d@,@/% F@ E2.E&/ f' 7P 7J ԕ/ԕ*ԕ*  2 % &ԥ/_ - Qb NI @ ȕ =5) @,!@ % n@ EZVE& f' @  Ȯ7v &\*  -J惄 B%78 & 4? @ ȕ*35& @,@*% @ EE&p* f' ? \ V@ ȕ/3D5&8 2@,@/% @ EE&/ f' 77ԕ/ԕ*_\ V_Z77 _6 -_Z &ԥ* _\e7 _\5\  -' &  &ԥ ڬ \t_Z  _Z -Pރ  %\P __b\ -_Z & ch\ -S & T% _Z_6PK\PB\P9\P0\ P'\@P\P\ -L &D P\ -"_Z &w %D77 \w%w %D %F#   0, V* &7  -  r(e"!    57`7`7`@mw$w $D Ce ȥ<# 77   > 7!ӟ ~ |n"5 ӟ\ X7!T"      :7,7&   7 % _  +  _ B % 5%6H r &+5 @ e5/@ȋNef T'"e 4NeSNf T' Qf ' Nef '  f '  1ڳс ~z 7س h CX ӋN  74 1ij L - "w"w "DCB & 8' 5J  wl"w R"R7 %6 n _& dN 5 ._& &N 5\f& T%55w5pP@`E5B-B-5 @77N 5̥(`Be@e5)̦ N  P M@e@-/@5=  }N 5̥ ̥)̥,\@5=eD- ̥  hCd@ ȕ : G JD5&8 2@,@ % @ EE& f' @7 7N 5 ̥\̥ _ \)u@e@-D-ӃN&f  % @Ae@ ӕD̥"̥'5D-׃L\D-\ B-u@e@- ׃&f  % @Ae@ ӕSB N  8'$6 0>lo @a R0R00N d  @ p 7^w@wCw xD\  v p L\x  Z#TPL R &B T% >- 4_ Z  "_ --0   & T%   _   & T%   _--  _ L_ x r_ _-N \ V» N H D _- ._ $ & T% _-7     _-k _ _77 #   5- @ -h @ -N "-:_@ u-" "Nf  V 1_@    77   _@w DC  & :+ 5 @wlw XDCeCe\=ӕ Ӌ0 \7! 77 0@a\  7!~ 7~7x ˥ ˥   @a@a \ʭ   @ 77ww DӋ !/!ӕ. ww D ww  @ H @w w ~ww rQ \\\\\\\ \: \ U4  7D 77ԙQ @m -_ r_  @m& ' 7V @m&   &+ @m ę 1 @m 7 eij& @m& 0 7j D- xR t ] &  &+.T t% 5 D &% &+@o/ t% 5 7 n  $  % 7N  &+Ne2 $ Ę  س7   0  7$ 7 7 7 7 7 7 7ַ 7ط  _ T7  T7 T7 T7  T7 5֗ )ʗ "- _Ne T @m _ C- D. E_ Id M P R U> @m  _ 4 *_ &_ _%J @m @m_ @me?LeF_%r> @m @me?e_% @m  AmAep_% #8 @m& % 7 @m:   &+_ N)_ @mJ_4 _J=f  fe  -<ʕ p^^Ze7Te7N7 T7 Rf L4747.( 4̕ww  _N w 8'_ 8 5H_ 9Y0U0xXe    +!  8'  ~_ d  5 7 T@  7@_ (\'C\5'0 ̋A@ 0e 57I9) 8'>~ē7 p 7hw Z_R?LH%8_ ̋_ԯ(577 @_,  w 5 u@ 5D0 6' xZ@e52AupAmu@e5% @e5% %l%LNT  ˀ@w4 w 6 7 7 Bee@e f Jw e 5* %,  77 m%k@ T5 -|& rC h b 5%, F H7<7 6e%@ e -@5  H C x z J % * e5%k T %& @ T_! 5* @e ֆ_! l_!`_!@  D@  5@7du@ 5 @  b 5%k  T A p & @  T@ _! x _!Lpw_! r7گ_! rc t t4# 4#4#4#4#4#A @@@xS     7&_!  @ 7 _!w D 3 H-EtU4 4 w w D Lԋw w x BuNefef .%=@@wL   Ћ Ћ w  D  +   r= wB w5 a U5ff '%ށ̥a &  'e 3     U̥r 33w &D5"E@e44fef .% (U4 4  fef .%5 w w(w"7 Ћ P ы A@Pw FD:5UE5Hw* _(5uNfe & *.% _(bNe & +  uN ,)U5| m- 5 & *.%St% " + U   & *.% S U _' @_'w DE%%"5   & *.% U wv w ^D55@ (  ) 3 H- 4 4 4 4 4 ww~w  `$ 5+ 0 &5e-4e %z &     :+ ww  5f :+ 7Ԫ f :+ 7wX@ m7 %z e w   z    :+ e-^ww D J 5 e %z w&  5 e- w N) *ww  N 0.ww rDCDpC , v+ wZw FN H-wJ ~5 & E        ~5>wlYwfw Net@f +e  w6w.w  "U7 U7" Ae vBި7   ֨%Ш 55 a  a!PE -%  w$ . `e vWt vwf@ `e @  .%>:e U?(( `e 7 U?  a7 ?U ew dDʧE wZw FD5 H- 5N ,!w5A vBB-  }ee@ !ۃ `!ւ ` `&mn& E%`߷mZ߇%w w7̦*'$!      7& A& BF7!W-27w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_0@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& f' z   5 , @ :% & f E f'  (˥-%0     ,:% &  f' 8 5E& z   5 , @ :% & f E f'  w "J&ZZZZZZZZZ|ZZZZZZZZZZZZZZZZZZZZZZZZZhZZZZZZZZZZZZZZZZh%s: argument mismatch%s: %s # %d "%s" token too long%s: unterminated macro callmissing endif%s: too much pushbackno spacetoken too longbad include syntaxUnreasonable include nestingno space/Can't find include file %stoo much definingillegal macro name%s: missing )bad formal: %stoo many formals: %s%s redefinedIf-less endifIf-less elseundefined control 1%s: %d: too many defines%s: macro recursion%d"%s"%s: actuals too long_$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567890123456789. "'/\ "'\* .too many -D options, ignoring %stoo many -U options, ignoring %sexcessive -I file (%s) ignoredunknown flag %sNo source file %swCan't create %sextraneous name %sno input file specified with -M flag missing component name on %s /dev/nullwCan't open /dev/null/usr/includedefineundefincludeelseendififdefifndefiflineunixpdp11BSD2_10__LINE____FILE__command line    ! ! ! ! ! ! ! ! ! !T!T!T!T!T!T!T!@!@!@!@!@!@!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!,!,!,!,!,!,!,<> -<> .<> /<> 0 1 #:  <  9 ;      !                   "%&'()*+,-./012345678$=  llaaLCC7)  $-!~(*/%+- <>&^|  ?,():)"""2####$ $$$"$.$>$F$N$V$^$f$r$|$$$$$$$$$$$$$||&&>><<>=<=!===bt n f r \\+-*/%<>&^|?:!~(),defined\ Illegal character %c in preprocessor ifIllegal number %syacc stack overflowsyntax error ((((( AAAAAABBBBBB ,,/d/o/x0f0e/gp0c|0s/l/L/u/D/O/X0U0Ll" 3_R0XR0X0L@ e74cce7( /  7%  )I8$N #L " ( ."4"J;"JG_environ___progname_strrchr_exit_mainstartmcount_moncontrol0Nlu f( * , . 0 R0R00! __.SYMDEF 810720543 0 10 640 10670 ` ) )+n,,&,,x-3x-<.C/KL0RL0W@1^@1g1n1uv2|v2333J4J4444,EGGHjKdee f f  f f f  f' f. f6Zm=ZmE>nL>nTn\ndsksrtxuuuuTvTvvvww"xxbybyzzzH}}}}}%}0};BIPXW^iFqznnЎ""ZZ.z#.9DHLHTH\HdHl szTTvvFFFF#."4pC RbnzҼҼX,D8BLV^BeBkrztt((VBB v$F+2;AtJT^hr|ZZ       ""Jll  (3=#C#N#b#k#wN9~N99999999zJKMMzNzNOO ORFS$FS.S5S<|TC|TKURU\UcUlNVuNV~NVNVb4c4cccccccccj j j j% j6 sC zN zW zd zo zy z z     V V 2 2 Ҙ Ҙ t t     , ,( Ƣ/ Ƣ6 `A `L `Y ` Vj s {     . . .  P   Z   " "   X p p( F1 .9 .C L T [ f *m *x   h h     l l       , ,  % 1 P8 PF N U _ pf pp  x l    P  J J   $ $ % |& b' d( ) *% f+. ,6 -> .F B0N 3T 3Z 5a 5j l6q l6w 7 7 7 7 7 pD pD  E  E  E  E  E  E  E D[ D[[[x\x\x\(z_5z_?JoFJoLoSo[|pezm t {Pʊʊj..BB&؟/6@IT_j qyp"pll((>>>> rrrr$*159@GFNFV_fow~F``0Sl8 f( * , . 0 R0R00..HHPdd%-4;ELUD^BhJn4uD~VV>8 ,;J|U^elv !#:%%&h'h'( (())%b*-*5+=,E,N&0W&0_&0g5n5uT6{T6T6T6T6T6T6J< ===\?P@P@@@ABBJC$JC*JC3I:IAIHIN(JU(J\JcJjJrJy|KOOXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXS"BV*BV/BV6BV=XF^K^R^Y___k_t_____setjmp__longjmp_abort_abs_errno_acct_errno_adjtime_alarm_alloca_errno_brk_errno_chflags_errno_chmod_errno_chown_errno_chroot_clearerr_errno_creat_setkey_encrypt_crypt_daemon_errno_chdir_devname_getdiskbynamealmul_errno_dup_err_verr_errx_verrx_warn_vwarn_warnx_vwarnx_errno_execle_errno_execve_execlp_execvp_errno_execv_fabs_errno_fchdir_errno_fchflags_errno_fchmod_errno_fchown_errno_fetchi_ffs_fgetc_errno_fork_errno_fperr_freopen_frexp_setfsent_endfsent_getfsent_getfsspec_getfsfile_getfstype_errno_fsync_ftell_ftime_errno_ftruncate_fwrite_getchar_errno_getegid_errno_getgid_getgrgid_getgrnam_errno_getgroups_errno_gethostid_errno_getitimer_freemem_getloadavg_getnetbyaddr_getnetbyname__net_stayopen_setnetent_endnetent_getnetent_opterr_optind_optopt_optarg_getopt_fputc_fputs_errno_getpagesize_errno_getpeername_errno_getpgrp_getprotobyname_errno_getppid_getprotobynumber__proto_stayopen_setprotoent_endprotoent_getprotoent_errno_getrlimit_gets_getservbyname_getservbyport__serv_stayopen_setservent_endservent_getservent_errno_getsockopt_getttynam_errno_getuid_getusershell_endusershell_setusershell_getw_getlw_getwd_gtty_inet_lnaof_inet_makeaddr_inet_netof_inet_network_initgroups_setgrent_endgrent_getgrent_insque_errno_kill_errno_killpg_ltol3_l3tol_ldfps_errno_link_errno_lock_errno_lstat_memccpy_memchr_memcmp_memcpy_memset_errno_mkdir_errno_mknod_errno_mount_nice_errno_getpriority_nlist_fseek_ns_addralrem_ns_ntoa_n_stroff_n_symoff_n_datoff_n_treloc_n_dreloc_pause_errno_phys_popen_pclose_errno_dup2_errno_pipe_errno_profil_psignal_errno_ptrace_putchar_puts_putw_putlw_errno_quota_srand_rand_srandom_random_initstate_setstate_rcmd_rresvport__check_rhosts_file_ruserok__validuser_errno_bind_getpwent_getpwnam_endpwent_getpwuid_setpwent_setpassent_setpwfile_atoi_atol_errno_flock_errno_geteuid_h_errlist_h_nerr_herror_inet_ntoa_errno_readlink_errno_readv_errno_reboot_errno_recvfrom_errno_recvmsg_re_comp_re_exec_cclass_backref_remque_errno_rename__res_opcodes__res_resultcodes_p_query_fp_query_p_cdname_p_rr_p_type_p_class_h_errno_res_query_res_search_hostalias_res_querydomain_res_mkquery_dn_expand_dn_comp_dn_skipname__getshort__getlong_putshort_putlong_res_send__res_close_errno_recv__res_res_init_errno_gethostname_rexecoptions_rexec_errno_accept_errno_getsockname_htons_ntohs_errno_listen_errno_rmdir_ruserpass_mkpwclear_mkpwunclear_fread_getlogin_getpass_fdopen_printf_scandir_alphasort_qsort_scanf_fscanf_sscanf__doscan_atof_errno_ldexp_seekdir_errno_select_errno_sendmsg_errno_sendto_setbuf_setbuffer_setlinebuf_setegid_setenv_unsetenv_seteuid_setgid_errno_setgroups_errno_sethostid_errno_sethostname_setjmp_longjmprollback_longjmperror_errno_setpgrp_errno_setpriority_errno_setquota_setrgid_errno_setregid_errno_setrlimit_setruid_errno_setsockopt_errno_settimeofday_setuid_errno_setreuid_errno_shutdown__sibuf_siginterrupt_sys_siglist_errno_sigstack_sleep__sobuf_errno_socketpair_strcasecmp_strncasecmp_strcatn_strchr_strcmpn_strcpyn_strcspn_strdup_strncat_strpbrk_strrchr_strsep_strspn_strtok_strtol_stty_swab_errno_symlink_errno_sync_syslog_vsyslog_openlog_closelog_setlogmask_errno_connect_ctime_localtime_asctime_tzname_tzset_offtime_gmtime_errno_access_errno_fcntl_errno_perror_strerror_sys_errlist_sys_nerr_errno_send_errno_socket_strftime_system_errno_execl_signal_telldir_time_errno_gettimeofday_times_errno_getrusage_timezone_tztab_strncpy_tmpfile_tmpnam_tempnam_getenv__findenv_mkstemp_mktemp_errno_getpid_sprintf_errno_truncate_ttyslot_setttyent_endttyent_getttyent_index_rindex_strncmp_ttyname_closedir_opendir_readdir_errno_stat_ualarm_errno_ucalludivuremuldiv_uldivualdiv_ualdivulrem_ulremualrem_ualremulsh_ulshualsh_ualshultof_ultofl2fl6f_errno_umask_errno_umount_freemem_uname_freemem_sysctl_errno___sysctl_ungetc_errno_unlink_usleep_errno_setitimer_errno_sigblock_errno_sigpause_errno_sigsetmask_errno_sigvec_errno_sigreturn_utime_errno_utimes_valloc_errno_vfork_vfprintf_errno_vhangup_vprintf_vsprintf_wait_wait3_waitpid_errno_wait4_errno_writev__host_file__host_stayopen__host_db_sethostent_endhostent_gethostent_sethostfile_fgets__filbuf_fopen_h_errno__host_db__host_stayopen_gethostbyname_gethostbyaddr_inet_addr__ctype__htonl_ntohl_dbm_open_dbm_close_dbm_forder_dbm_fetch_dbm_delete_dbm_store_dbm_firstkey_dbm_nextkeyaldiv_bcmp_bcopy_fprintfldivlmullrem_errno_open_errno_read_rewind_errno_lseek_strcat_strcmp_strcpy_strlen__strout__flsbuf_fflush_fclose_errno_close__iob__smallbuf__findiop__f_morefiles_f_prealloc__fwalk__cleanup_exit__cleanup_calloc_cfree_bzero_errno_fstat_errno_getdtablesize_isatty_errno_ioctl_malloc_free_realloc_errnocurbrkminbrk_sbrk_errno_write_errnox_normx_error__exit_gcvt_ecvt_fcvt__ovnoovhndlr1ovhndlr2ovhndlr3ovhndlr4ovhndlr5ovhndlr6ovhndlr7ovhndlr8ovhndlr9ovhndlraovhndlrbovhndlrcovhndlrdovhndlreovhndlrfcsvcretfltusedpgenpfloatpscien__doprntpgenpfloatpscien_modf_monstartup_monitor_moncontrol_errnomcount_setjmp.o 810719745 0 10 100751 211 ` > Pe @7 7@  Fy ) " "'__ovno__setjmprollback__longjmp abort.o 810719720 0 10 100751 303 ` @Pw  %   % & w9IXiy "  ( 0 < D J Oabort.o~abort_abortcsv_sigblock_signal_sigsetmask_getpid_killcret abs.o 810719745 0 10 100751 53 `   " _abs acct.o 810719746 0 10 100751 92 `  3w   " _errnox_normx_error_acctadjtime.o 810719746 0 10 100751 95 `  w   "#_errnox_normx_error_adjtime alarm.o 810719721 0 10 100751 371 ` jPw De t4 tt 4 4 Ne&& % w  eu @y  $"+ / : ?alarm.o~alarmsecsitoitvitp_alarmcsv_setitimercret alloca.o 810719746 0 10 100751 76 ` FEf&$" _allocabrk.o 810719747 0 10 100751 183 ` 8-EwYYI9   ' ."3brk.o_errnox_normx_errorcurbrkminbrk_brk chflags.o 810719747 0 10 100751 95 `  w   "#_errnox_normx_error_chflags chmod.o 810719748 0 10 100751 93 `  w   "!_errnox_normx_error_chmod chown.o 810719748 0 10 100751 93 `  w   "!_errnox_normx_error_chown chroot.o 810719748 0 10 100751 94 `  =w   ""_errnox_normx_error_chrootclrerr.o 810719739 0 10 100751 99 ` w DE0w)"  _clearerrcsvcret creat.o 810719748 0 10 100751 93 `  w   "!_errnox_normx_error_creat crypt.o 810719721 0 10 100751 4108 ` Jjw  @m4 @m4 %  5  %w5  %w <  Wp0`@LpWp0`@dp % % 4| %0w:w 6 @m36 %@5 u `3v %  AWp0`A@ mA@x3 %0 WpDt Wt@` Wt@` Wt@` @` @` Wt@`utE4 tE4  E4 E4 % 6 A @x` %  v 6 %  %_ Ĝ6 `36 ` %  @`H5 %@ww  4 %B   tE4 % B%@  4 %B B ( %Z%9.  t5Wp`A uWp`e fWp`^ Wp`q % %   %   Wp`A BP %e.%9e%Ze* % 4* ( w|:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     V   "<*L1d8;>B E|HPTVXZ\_b6 ehv o r x6 ( " ""6crypt.o_IP_FP_PC1_C_PC1_D_shifts_PC2_C_PC2_D_C_D_KS_E_e~setkeykeyijkt_S_P_L_R_tempL_f_preS~encryptblockedflagiiitjk~cryptpwsaltijctempblockiobuf_setkeycsvcret_encrypt_cryptdaemon.o 810719722 0 10 100751 643 ` xw   xw    qt & e  #  %% & & & % &/dev/tty//dev/nulliy %("0 4 : ? F L S Z a gdaemon.o~daemonnochdirnoclosefd_daemoncsv_forkcret__exit_open_ioctl_close_chdir_dup2 chdir.o 810719747 0 10 100751 93 `  w   "!_errnox_normx_error_chdir devname.o 810719722 0 10 100751 680 `  w    & f %7 N  w& fe %uu@e5ffD re55 @/var/run/devwarning: %s????  %+.6;?"H L V \ a i tdevname.o~devnamedevtypebkeydevdbdbfailuredatakey_devnamecsv_dbm_open_warncret_memset_dbm_fetchdisklabel.o 810719722 0 10 100751 6432 ` dvw  Nfe l w e5@e5}|:  e@-= Ne1  4@e5Ne4  5 7 f UB A f UBK R UB&N t*Q t(T t,NeW  5df  & Z e@4&*& &(& ef&] et.&,& &.& hef&` e40t2& c het4& f Tet6& i @et8 l *et: o e@4<& r e@4=& u e@4>& x e@4?& { et@t ~ etv fe  fe  fe  fe  fe `exa&@55555Ne  s%&%" 3 e i@e4r fe eD50iNe 3s& fe es & fe  f& Be@3 & fe Re@3 Nefe  5 vf  3 uu& fe ef&@e5VWEVlWEn_"w  5 w2  5j w^D#T N @e!O  N 4 N ԐB-fef %5́ @a % D-Ԇ\ w v˥#%  ̋ ̋˥|˥:ˋ w˥:˥| ˋˋ˥: Dw jD̥: ̋ ̥:wHw D ˋSˋAA@ ˥@@w˥#  ˥05 5 & fe ee 5`u`u A@w X ̋T̋AA@ ̥̋:̥@ wfw b ̋T̋AA@ ̥@ w.̥= N&  w DC=%::\  xEB  @  0teP Dwzw vDf  @ N wLe @ w 0    N 5 5 fe& %ww N 5u% %uuA@w    $ ) ($unknownSMDMSCPold DECSCSIESDIST506floppyunusedswapVersion 6Version 7System V2.11BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660b0tyremovablesimulatedsfntnsncdtdtscsurtrcacrmilskcshstssbpxbxfxoxtxdx/etc/disktabE^^\\::n r t bf disktab: /etc/disktab/etc/disktab ))888888IXiixxdv*9> C HQUX[^acgmt{lR( l44 "%.168;REHKTW\_hquz}("             " . 4 > F L Tdisklabel.o_dktypenames_fstypenames~getdiskbynamenamediskbootlocalbufbufcpcqdppppmaxpsizepbsizepfsizepoffsetptypedx_dgetent_dgetstr_dgetflag_dgetnum_gettype__gtnumdflt_tbuf~dgetentbpnamecpcicntibuftf_error_dnamatch~dnamatchnpNpBp_dskip~dskipbp~dgetnumidbaseibp~dgetflagidbp~dgetstridareabp_ddecode~ddecodestrareacpcdpi~gettypetnamesnm~errorerriov~_gtnumdfltdnamedfltf_getdiskbynamecsvcret_bzero_strcmplmul_strcpyldiv_open_errno_close_readalmul__ctype__strcasecmp_atoi_strerror_strlen__iob_writevalmul.o 810719746 0 10 100751 134 ` 2&  @ppC`pL" almuldup.o 810719749 0 10 100751 91 `  )w   "_errnox_normx_error_dup err.o 810719723 0 10 100751 1790 ` w @e5ff $%ww  p  Nf % nf &  N ww | @e5ff %w\w X  Nf % N w"w  @e5f ww   Nf % f &  ww @e5f r ww *  Nf % w\w XP wBw >:  w !$$*/36>GQW\`ilsx|Rr" "$     ' -"3":"@"G"RN"rV berr.o~errevalfmtva_alistap~verrevalfmtapsverrno_putprog_putcolsp~errxevalfmtva_alistap~verrxevalfmtap~warnfmtva_alistap~vwarnfmtapsverrno~warnxfmtva_alistap~vwarnxfmtap~putprog~putcolsp_errcsv_verrcret_errno__iob_vfprintf_strerror_fputs_fputc_exit_errx_verrx_warn_vwarn_warnx_vwarnx___prognameexecle.o 810719749 0 10 100751 167 ` "( e& 6 ;ew9   #"+execle.o_errnox_normx_error_execle execve.o 810719749 0 10 100751 94 `  ;w   ""_errnox_normx_error_execveexecvp.o 810719723 0 10 100751 1206 ` ^ w Nef  ww  f 5k/f z@Nevf& %@ 6   xwp{v@ev5xt%t t@t @aAt AmpxNev^  %ч Nfev      w DCB̥:̋ ҕ/Ҕˋ ̋ w /bin/shPATH:/bin:/usr/binshiii ^!&.38@CvIvQtS[bjrux{}" " execvp.o_shell~execlpnameargv~execvpnameargvpathstrcpfnamenewargsietxtbsyeacces_execat~execats1s2sis_execlpcsv_execvpcret_getenv_index_errno_execv_sleepexecv.o 810719749 0 10 100751 162 ` 0 ;ewI9   " +"2execv.o_errnox_normx_error_environ_execvfabs.o 810719749 0 10 100751 58 `  E6" _fabsfchdir.o 810719750 0 10 100751 94 `  w   ""_errnox_normx_error_fchdirfchflags.o 810719750 0 10 100751 96 `  w   "$_errnox_normx_error_fchflagsfchmod.o 810719750 0 10 100751 94 `  |w   ""_errnox_normx_error_fchmodfchown.o 810719750 0 10 100751 94 `  {w   ""_errnox_normx_error_fchownfetchi.o 810719750 0 10 100751 94 `  w   ""_errnox_normx_error_fetchiffs.o 810719750 0 10 100751 85 `   " _ffs fgetc.o 810719751 0 10 100751 114 `   @ w "__iob__filbuf_fgetcfork.o 810719751 0 10 100751 127 ` ( w9   !"'fork.o_errnox_normx_error_fork fperr.o 810719751 0 10 100751 113 `  J   "!_errnox_normx_error_fperr freopen.o 810719740 0 10 100751 575 ` 0w DC+ 5  a  r5 w: w U5ff %̥a &  e 3     U̥r 33(9HX"    $ +_freopencsv_fclosecret_open_lseek frexp.o 810719751 0 10 100751 67 ` 6> " _frexp fstab.o 810719723 0 10 100751 1805 `  `w D̥: ̋̋ww  C Wp De` ˋˋ =K ˋˋ ww 4 %wj= @0 @0 :&fe "% &fe "%w  $' 77 ww  7 ww   * t5%%*wtw p p  N& wP w B B  N& w pw    N& w @/etc/fstabr  ( X h      *4'/1":"CIPTZ]thtsvy6T ""6  "T "+ 3">"Ifstab.o_fs_line_fs_file_fsskip~fsskipp_fsdigit~fsdigitbackpstringendvaluecp_fstabscan~fstabscanfscp~setfsent~endfsent~getfsentnfields~getfsspecnamefsp~getfsfilenamefsp~getfstypetypefscsvcret__ctype__fgets_setfsent_endfsent_fopen_fclose_getfsent_getfsspec_strcmp_getfsfile_getfstype fsync.o 810719752 0 10 100751 93 `  _w   "!_errnox_normx_error_fsync ftell.o 810719741 0 10 100751 367 `  w D  5 & & e5u A@w5 5 5@ 5`u`u (9"   _ftellcsv_lseekcret ftime.o 810719770 0 10 100751 275 ` Z(w D Nefe Lt ff etttw(9I"   " '_ftimecsv_gettimeofdayldivcret ftruncate.o 810719752 0 10 100751 97 `  w   "%_errnox_normx_error_ftruncate fwrite.o 810719741 0 10 100751 526 ` 0w DC AupB5 S  "̥ ;  & ӄ %;  7  & %bb& ӄ % ₎& %`@ @m A D&@w8  (8(8IY"   % *_fwritecsv__flsbuf_bcopyudivcretgetchar.o 810719741 0 10 100751 161 ` "(w  w )))9(H"    %_getcharcsv__iobcret__filbuf getegid.o 810719752 0 10 100751 91 `  0   "#_errnox_normx_error_getegid getgid.o 810719752 0 10 100751 90 `  /   ""_errnox_normx_error_getgidgetgrgid.o 810719724 0 10 100751 248 ` $Pw D 3! wYiy") - 7 A K Pgetgrgid.o~getgrgidgidp_getgrgidcsv_setgrent_getgrent_endgrentcretgetgrnam.o 810719724 0 10 100751 277 ` *Xw D   wYiy "* . 8 B J T Ygetgrnam.o~getgrnamnamep_getgrnamcsv_setgrent_getgrent_strcmp_endgrentcret getgroups.o 810719753 0 10 100751 97 `  Ow   "%_errnox_normx_error_getgroups gethostid.o 810719753 0 10 100751 93 `     "%_errnox_normx_error_gethostid getitimer.o 810719753 0 10 100751 97 `  Vw   "%_errnox_normx_error_getitimer getloadavg.o 810719724 0 10 100751 505 ` pw D & fefefe e w%  @a0uWtAm !%+46:? H"T X ` e mgetloadavg.o~getloadavgloadavgnelemloadinfoimibsize_freemem_getloadavgcsv_sysctlcretfltused getnbyaddr.o 810719733 0 10 100751 271 ` >8w D  3!,,  w)8I)Yi"  % 0 ; F K_getnetbyaddrcsv__net_stayopen_setnetent_getnetent_endnetentcret getnbyname.o 810719733 0 10 100751 323 ` P@w D   e    w)8HHY)iy"  % 0 8 C N S_getnetbynamecsv__net_stayopen_setnetent_strcmp_getnetent_endnetentcret getnent.o 810719733 0 10 100751 1041 `  RXw   7rl w]ww VP 7 H7 ww 6  7" m %5#f P  wf P  ̥ ̥ & P 5=  7w7 D ̥̋ ̥ %& P   ww D CKw ˋ 5 /etc/networksrr# )8H Y)x Y)8Y)Y " " ) 1 6"0A I"NT [ i__net_stayopen_setnetentcsv_fopen_rewindcret_endnetent_fclose_getnetent_fgets_inet_network getopt.o 810719772 0 10 100751 904 ` (@Xw $w- @m7 ȥ- > - 7%:f ( f / d  ?wH ̥:7 (8I"   %_fputscsv__flsbuf_fflushcret getpagesize.o 810719753 0 10 100751 95 `  @   "'_errnox_normx_error_getpagesize getpeername.o 810719753 0 10 100751 99 `  w   "'_errnox_normx_error_getpeername getpgrp.o 810719753 0 10 100751 91 `  Q   "#_errnox_normx_error_getpgrp getpname.o 810719733 0 10 100751 333 ` P@w D   e    w)8HHY)iy"  ) 6 > K X ]_getprotobynamecsv__proto_stayopen_setprotoent_strcmp_getprotoent_endprotoentcret getppid.o 810719754 0 10 100751 91 `     "#_errnox_normx_error_getppid getproto.o 810719734 0 10 100751 251 ` .8w D 3!  w)8I)Yi"  + 8 E R W_getprotobynumbercsv__proto_stayopen_setprotoent_getprotoent_endprotoentcret getpent.o 810719733 0 10 100751 1025 ` v"NXw ~ v 7jd w]ww NH 7 @7 ww . v 7 h %5#f F  wf F  ̥ ̥ & F 5=  77 D ̥̋ ̥ %& F   ww D CKw ˋ 5 /etc/protocolsrr# )8H Y)x Y)8Y)Y "" & - 5 :"0G O"N\ c i__proto_stayopen_setprotoentcsv_fopen_rewindcret_endprotoent_fclose_getprotoent_fgets_atoi getrlimit.o 810719754 0 10 100751 97 `  w   "%_errnox_normx_error_getrlimit gets.o 810719754 0 10 100751 273 ` h      SW ~#r`J    "__iob__filbuf_gets getsbyname.o 810719734 0 10 100751 372 ` f@w   f e  f  N&   w)8HYHH)iy"  ' 3 ; G S X_getservbynamecsv__serv_stayopen_setservent_strcmp_getservent_endserventcretgetsbyport.o 810719734 0 10 100751 300 ` B@w  t- N&   w)8IX)iy"  ' 3 ? G S X_getservbyportcsv__serv_stayopen_setservent_getservent_strcmp_endserventcretgetsent.o 810719734 0 10 100751 1080 ` $`w   7|v w]ww `Z 7 R7 ww @  7, r" %5#f Z  wf Z 5=  f Z N  7V7TX7H& Z  ̥̋ ̥ %v& Z   Pww D CKw ˋ 5 /etc/servicesrr# ,/ )8H Y)x Y)8Y)Y " $ + 3 8"0D L"NX _ e l__serv_stayopen_setserventcsv_fopen_rewindcret_endservent_fclose_getservent_fgets_atoi_htonsgetsockopt.o 810719754 0 10 100751 98 `  vw   "&_errnox_normx_error_getsockoptgetttynam.o 810719725 0 10 100751 278 ` (Xw f  wYiy!", 0 ; F N Y ^getttynam.o~getttynamttyt_getttynamcsv_setttyent_getttyent_strcmp_endttyentcretgetuid.o 810719755 0 10 100751 90 `     ""_errnox_normx_error_getuidgetusershell.o 810719725 0 10 100751 1300 ` l(w h Z7^ZeP@ww b\ 7 T RL 7 D7 ww 7 ww 4  7   7  2Ne & %N 7A r& 7,   7 l+˥/ˋ ˥#˥#ˋ˥#ˋ  %   ,wt|/bin/sh/bin/csh/etc/shellsr  88  88Xhx8l%.r8FJjV*dZrj~" "* "Z getusershell.o_okshells_shells_strings_curshell~getusershellret_initshells~endusershell~setusershell~initshellsspcpfpstatb_getusershellcsvcret_endusershell_free_setusershell_fopen_fstat_malloc_calloc_fclose__ctype__fgetsgetw.o 810719741 0 10 100751 395 ` (w D Bew     5@w DBe@w     5A@)8)8"   "H#_getwcsvcret__filbuf_getlw getwd.o 810719725 0 10 100751 1723 ` zw x@e5@e57 R=Ne  f wuuf eNefe pNef u-$u- N _p_N 5N >}-(N 5N VNef Nefe u-u-N Nfe  n  5u-u-uu%f eNe 5_)_:Nf @_Fw % m  %@v/bin/shsh-c (8HYhhyhhhh y) !&*/37H?CHNTX"_ c r z "H popen.o_pids~popenprogramtypeioppdesfdspid~pcloseiopfdesomaskpstatpid_popencsv_getdtablesize_malloc_bzero_pipe_vfork_closecret__iob_dup2_execl__exit_fdopen_pclose_fclose_sigblock_waitpid_errno_sigsetmaskdup2.o 810719749 0 10 100751 92 `  Zw   " _errnox_normx_error_dup2pipe.o 810719758 0 10 100751 143 ` (*J w9   !"'pipe.o_errnox_normx_error_pipe profil.o 810719758 0 10 100751 90 `  ,   ""_errnox_normx_error_profilpsignal.o 810719727 0 10 100751 459 ` r`w r% @ N f % % & % %wUnknown signal: y!"* . ; C J Opsignal.o~psignalsigscn_psignalcsv_sys_siglist_strlen_writecret ptrace.o 810719759 0 10 100751 141 ` 07 w)I    ! )"1ptrace.oerror_errnox_normx_error_ptrace putchar.o 810719741 0 10 100751 289 ` b(w D ? 5 - ?%  &  &E w))))))))()(8I"   %_putcharcsv__iob__flsbufcret puts.o 810719743 0 10 100751 486 ` (w D* R ?E G  -?%  & ߶  ݀5 E - ?~%  p & d wL5Z  )))))))))()8))())))()8I)("    "_putscsv__iob__flsbufcretputw.o 810719741 0 10 100751 603 ` (w DCe!%  -#<%   &  5  w ׀5E&w |DCe!%  -#<%   &  5  w ׀5E&(9(9"   "#_putwcsv__flsbufcret_putlw quota.o 810719759 0 10 100751 93 `  w   "!_errnox_normx_error_quota rand.o 810719771 0 10 100751 243 ` J(w wB7 <ww mNA*$ ee90@ w7vE@w)I)"  " _srandcsvcret_randlmul random.o 810719727 0 10 100751 3000 ` (8w p wp !mNAtmf& ee90@ f&tm -tm7  : Wp !w Xpe jb`T P vWpmDf< % # 0 w7 7 7 -%@% %?@e7tm7N ~|p l vWpm`fX w , D && eC && eBe5   vWpmf  6 x& 7 7e7 tm7m 7rWtmzwrvtmj7n@wBx w . DmNA4f& ee90@ Er 5u0r`J `vE5ue-e e-A@w|?192$f1]B; ߵoH@Itk屾\YeT.h=yC-kg*.i]sO5֏oQnakA6?"Ƙ¤*{׭ "'GXXXXXinitstate: not enough state (%d bytes) with which to do jack; ignored. setstate: state info has been munged; not changed. (8Yi(8 %+18C M"W$`ikmoz" "" "  random.o_degrees_seps_randtbl_fptr_rptr_state_rand_type_rand_deg_rand_sep_end_ptr~srandomxij~initstateseedarg_statenostate~setstatearg_statenew_statetyperearostate~randomi_srandomcsvcretlmul_random_initstate__iob_fprintf_setstatelremldivrcmd.o 810719736 0 10 100751 5456 ` Bpw R 5N 5N w}& %5u?" GNf %@5fe@& %u fef e _N %02 Ne 5% < ff %%= %N @ <ff %I %w A1`@fe@& %ff l%a %N Rof %5 N ff %N f f %N f f %fef %%_:N N N _Ne 5 f Npfe %Ne &fe R &fef >e%s Nfe  C r vf&A r t@aUU C r vf&A r t@aUU7  & & fe e%  C r vf&A r t@a&50 V  fefef e5N  5 _P}N 5%%%_ _Bfef %%_Bfe % _Bff v%@_6w h5 5   %5+N 5fef % %0 %N  @N ww |DCe%@5̥.e ̋    5 Nff fef le N QN %G B A5 N 5|8fe|  fe| ! fe| 5Ne~@ &   @|p-5N ww BN@fe % YDe̥ ̥ ̋e  ̥ ̥ ̥  ̥ ̥ 5̥ ̥ ̥ ̋ 5 N fef D% NNf  ww % Nf _WNff % KNf @@mȋ= : x+A$ %^)7.$ 7D >: e ̋@@m   wsocket: All ports in use rcmd: socketconnect to address %s: Trying %s... %dwrite: setting up stderrselect: setting up stderrselect: protocol failure in circuit setup. acceptsocket: protocol failure in circuit setup. /etc/hosts.equivr/.rhostsr)8HYix )x)x8H8H8H8XhxHI9xxX8 Y(HHXhx(HYYY"   % - 2 < B K R Y b i p"{ #"  '"l3 ; E M U \ c k t  _rcmdcsv_getpid_gethostbyname_herrorcret_sigblock__iob_fprintf_fcntl_bcopy_connect_close_errno_rresvport_perror_sigsetmask_sleep_inet_ntoa_write_strlen_read_listen_sprintf_bzero_select_accept_ntohs_socket_htons_bind__check_rhosts_file_ruserok__ctype__fopen__validuser_fclose_getpwnam_strcpy_strcat_fstat_fgets_strcmp_strncmp_gethostname_indexbind.o 810719747 0 10 100751 92 `  hw   " _errnox_normx_error_bindgetpwent.o 810719724 0 10 100751 4184 ` ZnRhw     L  w  5 ff L% 50  8 w   uN 5&f %5w\ 5  f   0   w  p  @e5ff l%5w 5  w-   4 w ZT  J &  %74w\j v5f 7 w " ww  t  www  7    7 ww www  | v@ E w\ 5% %D %    7& 7&  7&  7& 7&  7w&  7w& 7& 7r& 7d_fw x8  wb  7    55 ff e55 D& %e& %e& %e|vp& %e7\w l d _V __5 & f %5= 5u fff e5 #u 1f %50 :=N w^/etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwd(Xh(x((8HXi8xxxx((+Z7EO\Y_imrd|Bdd4B $&(/59<>@"J N S"d] e m"w"   ""  "4          & - 6 < C I Pgetpwent.o__pw_db__pw_fp__pw_passwd__pw_rewind__pw_stayopen__pw_flag__pw_file_line~getpwentkeyrval_start_pw_fetch_pw_scanpw_getpw~getpwnamnamrvalkey~getpwuiduidrvalkey~start_pwp~setpwent~setpassentstayopen~endpwent~setpwfilefile~scanpwcpch~fetch_pwkeypt~getpwpwbufposfdnp_getpwentcsvcret_getpwnam_strlen_strcmp_endpwent_getpwuid_rewind_dbm_open_fopen_setpwent_setpassent_dbm_close_fclose_setpwfile__filbuf_fgets_index_strsep_atoi_atol_flock_dbm_firstkey_dbm_nextkey_dbm_fetch_bcopy_geteuid_open_lseek_read_closeatoi.o 810719721 0 10 100751 306 ` ^@w D      + - ̥9 Wp @@`e̥0  wiy " ! &atoi.o~atoipnf_atoicsvcretatol.o 810719721 0 10 100751 443 ` Hw D5 5      + -! ̥9 f& ff eee@ ee@ 5u̥0 A@  wnA@iy " ! & +atol.o~atolpnf_atolcsvlmulcret flock.o 810719751 0 10 100751 93 `  w   "!_errnox_normx_error_flock geteuid.o 810719752 0 10 100751 91 `     "#_errnox_normx_error_geteuid herror.o 810719736 0 10 100751 705 ` @w De LN 4ee-b   4e Be v Nfe %wjError 0Unknown hostHost name lookup failureUnknown server errorNo address associated with name: Unknown error 9HYYHhy##" # + 4 < A_h_errlist_h_nerr_herrorcsv_strlen_h_errno_writevcret inet_ntoa.o 810719732 0 10 100751 249 ` H  w DeEE&E&E&HT e Tw%d.%d.%d.%d(9"   !_inet_ntoacsv_sprintfcret readlink.o 810719759 0 10 100751 96 `  :w   "$_errnox_normx_error_readlinkreadv.o 810719760 0 10 100751 93 `  xw   "!_errnox_normx_error_readv reboot.o 810719760 0 10 100751 94 `  7w   ""_errnox_normx_error_rebootrecvfrom.o 810719760 0 10 100751 96 `  }w   "$_errnox_normx_error_recvfromrecvmsg.o 810719760 0 10 100751 95 `  qw   "#_errnox_normx_error_recvmsg regex.o 810719727 0 10 100751 3110 ` F&Xw D5 5 @e5 ̋ʋ <@e@-75 ҕ  w̥^7# [3 \_rҕҐ .ҕ *  %D%* $̋ҕ ҕ%^ 75 %-!%]ҕ-   %75 Ґ %%]@p%(% 7\5 _`} ҕR %)@e@-7"5 _`ҕ R_%1_%:_ҕe_w D   0  0  % &  &  5 @wœ ԋ ˥&  5ԋw |DC 9 xH wTԋ̋& % ` & %  0 05 f @ A @`5 @ A @5Dmf  &  5@DԋԢ  & % ` &  5 _w DC Ҥ  w w D  wT@~ n:Regular expression too longNo previous regular expressionunmatched \(missing ]too many \(\) pairsunmatched \)iyiyiyiyiy (/8;=@GNU]fFpy|" """regex.o_expbuf_braslist_braelist_circf~re_compspcepcclcntnumbralastepbracketbracketpretoolong~re_execp1p2crv_advance~advancelpepcurlpctirv~backrefilpbp~cclasssetcafn_re_compcsvcret_re_exec_cclass_backrefremque.o 810719760 0 10 100751 72 ` H1" _remquerename.o 810719761 0 10 100751 94 `  w   ""_errnox_normx_error_renameres_debug.o 810719736 0 10 100751 1662 ` rdXw ww ww ww ww @ r yqwsv|    *N %    *    *   *     w @   %w (09BIQSUWY\_beh$QUERYIQUERYCQUERYMCQUERYU45678UPDATEAUPDATEDUPDATEDAUPDATEMUPDATEMAZONEINITZONEREFNOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSED67891011121314NOCHANGEANSCNAMESOAMBMGMXMRNULLWKSPTRHINFOMINFOAXFRMAILBMAILAANYUINFOUIDGID%dINANY%d9I9I9I9I9I9I#r#$"- 1 6"@"J"P" X a":j__res_opcodes__res_resultcodes_p_querycsvcret_fp_query_p_cdname_p_rr_p_type_sprintf_p_classres_query.o 810719737 0 10 100751 2294 ` $w E  %wfe& & & fff& e5 @N f ffe e5u AA v5@ AA vE@  x&w E  %w7 D5 ̥. ̋ N N f ff& e .753<.7 tN f fff e 5%=H@%8%0 0E e  N f ff& f e w @e5 &N 5@@mȥ.%Nfef %@@m0uNffe e Nf f ff ewLw HD 5 f 5_d ;Ce ˋˋ= fe ( ˋ, ʋ 7i %N w5Nfe % N %.*s.%.*sHOSTALIASESr)9IYh x )9IY 98  9)Y)(8((HXYhX  "  " , 1 > H O"[ b"m"~ _h_errno_res_querycsv__res_res_initcret_res_mkquery_res_send_ntohs_res_search_errno_hostalias_res_querydomain_strlen_bcopy_sprintf_getenv_fopen__ctype__strcasecmp_strncpy_fclose_fgetsres_mkquery.o 810719736 0 10 100751 1760 `  `w D *& @EtEx4PE vEE CtP vEEWtEtP vEEWtEtPxE  EtE@4PPE  EE4PE4 4 4 4 Ce @e5}e= e@e550 -*.f "5  %w<ffe e@e5@ p xNfeff é`f ef e 4 > ; Nfeff e` ef e& %e& e 4 @_^@e @-_Zf ef e& %ef e  Nf %Cm 4%s.%s))8)))H)Yi)(x888"   " ) 3 8 A J T ] d_res_mkquerycsv__res_htons_index_res_initcret_sprintf_dn_comp_putshort_putlong_bcopyres_comp.o 810719736 0 10 100751 2293 ` Xw 5 C D@m 5YE?B ; 5%.` @-.ӕ\SD-': @ 5Et E@P@mD- D- e@@@-"C- C-ӕ.`@- 5`  @5@ww CD@m5 @ e 5u e u5 _. @-@tUA r@@wt Nf f ve5Ӏ @ e@-=e= 5 %. %\ D- @ 5   %?} D-w Dw`D- E?  @w B(@E? )wd ̥\ Ԥ 5ˋ@@%.eB- ݃D @Et @PCm 5̋w D t Pww D 55 @v5u  5PuPA@v5u  5PuPA@v5u ӁPw^w ZDC3 v@ w>w :Dtfe "%@4fe %@4A@ @ w))))))))"  "!"<."9"*C"M"V \ a_dn_expandcsvcret_dn_comp_dn_skipname__getshort__getlong_putshort_putlongualshulsh res_send.o 810719737 0 10 100751 2681 ` w >5 5 uu<5  %w5% 5u#5  _d5 M  %7 'f -d    _v _l=@te & %  N 5@e5uufeN %Ae@ uNf$ %5a5 uN 5@- u uNf %5a5   &@S@@ 5%@fev %5 E W _Z _Z@_8 6   %7 %-x( @te & % _ ff e@-_@te && ff e @-_At 7r5   5 5 fe B r f vf&* r t@aUUNe& & fe e_ %P  %5 _ f f e5__}-5 _>AA v5_>b X 5_@ 6_\<_4w_4w |% wb)9I))Xi)xi(ix)X))(()))))x)xiixI"   " ' / 6 = F M U [ b h p w  "_res_sendcsv__res_res_initcret_socket_errno_close_connect_htons_writev_read_ntohs_send_sendto_bzero_select_recv__res_close recv.o 810719760 0 10 100751 92 `  fw   " _errnox_normx_error_recvres_init.o 810719736 0 10 100751 2207 ` 4xw 5 7 27 0$5 77@x _X_fe % #Ce  ˥ ˥ ˋmp %7 p Z X fe % L%HCe  ˥ ˥ ˋ: f&@tBD@t B ,D@t0 B0 D@t>5 AWt1@ %fe % _J%w fe .fe  p  p %ppp5 ˥. ˋp .   %%vU w/etc/resolv.confrdomaindomaindomainnameservernameservernameserverLOCALDOMAIN)8HXhxX8xhx#4 "   & / 8 ? J Q Y f n v {__res_res_initcsv_htons_fopen_strncmp_strncpy_index_inet_addr_fgets_fclose_gethostname_strcpy_getenvcret gethostname.o 810719753 0 10 100751 99 `  Ww   "'_errnox_normx_error_gethostname rexec.o 810719737 0 10 100751 1894 ` 8w JN 5 N %w}Ne fef %  %5 @5ufe@& %fef % %=H% N N N  f %5 _  %5N f Nefef % % N N N 5fe %Ne fef % fefef e5N  5 }N ff %N f f %N f f %fef %%N _dfef %%_dfe % _d@_2%s: unknown host rexec: socketgetsockname%uaccept)8HXix(8HXHHHhh "  , 2 ; @ K S [ b k r y _rexecoptions_rexeccsv_gethostbyname__iob_fprintfcret_ruserpass_socket_perror_bcopy_connect_errno_close_sleep_write_listen_getsockname_ntohs_sprintf_strlen_accept_readaccept.o 810719745 0 10 100751 94 `  cw   ""_errnox_normx_error_acceptgetsockname.o 810719754 0 10 100751 99 `  w   "'_errnox_normx_error_getsockname htons.o 810719755 0 10 100751 66 ` " "_htons_ntohslisten.o 810719757 0 10 100751 94 `  jw   ""_errnox_normx_error_listenrmdir.o 810719761 0 10 100751 93 `  w   "!_errnox_normx_error_rmdir ruserpass.o 810719738 0 10 100751 9464 `  w Nff %   Nff % @ 5 =NfJ % f %  @ȥ } f  f   NfY % l =ww N LG,& 5>   =N&f % N&f %  N  N&  =@&& v %w^w ZV'm % = efe %  w e  w 8 5Nfe %fe 7%_Ne _ 6 25_   % bf _ x m b  =bf Xbf ONen & 5?   l ) &b  =bf @% @ b % 5 wdw ` 5 wJ % % % %, | v @ E5%%b%"\ D > @ E* 5%a%"^%\  @ E 5} % >% :% 6%,2%\  @ E 5} | @ Eh 5%=T _ bf @_e  _w =N  @w 4 %  t  %  V f -f w 4=Nfe 1u $u=Nef  fe Nef @ 5@ww N    4  %0N    b  *wZw VN    4  %0NJ  J b J Rww   @a %F  @aA BtEH % u%@ww  5 t@m`5 %t % 4whw d  @a %F 2ZAu9Au.Au @aA BtEH % u%@ww  5 WpAm`A@5 %.A`u9A`uZA`ut % 4wTw P  @m4 @m4 %   5  %w  5  %w  Wp0`@ p"Wp0`@p: % %ww  2 @m3" %@5 @5u Bb %  AWp0`A"@AA@x3 %0 WpDtWt@`Wt@`Wt@` @`@`Wt@`*utE4tE4 E4E4 % "*A@x3B %  b" %  %_  Ĝ"B"3B %  @`r H! %@w.w * _ _ )9/ 5N, e%,Ne N wN w DC ` ww n _ _     fe Ne  w&ʋS&*&(;fe eNefe P Beʋ w =@ v  ?  N&f L%ww =@ v  O  N&f %wBrz  XXttXX    :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  Name (%s:%s): Password (%s:%s): MACHdefaultloginpasswordnotifywriteyesynoncommandforcemachineHOME.%s/.netrcrError - .netrc file not correct mode. Remove password or correct mode. Unknown .netrc option %s $/etc/utmpr%ldCan't make key Can't make key )8HXhxHXh888)8HXix8XX8XXIXX"   % - 3 ; A G N W \ e n w  "v  ". _ruserpasscsv_getlogin_malloc_printf__iob_fflush_read_exit_index_getpasscret__ctype__strncpy_strncmp_strlen_strcpy_mkpwclear_environ_getenv_sprintf_fopen_errno_perror_strcmp_fstat_fprintf_fclose__filbuf_strcat_fread_isatty_ttyname_mkpwunclearfread.o 810719740 0 10 100751 389 ` 0w DC AupB 4  & %b 5% 傎& %`@ @m A &@w|  (8(IY"    $ )_freadcsv_bcopy__filbufudivcret getlogin.o 810719724 0 10 100751 500 ` z ,xw  3 z  Wp,f&  e, %%,  . 5ҥ "w/etc/utmpz%(+."8 < E K R X _ dgetlogin.o_UTMP_ubuf~getloginmeufcp_getlogincsv_ttyslot_open_lseek_read_closecretgetpass.o 810719724 0 10 100751 1068 ` V w _V %& 5 f  5Net@@ & euENe t@ & eNa % fA@ E %nԐ N % % d  uNe t@ & eN %N fw/dev/ttyr%s (8H(8Xi#)+-0f59"B F L T Z b j q z getpass.o~getpasspromptttybflagspcfipbufsig_getpasscsv_open_fdopen__iob_setbuf_signal_ioctl_fprintf_fflush__filbuf_fclosecretfdopen.o 810719739 0 10 100751 409 ` 0w D  7z -p  s 3  33 a r w w+& f e)9IX"   ) . 5_fdopencsv_getdtablesize__findiopcret_lseek printf.o 810719741 0 10 100751 180 ` ,(w  fef %5 w (8)I"    $_printfcsv__iob__doprntcretscandir.o 810719727 0 10 100751 1209 ` nw >N 5Nef  ff eu@  w5 Y   Qe E  33e5e5@ A H u-Nef  ff eu@  @ `N N  N f e@w Nefe w9HXixxXi9(/ 579?FJNRZ_Pjmp"y } "P scandir.o~scandirdirnamenamelistselectdcompdpnamesnitemscp1cp2stbarrayszdirp~alphasortd1d2_scandircsv_opendir_fstatldiv_malloccret_realloc_readdir_closedir_qsort_alphasort_strcmp qsort.o 810719727 0 10 100751 1864 ` w %Vww t7WpwAwpAmu% Nf " @ml5uBmTB-"C-Dm>5TD-um@5@- w@ ӁNf mu-Bm B-т̒C-Lw @@5@  vwp|AmDu-r6B \@H5 : N C! 5ԒS DCUC-f m5D-/+D-!Cm@5&@5%3-f " 5u0B55`\5R DD-N& 4m,-(N& " -_6w8   (/46; BDFHKNRV"["`eikmoruy}" qsort.o_qcmp_qsz_thresh_mthresh~qsortbasensizecomparcijlohiminmax_qst~qstbasemaxcijjjiimidtmplohi_qsortcsvcretudivscanf.o 810719742 0 10 100751 383 ` 8w Nef %ww Neff %ww D A555  ԋuNeffe %w~(8I8I8I"    #"+"83_scanfcsv__iob__doscancret_fscanf_sscanf doscan.o 810719739 0 10 100751 4138 ` &@w DC 5 5 _B%%_d5 %*e5  AWp `eu 0u%l5  %h%[ e  _Neffff e   * O  A@ EN 5% % % %Nf &    %_ A@ E%Nf @wdN 5 w NN%c%s%[Nf ff f& ew5 5 5 5 %e%f %o%xDe5 5 A @ EN % % % %- Ԑ A @ EN  _%+_  _%a%f %A_%F_ % A@vN O% A@v@mAm@ vA@v5u0 %a%fW7 5`u`u C% S P Ԑ A @ E =%%.%e%E- *% ' $ ! Ԑ A @ EN %+%-%0%9 A@  5u% N  =   @e! @e! _@t@]   xNe A _Ne A @H@pHw DC = 5%c%0u5 %s    %r%c5 %[r      %%   =  D- %cw w D ̥^   % %]%-+  $%-̥]4   ̠   %]  wX((8HHY8Y888((8Hhh88HYY"   # + 0 6 >__doscancsv__ctype___filbuf_ungetccret_atoffltusedatof.o 810719746 0 10 100751 1031 ` 0w D*\5% %-%+ 5 55 55  B5eA5 %.55  B5eA5  %E%e$%+%-  Wp B`e  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& e5 55w2(((8I"    # +_atofcsv__ctype__ldexpcretfltused ldexp.o 810719756 0 10 100751 138 ` $6 m 7 "   "_errno_ldexpseekdir.o 810719727 0 10 100751 497 ` pw D 5u@-A-/A@E5u@E55  ff& e4 4 5- 5- 5wx ',36"? C L S \ aseekdir.o~seekdirdirploccurlocbaseoffsetdp_seekdircsv_telldir_lseek_readdircret select.o 810719761 0 10 100751 94 `  ]w   ""_errnox_normx_error_selectsendmsg.o 810719762 0 10 100751 95 `  rw   "#_errnox_normx_error_sendmsg sendto.o 810719762 0 10 100751 94 `  w   ""_errnox_normx_error_sendtosetbuf.o 810719742 0 10 100751 219 ` H w D 3 EtU4 4 w(9"   _setbufcsv_freecret setbuffer.o 810719742 0 10 100751 410 ` 8w D 3 EtU4 4t ww D   & & % 5 f& %Uwt(9Xh9"   "H* 2 :_setbuffercsv_freecret_setlinebuf_fflush_mallocsetegid.o 810719728 0 10 100751 172 ` 8w N wIXi"% ) 3 8setegid.o~setegidegid_setegidcsv_setregidcretsetenv.o 810719728 0 10 100751 1109 ` hw DC˥=  5Ne&   w @-KҔ5 e  @e | 7r@e  5@ f> %w2@ m(0 u ʋʥ=@me A m @ m ʥ=ҕ=Ҕw Nef  D m ew (9IIXIhIxIIhII (I9  (h02:AEG6QVX_"g k s } "6setenv.o~setenvnamevaluerewriteallocedCl_valueoffsetcntP~unsetenvnamePoffset_setenvcsv_strlen__findenvcret_environ_realloc_malloc_bcopy_unsetenv seteuid.o 810719728 0 10 100751 172 ` 8w N wIXi"% ) 3 8seteuid.o~seteuideuid_seteuidcsv_setreuidcretsetgid.o 810719728 0 10 100751 168 ` 8w Nf wIXi "! % / 4setgid.o~setgidgid_setgidcsv_setregidcretsetgroups.o 810719762 0 10 100751 97 `  Pw   "%_errnox_normx_error_setgroups sethostid.o 810719762 0 10 100751 97 `  w   "%_errnox_normx_error_sethostid sethostname.o 810719762 0 10 100751 99 `  Xw   "'_errnox_normx_error_sethostname setjmp.o 810719762 0 10 100751 374 ` j@&& e& & %ReR$ @  1   )IYi   "' 0 ; I"DR_sigstack_sigblock__ovno_setjmprollback_sigreturn_longjmperror_longjmprollback.o 810719761 0 10 100751 123 `  @! @#E B E  "_longjmperrorrollback setjmperr.o 810719763 0 10 100751 194 `  w  %wlongjmp botch longjmp botch (9"   "_longjmperrorcsv_writecretsetpgrp.o 810719763 0 10 100751 95 `  Rw   "#_errnox_normx_error_setpgrp setpriority.o 810719763 0 10 100751 99 `  `w   "'_errnox_normx_error_setpriority setquota.o 810719763 0 10 100751 96 `  w   "$_errnox_normx_error_setquotasetrgid.o 810719728 0 10 100751 172 ` 8w f wIXi"% ) 3 8setrgid.o~setrgidrgid_setrgidcsv_setregidcretsetregid.o 810719763 0 10 100751 96 `  w   "$_errnox_normx_error_setregidsetrlimit.o 810719764 0 10 100751 97 `  w   "%_errnox_normx_error_setrlimit setruid.o 810719728 0 10 100751 172 ` 8w f wIXi"% ) 3 8setruid.o~setruidruid_setruidcsv_setreuidcretsetsockopt.o 810719764 0 10 100751 98 `  iw   "&_errnox_normx_error_setsockoptsettimeofday.o 810719764 0 10 100751 100 `  zw   "(_errnox_normx_error_settimeofdaysetuid.o 810719728 0 10 100751 168 ` 8w Nf wIXi "! % / 4setuid.o~setuiduid_setuidcsv_setreuidcretsetreuid.o 810719763 0 10 100751 96 `  ~w   "$_errnox_normx_error_setreuidshutdown.o 810719764 0 10 100751 96 `  w   "$_errnox_normx_error_shutdownsibuf.o 810719742 0 10 100751 36 `   __sibufsiginterrupt.o 810719729 0 10 100751 328 ` LPw Ne& f %5w UE fef %y!%*-1"? C K Psiginterrupt.o~siginterruptsigflagsvret_siginterruptcsv_sigveccretsiglist.o 810719728 0 10 100751 1159 ` &@IPZ_s*2<I]rSignal 0HangupInterruptQuitIllegal instructionTrace/BPT trapIOT trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionStopped (signal)StoppedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesSignal 29User defined signal 1User defined signal 2#siglist.o_sys_siglist sigstack.o 810719765 0 10 100751 96 `  pw   "$_errnox_normx_error_sigstacksleep.o 810719729 0 10 100751 1118 ` w 4De _h t4 t t4 4t Ne&& % _ht 4     6t-t- t-t- t- t- 55 eAePPPP 5 5  55 Nefe % & %5u7 j && % Z fe %ff % fe& %wA@E f& w zwp )9) %).26;CK"R V a i s  sleep.o_ringring~sleepnomaskitvoitvitpvecovec_sleepx~sleepx_sleepcsv_setitimer_sigvec_sigblock_sigsetmaskcret_sigpausesobuf.o 810719742 0 10 100751 36 `   __sobufsocketpair.o 810719765 0 10 100751 98 `  w   "&_errnox_normx_error_socketpairstrcasecmp.o 810719729 0 10 100751 1017 ` xw DC``Hԋ w``A@w DCB  @mAmHԋ  @mAmA@w|  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&),/6<?BDG"S W \"6istrcasecmp.o_charmap~strcasecmps1s2cm~strncasecmps1s2ncm_strcasecmpcsvcret_strncasecmp strcatn.o 810719773 0 10 100751 154 ` .w DCB 5ԋ Ԕ $@w)"  _strcatncsvcretstrchr.o 810719773 0 10 100751 117 ` w DLwԋ )"  _strchrcsvcret strcmpn.o 810719773 0 10 100751 154 ` .w DCB ԋ  @w)"  _strcmpncsvcretstrcpyn.o 810719773 0 10 100751 170 ` 6w DC 5 Ԕ B- B-@w)"  _strcpyncsvcretstrcspn.o 810719774 0 10 100751 198 ` Dw DC @@- w 5)"  _strcspncsvcretstrdup.o 810719731 0 10 100751 306 ` @Xw N 5 5 wNff %@ix ""* . 6 > C Jstrdup.o~strdupstrlencopy_strdupcsv_strlen_malloccret_bcopystrncat.o 810719766 0 10 100751 113 ` & ы ~ " _strncat strpbrk.o 810719774 0 10 100751 170 ` 6w DC @-w ʋ 5 )"  _strpbrkcsvcretstrrchr.o 810719775 0 10 100751 118 ` w D Lԋw)"  _strrchrcsvcretstrsep.o 810719731 0 10 100751 370 ` ``w DC H w5 74@  55@- 7 5! #%(`-1"9 = Bstrsep.o~strsepsdelimspanpcsclasttok_strsepcsvcretstrspn.o 810719775 0 10 100751 197 ` Dw DC @@- w 5)"  _strspncsvcret strtok.o 810719775 0 10 100751 317 ` w DC h / 7 X555  5  55@- 47@w)"  _strtokcsvcret strtol.o 810719775 0 10 100751 659 ` (w DC %5 ̥+̥- %$ ! ̥0 ̥X̥x % ̥0 ̥X̥x 5 5 %0e e  ff 4eee@ 5u % = A@  wA@(((9(I"    #_strtolcsv__ctype_lmulcret stty.o 810719771 0 10 100751 138 `  w N tf ew(9"   _sttycsv_ioctlcretswab.o 810719729 0 10 100751 443 ` Hw DCB 5S 5t05S5S5S5S5S5S5S5S ΀wfy  "& * /swab.o~swabfromtontemp_swabcsvcret symlink.o 810719766 0 10 100751 95 `  9w   "#_errnox_normx_error_symlink sync.o 810719767 0 10 100751 88 `  $   " _errnox_normx_error_syncsyslog.o 810719730 0 10 100751 3380 `  l0w @e5ff $%ww D5 N*# %EAEt =_5]Ne NBfej %CaejNe GAej@ e`5 2 *"  Q %`5  T %` ӕ:ӕ Bej%_,mo N Y %` 5 Nfej %`Aej@55 v*@e`5^}^f@ej@A^1e^\^@^fe` %  U %Nfej %@-`R ffej e O5K 5h%D 4 ^ %5kfej e>fej  NAej@f %N   & fh %%%ww D ww 57%<Tn| %5,  %7%  77%'z %%nzZ %%J @w(w $, "7ww D 7w/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/log)8HXxx(8  x!)2:GPYaeiru$~jjh`^z " "$$ ) 0 6 ? J T ` h r | "             ""syslog.o_LogFile_connected_ToFile_LogStat_LogTag_LogFacility_LogMask_logfile~syslogprifmtva_alistap~vsyslogprifmtapcntchptnowfdsaved_errnostdptbuffmt_cpypidiovv_SyslogAddr~openlogidentlogstatlogfac~closelog~setlogmaskpmaskomask_syslogcsv_vsyslogcret_errno_time_sprintf_localtime_strftime___progname_getpid_strerror_vsprintf_writev_openlog_write_send_vfork_open_strcat_index_close__exit_waitpid_strncpy_socket_fcntl_connect_closelog_setlogmaskconnect.o 810719748 0 10 100751 95 `  bw   "#_errnox_normx_error_connect ctime.o 810719722 0 10 100751 5627 ` xw N J ww D el&&&&Wpef WpefZ eww 5 5  AaAE f&A@vUU5u %wPw LD w2̥/ 55 &f  e %Nfe fe fe ԥ.̋De &  & %fe0 % %,@e05e hwNe$ hw Ne( hw%r_ _% _%2_WpfWpeme, _@e\5 N hf&te -t @ E3 -X *te5.N hf&@.e@.A Ep@.A Ep - sV -3V _ - t- _ -V77te5  eV7 -r _@eV7w Nefe wl7 .AWp@7b \ 7 ^  f V V7V7P w &7 7 $ 7 " 7 " V V7$7ww x  ̋    2  ww  4  @55 X w-Vw-N  t  -0  t5, 5, - ܓue&&fe Xe3 eVp"eV3ww & f eww Q@f& e5uQ@f& xe5uumumu _eeQu  %QQ eu % ff et ff e5u< ff et< ff eL A@e@ f& et e  =  r  rd > r 8 8 rd ( AV 5 8u 4  AV f&A@ 5u r  r   AV @mAm@ 5u e4 tWpe&u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttwSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecz~mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT ((8HXhx &09@CNhXhbhoqy0.ppJ$(&5VC<LRY]bfhnqt"{ "J"  #"         " "< "  ctime.o~ctimet~asctimetimeptrwday_namemon_nameresult_s_tz_is_set_detzcode~detzcodecodepresulti_tzload~tzloadnameifidpdoaccessfullnameptzhpbufttispttisp_tzsetkernel~tzsetkerneltvtz_tzsetgmt~tzsetgmt~tzsetname~localtimetimepttisptmpit~gmtimeclocktmp_mon_lengths_year_lengths~offtimeclockoffsettmpdaysremyyleapiptm_ctimecsv_localtime_asctimecret_sprintf_tzname_strlen_strcpy_strcat_access_open_read_close_gettimeofday_tztab_tzset_getenv_offtime_gmtimeldivlrem access.o 810719746 0 10 100751 94 `  !w   ""_errnox_normx_error_accessfcntl.o 810719750 0 10 100751 93 `  \w   "!_errnox_normx_error_fcntl perror.o 810719726 0 10 100751 710 ` w De LN 4ee  4e Be v Nfe %wzw v-r@ w`N %: Unknown error: %d !#-4 ;"C G O"Y a f p } perror.o_ebuf~perrorsiovv~strerrorerrnum_errno_perrorcsv_strlen_strerror_writevcret_sys_nerr_sys_errlist_sprintferrlst.o 810719723 0 10 100751 3988 ` 0BR^p3Gfu.Lk ,Jz5Ok#0DXkz.AZ|RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator ##$errlst.o_sys_errlist_sys_nerrsend.o 810719761 0 10 100751 92 `  ew   " _errnox_normx_error_sendsocket.o 810719765 0 10 100751 94 `  aw   ""_errnox_normx_error_socketstrftime.o 810719729 0 10 100751 4290 ` X.w w~@7t% ?h@^wN f >w DC_̥%_ 5 r y~ _ 9% 5afe &X %5@e5 5XN . _ 5fN . _ w' >_< >_N >_  % _0 % _0 r  r f % _0 % _  % _  r  r f % __0 % __\ . ___ >__0 % __q >__z . __0e r& % __0e  @ r& % __0 % __| >__ _ . __ _t _z _ _% _b_fe &f %5@e5_ _ _ _ _ _ _ _ _: _ _0 el rdf % __ _P _0 % __ _l _z _W . __ _H _ h_r _b _  Y% _&Y_* _ G0 % H_ _l _. -e >2_ ! 0 el % _ _ _8 _  _?  ̋_R_w 4A r e0@ A r 5   % @  L %  .ww D w F @ <?8 VN*VSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%yXf"&02:A C>I>OVX[^c.ipwy." strftime.o_Afmt_Bfmt_gsize_pt~strftimesmaxsizeformatt__fmt~_fmtformattchcpjunk__add__conv~_convndigitspadbufp~_addstr_strftimecsvcret_bcopysystem.o 810719730 0 10 100751 851 ` w w&  %5u  - xff %5 EU@ff % f e  5 5 fe& %ff (%N N %Bf/bin/shsh-c #'-5>"F J O Y ` l s z system.o~systemcommandpstatpidomaskintsavequitsave_systemcsvcret_sigblock_vfork_sigsetmask_execl__exit_signal_waitpid execl.o 810719749 0 10 100751 170 ` 0e& ;ewI9   " +"2execl.o_errnox_normx_error_environ_execlsignal.o 810719728 0 10 100751 548 ` `w u@t55@ 58Nefef % (3A@u5Btr2@ Aup8 fef % u-u-u-@wH  %8+"3 7 ? Dsignal.o~signalsaosvsvmaskflags_signalcsv_sigveccrettelldir.o 810719730 0 10 100751 253 ` @8w & f eB B`@ `wIXi"% ) 0 5telldir.o~telldirdirp_telldircsv_lseekcret time.o 810719730 0 10 100751 259 ` @@w  fe @w @pHA@Yhy " . 3time.o~timettt_timecsv_gettimeofdaycret gettimeofday.o 810719755 0 10 100751 100 `  tw   "(_errnox_normx_error_gettimeofdaytimes.o 810719771 0 10 100751 489 ` 0w DLNe& wNe tNe 4tNe Ne 4t Ne 4 t w |DA && fef&< && Neee@ w@(9(IY9"    $ )_timescsv_getrusagecretldivlmul getrusage.o 810719754 0 10 100751 97 `  uw   "%_errnox_normx_error_getrusage timezone.o 810719730 0 10 100751 1177 ` 2w 6 !,&   w 1& %7˕,Nf b w D  !     +  wVe% - r<N r<&@& e=AIMUY,]aheimquy} TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d(H %)-1:bAFJMR"\ ` h o t }"b timezone.o_czone~timezonezonedstbegend_zonetab~tztabzonedstzpsign_timezonecsv_getenv_indexcret_strncpy_tztab_sprintf strncpy.o 810719766 0 10 100751 117 ` ( ~ ~" _strncpy tmpnam.o 810719775 0 10 100751 1226 ` vhw  N5 f 5 N % wN @w   5 wf %N w t 56 Y Nff eN 5"= Nff eN 5 # 5  Nf eN 5@w Nf %N w+tmpfile: cannot open %s. %s/XXXXXX/usr/tmpTMPDIR%s/%sXXXXXX%s/%sXXXXXX%s/%sXXXXXX/usr/tmp/tmp/%sXXXXXX8HXixii" "N & / 4 < D M U"^ f_tmpfilecsv_tmpnam_fopen__iob_fprintfcret_unlink_malloc_sprintf_mktemp_tempnam_getenvgetenv.o 810719723 0 10 100751 524 ` w Nef  ww D 5  =& % `5ȥ=  = @we   !+07;=?"G K"U Z c lgetenv.o~getenvnameoffset~_findenvnameoffsetlenPC_getenvcsv__findenvcret_environ_strncmpmktemp.o 810719725 0 10 100751 1026 ` Pw Nef D@ww  f D@w w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef ,5@ 'NeP %ʕ/  f % %% wNef ҕaʋʥzʕa.  )88HYY 8h D&&.1D;>EKOTX"a e j"&r z mktemp.o~mkstempasfd__gettemp~mktempas~_gettempasdoopenstarttrvsbufpid_mkstempcsvcret_mktemp_getpid_stat_open_errno__ctype_getpid.o 810719754 0 10 100751 90 `     ""_errnox_normx_error_getpidsprintf.o 810719742 0 10 100751 207 ` @ w BuNefef %=@@w(9"   _sprintfcsv__doprntcret truncate.o 810719767 0 10 100751 96 `  w   "$_errnox_normx_error_truncatettyslot.o 810719730 0 10 100751 477 ` txw      w/  5   &  @ y!"* . 7 < D O Z b mttyslot.o~ttyslottytpps_ttyslotcsv_ttynamecret_rindex_setttyent_getttyent_strcmp_endttyent getttyent.o 810719724 0 10 100751 1866 ` &w   7z ww jd 7 \ww D 5 %" 5x@ #w%̥\" %%# % % % % % %  w &D=&  w w    7 _z % % % %  %#7^7\ D7R D7H D7 >7 <_Z& % % % % UK % % N& % % % % E(& % % % % U& %  7p D̋#T̥#7T̋7 L &  wn/etc/ttysrronoffsecurewindow=YhxYYYYh"&,1<*GDMDSUWY[bikvxz" "* " getttyent.o_TTYFILE_zapchar_tf_line_tty~setttyent~endttyent_skip~skipptcq_value~valuep~getttyentpc_setttyentcsv_fopen_rewindcret_endttyent_fclose_index_getttyent_fgets_strncmpindex.o 810719755 0 10 100751 95 ` Ћ Ћ " _index rindex.o 810719761 0 10 100751 120 ` *  Ћ Ћ " _rindexstrncmp.o 810719766 0 10 100751 117 ` ( Jҋ~ @@" _strncmp ttyname.o 810719730 0 10 100751 656 `  w hN HNef ?@E% 8 2 *L- e Ne u-u- wb /dev/(9("&),1": > F M V _ g o u  ttyname.o_dev~ttynameffsbtsbdbdfrbuf_ttynamecsv_isatty_fstat_opendir_readdir_strcpy_strcat_stat_closedircretclosedir.o 810719721 0 10 100751 214 ` $@w D 4 4  wIXhy"( , 3 9 >closedir.o~closedirdirp_closedircsv_close_freecretopendir.o 810719726 0 10 100751 307 ` @Xw  f %  P 4 4 wix!$"- 1 7 > F Kopendir.o~opendirnamedirpfd_opendircsv_open_close_malloccret readdir.o 810719727 0 10 100751 447 ` @w D 4-&4-!4 4   &e & %4    wme   s lt  Yhy"( , 2 7readdir.o~readdirdirpdp_readdircsv_readcret stat.o 810719765 0 10 100751 92 `  &w   " _errnox_normx_error_statualarm.o 810719730 0 10 100751 589 ` hw DC @B& e5u@B& e5u@B&& e5u@B&& e5uNefe& % @Bff TeAm@wFy "&*"2 6 ; @ K P Uualarm.o~ualarmusecsreloadnewold_ualarmcsvlremldiv_setitimerlmulcret ucall.o 810719767 0 10 100751 93 `  w   "!_errnox_normx_error_ucall udiv.o 810719768 0 10 100751 186 ` FW f r @  W f r@  @ " "$udivuremuldiv.o 810719768 0 10 100751 228 ` >0 C& eJ   """ "(l2fl6fuldiv_uldivualdiv_ualdivulrem.o 810719768 0 10 100751 248 ` H0  C@C eJ)"  ""$ "$(ulreml2fl6f_ulremualrem_ualremulsh.o 810719768 0 10 100751 244 ` T   6v   6v   6vb"" ""0"0ulsh_ulshualsh_ualshultof.o 810719768 0 10 100751 209 ` D  E6P6 EP" """&ultof_ultofl2fl6f umask.o 810719768 0 10 100751 89 `  <   "!_errnox_normx_error_umask umount.o 810719769 0 10 100751 94 `  w   ""_errnox_normx_error_umountuname.o 810719731 0 10 100751 968 ` `w D5  & fe&fe e %  & fe&efe e % & fe&efe e % & fe&efe e %' & fe&efe e %@we ˥ ˥ % ˕ @   !%' 0"7 ; C Huname.o~unamenamemibrvallenp_freemem_unamecsv_sysctlcretsysctl.o 810719729 0 10 100751 981 ` Vw %Nf f fff e _ g %]@ D  %0  Q% 80 -f % x>c  = ?   @ ǃw/usr/bin:/bin:/usr/ucb:/usr/local:/usr/new:/etc $)16 > CJ S"[ _ i p x }sysctl.o__PATH_STDPATH~sysctlnamenamelenoldpoldlenpnewpnewlen_freemem_sysctlcsv___sysctl_errno_strcpycret __sysctl.o 810719745 0 10 100751 96 `  w   "$_errnox_normx_error___sysctlungetc.o 810719742 0 10 100751 221 ` Pw D% 5     |@w4- )"  _ungetccsvcret unlink.o 810719769 0 10 100751 94 `  w   ""_errnox_normx_error_unlinkusleep.o 810719730 0 10 100751 1343 ` w 4De _ t4 t t4 4t Ne&& % _@Bf& e4t @Bf& ze4 t    Nt-t- t-.t- *t- &t-!55 5 5 !ee@Bu  eAePPPP5 5  N  55 Nefe % & %5u7 j && % Z fe %ff H% fe& %w2A@E f& w w )9IYI !'+048=EM"U Y d i n v usleep.o_ringring~usleepnomaskitvoitvitpvecovec_sleepx~sleepx_usleepcsv_setitimerldivlrem_sigvec_sigblock_sigsetmaskcret_sigpause setitimer.o 810719762 0 10 100751 97 `  Sw   "%_errnox_normx_error_setitimer sigblock.o 810719764 0 10 100751 92 `  m   "$_errnox_normx_error_sigblocksigpause.o 810719764 0 10 100751 96 `  ow)   "$_errnox_normx_error_sigpausesigsetmask.o 810719764 0 10 100751 94 `  n   "&_errnox_normx_error_sigsetmasksigvec.o 810719765 0 10 100751 222 ` $@lw e& Yy  $ + 3"; Fsigvec.osigtrampSIG_SC_errnox_normx_error_sigvec_sigreturnsigreturn.o 810719764 0 10 100751 204 ` @7 7gwiiY # * 2 9"Dsigreturn.oSC_OVNOemt_errnox_normx_error__ovno_sigreturnutime.o 810719771 0 10 100751 216 ` F w @555 5 555 5 Nef w(9"   _utimecsv_utimescretutimes.o 810719769 0 10 100751 94 `  w   ""_errnox_normx_error_utimesvalloc.o 810719731 0 10 100751 152 ` 8w N wIXi " # + 0valloc.o~valloci_valloccsv_malloccretvfork.o 810719769 0 10 100751 198 ` $8BI I7IYY) $  ( /"6vfork.osavov_errnox_normx_error__ovno_vforkvfprintf.o 810719743 0 10 100751 412 ` (w @5-E@BepNff %5N @U@0 @0 =  Nff %5@5 wh@(8(I"   # (_vfprintfcsv__doprnt_fflushcretvhangup.o 810719769 0 10 100751 91 `  L   "#_errnox_normx_error_vhangup vprintf.o 810719743 0 10 100751 193 ` 2(w  ff %55 w@(8)I"   %_vprintfcsv__iob__doprntcret vsprintf.o 810719743 0 10 100751 204 ` > w BuNeff %=@@w(9"   _vsprintfcsv__doprntcretwait.o 810719731 0 10 100751 173 ` 8w  & f ewIXi " ! ( -wait.o~waitistat_waitcsv_wait4cret wait3.o 810719731 0 10 100751 212 `  Hw Nff ewix !%", 0 7 <wait3.o~wait3istatoptionsrup_wait3csv_wait4cretwaitpid.o 810719731 0 10 100751 214 ` Hw  fff ewix!)"2 6 = Bwaitpid.o~waitpidpidistatoptions_waitpidcsv_wait4cretwait4.o 810719769 0 10 100751 93 `  w   "!_errnox_normx_error_wait4 writev.o 810719770 0 10 100751 94 `  yw   ""_errnox_normx_error_writevgethostent.o 810719776 0 10 100751 1144 ` "xw | w]ww f` 7 X  7 7 ww 4 0 7  l %5#f Z  f Z N f&~v ̥ ̥ 7^\7X& Z  ̥̋ ̥ %& Z   Rww w:ww D CKw ˋ 5 N/etc/hostsr# IXiI)))iIiIiIi#  *"6 : B G"S [ f"Lr y "L__host_file__host_stayopen__host_db_sethostentcsv_rewindcret_endhostent_fclose_dbm_close_gethostent_fopen_fgets_inet_addr_sethostfilefgets.o 810719751 0 10 100751 326 ` &  4  '     ` TW ~  s`K6!   "__iob__filbuf_fgetsfilbuf.o 810719740 0 10 100751 828 ` PHw D85U5_:5P_:  m@e4 ,5Ne &   uN 4USt%5^ 5Z 5& & % 45@e-4  % U5EU  wE ))8HXYXhYXhx"   # + 1 9 ? D__filbufcsv__smallbuf_fstat_malloc__iob_fflush_readcretfopen.o 810719740 0 10 100751 571 ` 0w D  +   r= wB w5 a U5ff %ށ̥a &  e 3     U̥r 33)9HX"    $ +_fopencsv__findiopcret_open_lseek gethnamadr.o 810719776 0 10 100751 1680 ` Fw   uffr e55 DPfe& %e  & %e& %e@A@ 7r5%  & %mm  ww D@et5r%=r pD  7^;   we =r r̋=rNet  Net e  @et5Net 5&f 4% , 7 w DC .  7|%  2!f %   wu5&f %  7  9IXXXXi9))i) 9)() i)  # ' + 6 = B"Q ] g s  " _h_errno__host_db__host_stayopencsv_dbm_fetch_bcopycret_gethostbyname__host_file_dbm_open_sethostent_gethostent_endhostent__ctype__strcmp_strlen_dbm_close_gethostbyaddr_bcmpinet_addr.o 810719732 0 10 100751 1225 ` &0w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff e A f&A@vee@ 5u 5 @ W-@D Ae Bḁ.@e@- @D@pHe _̋@pHeA Be vC ̂ x&uuff %5uwrA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPh)8888IY"   ! ( -_inet_addrcsvlmul__ctype__htonlcret ctype_.o 810719722 0 10 100751 570 `  ((((( AAAAAABBBBBB  #ctype_.o__ctype_htonl.o 810719755 0 10 100751 78 ` " "_htonl_ntohlndbm.o 810719726 0 10 100751 9536 `  B(w 4$  w5 4@E%@EU5N&e &e Nf&e %4 IN&e &e Nf&e %  (Ne&  ff eee@ 4t@t"4 4t  _w N @ N ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4tww D55ff %f&& "eff&e e &e 55 w w w5 5 w D5#r5ff T %f&& eff&e *ew*&e j '44  && ef&& e&e & %%U w D5_>o5ff %f&& eff&e Ze L&e j 8f f ff&e V e 744  && ef&& e&e & %%UUw @@m e%fe  &e 55 3ff `%f&e@ &50c &e 55 3 U44  && ef&& e&e & %%&_*fffffe e _*&e % _n_*e_n  mm@ e@ f& Lef&& efe& %%_* ( _hw @0 0 @0 N "77ww D85_.Ne& q fe e4-4-/44  && pef&& e&e & %%&e &e 55 ewww4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4t4-4-/44  && $ef&& e&e & %%&e ww D4- 4-  w & & eB & & e5u ff veC ff ^e5u4 t "-t t"  ff &ef&& e&e$& %%&e$ `$BtA @@w D4-  4- 4 4  & & eB & & e5u ff feC ff Ne5u4 t "-t t"  ff ef&& e&e$& %%&e$ `Btp$t t"  ff ef&& e&e$& %%Uwzw vD5#5 5 wZwVwL @ a@ a@m5A a@5w D 5# aB- f a@m& % we aC-w D@ A 5@u@e@ 5u   wbuMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@wC  E 5l @Et5l 5l u te%w D5u-5 wh@e@- @ a@ a@ a5@ a@@@m`&fNm % a@ `` e w D a@@m e  we  aAm HN@`@m &f %  aN f`f %=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired  (( x x x x x x)) x)) x x8HHH  %+.,9<PHKOT _gruy{8  rj @ * ( "%(.38?BGORUWY[( cfikmo y}   X X  j   *  % +.14"> B J Q V ^ f l s x  ","P""r  "@   """      ndbm.o~dbm_openfileflagsmodestatbdb~dbm_closedb~dbm_forderdbkeyhash_dcalchash_getbit~dbm_fetchdbkeyiitem_dbm_access_finddatum_makdatum~dbm_deletedbkeyiitem_delitem~dbm_storedbkeydatreplaceiitemitem1ovfbuf_additem_setbit~dbm_firstkeydb~dbm_nextkeydbstatbitem~dbm_accessdbhash~getbitdbbnbin~setbitdbbnbin~makdatumbufnsptitem~finddatumbufitemspinj_hitab_hltab_hashinc~hashincdbhashbit~dcalchashitemscjcphashlhashi~delitembufnspsp1i1i2~additembufitemitem1spi1i2_dbm_opencsv_malloc_errnocret_strcpy_strcat_open_fstatlmul_close_free_dbm_close_dbm_forder_dbm_fetch_dbm_delete_lseek_write_dbm_store_bzero__iob_fprintf_dbm_firstkey_dbm_nextkeyaldiv_readlremldiv_bcmp_bcopyaldiv.o 810719746 0 10 100751 126 ` .  @A  v @A" aldivbcmp.o 810719747 0 10 100751 218 ` \  R~55R 5& ER$ ~ER " _bcmpbcopy.o 810719747 0 10 100751 407 `  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5b" _bcopy fprintf.o 810719740 0 10 100751 347 ` ~(w D5"E@e44fef % U4 4  fef %5 w (8(I"   " '_fprintfcsv__doprnt_fflushcret ldiv.o 810719756 0 10 100751 121 ` ,   6v&" ldiv lmul.o 810719757 0 10 100751 113 ` (  @ppC`p" lmul lrem.o 810719757 0 10 100751 141 ` 6   6@C" lrem open.o 810719758 0 10 100751 92 `  w   " _errnox_normx_error_openread.o 810719759 0 10 100751 92 `  w   " _errnox_normx_error_readrew.o 810719741 0 10 100751 224 ` B(w D  & & e 4E05Ew(8I"    $_rewindcsv_fflush_lseekcretlseek.o 810719757 0 10 100751 113 `  7    "!_errnox_normx_error_lseek strcat.o 810719765 0 10 100751 84 ` Ћ P" _strcatstrcmp.o 810719765 0 10 100751 92 `  ы A@" _strcmpstrcpy.o 810719766 0 10 100751 72 ` P" _strcpystrlen.o 810719766 0 10 100751 68 ` Ћ " _strlenstrout.o 810719742 0 10 100751 859 `  w DCB P  5 , :% & E& z   5 , @ :% & f E  (˥-%0     ,:% &  8 5E& z   5 , @ :% & f E  wz((((9"   __stroutcsv__flsbufcret flsbuf.o 810719740 0 10 100751 1367 ` H`w D:5UE5Hw _j5uNfe & % _jbNe &   uN )U5| m- 5 & %St%  U   & % S U _( @_,w xDE%%"5   & % U w w D55@   3 4 4 4 4 4 w)8HX8hix88))"    $ , 2 :"B"J Q W__flsbufcsvcret_write_fstat_malloc__iob_isatty_fflush_fclose_close_free close.o 810719748 0 10 100751 93 `  w   "!_errnox_normx_error_close findiop.o 810719740 0 10 100751 1466 ` rhw p$r5+ &5e-De %b & "    ww 5f 7 f 7wL@ m7r%be w $      e-nww D Zr5 e %bw6  5 e-w  wd9IIhy9hhy9hy9y9y#r #b" # *"t8 @ E T"`"h"br z__iob__smallbuf__findiopcsv_errno__f_morefiles_calloccret_getdtablesize_f_prealloc__fwalk__cleanup_fcloseexit.o 810719739 0 10 100751 132 ` (w N w)8I"    $_exitcsv__cleanup__exitcretfakcu.o 810719723 0 10 100751 113 ` (w w9I " $ )fakcu.o~_cleanup__cleanupcsvcret calloc.o 810719721 0 10 100751 359 ` <w DCDpC  ww N w  ,')-2": > F M R",Y _calloc.o~callocnumsizep~cfreepnumsize_calloccsv_malloc_bzerocret_cfree_free bzero.o 810719747 0 10 100751 183 ` J ~5 & E        ~5" _bzero fstat.o 810719752 0 10 100751 93 `  >w   "!_errnox_normx_error_fstat getdtablesize.o 810719752 0 10 100751 101 `  Yw   ")_errnox_normx_error_getdtablesize isatty.o 810719725 0 10 100751 232 ` 2@w Net@f e  wYhy "$ ( / 4isatty.o~isattyfttyb_isattycsv_ioctlcretioctl.o 810719755 0 10 100751 93 `  6w   "!_errnox_normx_error_ioctl malloc.o 810719725 0 10 100751 1416 `  w U7U7Ae vB7   % 55 a  a!PE -|% wh  `e vWt vwJ@ `e @  %"e U?   `e 7U? a7 ?U ew DE ww D5 D 5N !wb5A vBB-  }ee@ !ۃ `!ւ ` ` yyy %-5<>@C HDNQSb\^egiknr"z ~ "D"bmalloc.o_allocs_allocp_alloct_allocx~mallocnbytespqnwtemp~freeapp~reallocpnbytesqstnwonw_malloccsvcret_sbrk_free_reallocsbrk.o 810719761 0 10 100751 222 ` &@m& E%m%w9HH   ! &#&-#(4":sbrk.o_errnox_normx_error_endcurbrkminbrk_sbrkwrite.o 810719769 0 10 100751 93 `  w   "!_errnox_normx_error_write _exit.o 810719745 0 10 100751 125 ` (7 """")_exit.o_errnox_normx_error__exit gcvt.o 810719723 0 10 100751 855 ` >xw Nefef 5& e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @w  #(.146"< @ F K Sgcvt.o~gcvtnumberndigitbufsigndecptp1p2i_gcvtcsv_ecvtcretfltused ecvt.o 810719749 0 10 100751 1035 ` P0w fff 5& Jeww  fff 5& Jeww  5 %O N  = 555Ne5& e5"55'0Ne5 B& e57 Be0" 5%"55 5 B5@B e a=%7w %"5 B5Ne& e55e0%"7`Jʕ0%ʕ1  %˕0 ʥ9 =(\))HH)H"  "&  '_ecvtcsvcret_fcvt_modffltused csv.o 810719748 0 10 100751 686 ` *'$!     P 7F& A6& BF7!W-7# ""$" -"6"?"H"$Q"*Z"0c"6l"<u"B~"H"N"T"r"__ovno_etextovhndlr1ovhndlr2ovhndlr3ovhndlr4ovhndlr5ovhndlr6ovhndlr7ovhndlr8ovhndlr9ovhndlraovhndlrbovhndlrcovhndlrdovhndlreovhndlrfcsvcretfltpr.o 810719751 0 10 100751 625 ` 8& & e Ӌ  &7& e ӕ-ӕ0B~ӕ.  ӕ0~ B~&7j & be Pӕ-0 Dӕ.8 B~ӕe* ӕ- ӕ+ r e0e0S)   ""#" *"1_ecvt_fcvt_gcvtfltusedpgenpfloatpscien doprnt.o 810719748 0 10 100751 1370 ` 0@8w 8uDAB %u f& & e w5 5  W- W00~u5  .lu0Bw* J@B L_@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B L @  4A  fff e w5  @ 0   Wp `e0doxfegcslLuDOXU )9IY     " )"2__stroutcsvcretpgenpfloatpscien__doprntffltpr.o 810719750 0 10 100751 83 `  eӕ?" ""pgenpfloatpscien modf.o 810719758 0 10 100751 62 ` 6@~ " _modfmon.o 810617791 0 10 100751 1758 ` <w AA rd5%22AAe vCp`eu@ E5 5% +< % 7|NA vffff ewTw P   ("& % _ %  %^ww @e7A WpDeD- A e r5 WpDe@a7CKss zz@ 7rwn@@7!^&& T vf& VeD7: w:w 6    & & & ew 5ea w  EQ$wH emonstartup: no space for monitor buffer(s) monstartup: no space for monitor buffer(s) mon.outmonitor: buffer too smallmonitor: buffer too smallmcount: counter overflow (8(Ii88ii"   ! ("1 6"B I P U ] d k s"z_monstartupcsv_sbrk_writeminbrk_monitorcret_moncontrol_creat_closeldiv_profil_errnox_normx_errormcount0*l " 000/usr/src/sys0,l 000unix0.lo" E /b/b0tftpd: ALL rexecd: ALL rshd: ALL zyncd: ALL popper: ALL ALL: 0.0.0.0 00l _ 000# # Local clock parameters # # Stratum MUST only be defined if you are a primary clock # If so, include the 4 char clock type #stratum 1 WWVB # # Precision of the local clock to the nearest power of 2 # ex. # 60-HZ = 2**-6 # 100-HZ = 2**-7 # 1000-HZ = 2**-10 precision -6 # # Peers Type Name # peer / LOCL 5 -6 local peer 192.168.251.1 02lZ 4 000tftpd: LOCAL rshd: LOCAL zyncd: LOCAL popper: LOCAL 04l ~U W Y [ ] R0UR0U0 g e7cce7 / ~%  7%  6Zw p]" <@ȥ/fe TV /f % = NB<fe p5%@-w FV 9 5 N X % U  % % f  9eN  @]wUw U@"Ffe TV @   e@&@&  %@ewdUw PU@Ffe TV @ N@ @ewUw UFf TV @ N@ @wTw T N 5Ff % Nf %@wTN lw T Ne  5@@NfeX$ p% .N fV5%@@m  %@@m\ umu=@u- wLw L Nf % 5= @wKw K5 5 u.5   %N CwK@w K Nfhfe pJNf # w% C@5 =59Nefefefe e%$@ @-@ @- fe % 5=@e5 hN ^Xff ;%@0whHw TH De t4 tt 4 4 Ne&& J=% wH  eu @)wjGF ;ewTG wDGwz F>%5#f   wzf   ̥ ̥ &  5=  $767, D ̥̋ ̥ %&    |w4Fw FD CKwF ˋ 5 vwpEw EDCB Ԥ@wE w EDCB 5Ԕ @wEhwEw ED      + - ̥9 Wp @@`e̥0  wREw :EDeEE&E&E& p A74 -* ? s 3  33 a r w wD+& f Vew NDNef %wFDw 2DNeff %w*Dw DD A555  ԋuNeffe %wCw CDC 5 5 _2%%_T5 %*e5  AWp `euW 0u%l5  %h%[ We  _Neffff e   * O  A@ EN >5% % % %Nf < &    %_  A@ E%Nf < @wDBN >5 w BN%c%s%[Nf ff f& ewA5 5 5 5 %e%f %o%xDe5 5 A @ EN >% % % %- Ԑ A @ EN > _%+_  _%a%f %A_%F_ % A@vN >O% A@v@mAm@ vA@v5uW0 %a%fW7 5`u`u C% S P Ԑ A @ E =W%%.%e%E- *% ' $ ! Ԑ A @ EN >%+%-%0%9 A@  5u% N  < =   @e! @e! _@t@]   x*Ne A _Ne A @H@pHw >DC = 5%c%0u5 %s    >%r*%c5 %[r*      >%%   < =  D- %cw= w =D ̥^  *** % %]%-+ * $%-̥]4  * ̠ * ** %]  w8=w $=D*\5% %-%+ 5 55 55  B5eA5 W%.55  B5eA5 W %E%e$%+%-  Wp B`eW  @`5 @ 5AupAm%55 @5A5u555555  55555AupN& f"e5 55wj;6 m 7"w 2;D 3 X\EtU4 4 w:&& e& & \%ReR$ @  1  L "@! @#E B Ew `:X :]%wZ:iw9pw9w ::4De _$ t4 t t4 4t Ne&& J=% _$t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 % 55 Nefe ^=% & %5u7 2 && J=% " fe ^=%ff % fe& J=%w8A@E f& Rw 8w8w 8DCv``Hԋ w8``A@w t8DCB v @mAmHԋ  @mAmA@w:8w &8DLw&8ԋ w 8D Lԋw8w 7DC @@- w7 5w 7DC  / 7 555  5  55@- 47R@w>7w *7 @e5ff &%w7w 7D5 N# &%EAEt =_~)5]hNe :Nfej p<%CaejNe .Aej@ \3e`5    p<%`5   p<%` ӕ:ӕ Bej%_(mo N 3 p<%` 5 Nfej =%`Aej@55 N*@e`5^}^f@ej@A^1e^^@^fe` @>%X  U )%Nfej :]%@-`R ffej P3e O5K 5h%D 4  U%5fej V e>fej <  NAej@f :]%N X @] & fh >%%%wN4w :4D ww 57%<( ;%5,  V3%7%  U 7xt7h%`'R 2%%F2 *%%" Xxwf3w R3 X7^wL3w 83D 7w23bw2w 3N . *w3w 3D el&&&&Wpef WpefT  p r 8 8 rd ( AP 5 8u 4  AP f&A@ 5u r  r   AP @mAm@ 5u e4 tWpe u4  AmA f&A@ 5u  AmA 5 u ܃@ 44  ttwD+!w*\w*w $+De LN fV4e eD 3  fV4e  Be v Nfe @>%w*w *-<@  w*N % p<%%ew)aw)w `*w@7% ?@xwH*N f 3w "*DC_9̥%_8 5 r y _8 9% 5afe &b T%5@e5 5bN 9 _9 5pN 9 _9 w|)1 3_9F 3_9X 3_9  $9% _90 $9% _90 r  r f $9% _90 $9% _9  $9% _9  r  r f $9% _N4_90 $9% _N4_9f 9 _N4_9i 3_N4_90 $9% _N4_9{ 3_N4_9 9 _N4_90e r& $9% _N4_90e  @ r& $9% _N4_90 $9% _9_N4 3_9_N4 _N4 9 _9_N4 _3 _3 _8 _N4% _N4b_24fe &p T%5@e5_>4 _8 _T4 _4 _8 _x4 _5 _8 _5 _*5 _80 el rdf $9% _9_N4 _5 _80 $9% _9_N4 _5 _3 _8a 9 _9_N4 _4 _5 h_6 _4 _f4 Y% _5c_5 _ 6 G0 $9% H_N4 _5 _4 -o 32_N4 ! 0 el $9% _N4 _d5 _6 _5 _N4? ̋_3_P4w $ &A r e0@ A r 5   %& @  L %&  9wF$w 2$D w6$ ` Z V?Rj݀e& ;ewt#w #u@t5 &5 &@ 5&Nefef ^=% (3A@u5Btr &2 &@ Aup& fef ^=% u-u-u-@wH#w 4# fe :@w&# @pHA@twt"w " ;!,& <   w" 1&& ;%7˕,&Nf 0; w "D  !     +  wX"e% - r<N r<&@&?& peww  fff :>ewwyw&  4  b '     ` TW ~  s`K6!  w D85U5_@5P_@  m@e4 ,5Ne & Z  uN [4USt%50 W5, W5& & U% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff U%ށ̥a &  Ve 3     U̥r 33w   uff. e55 D'fe& T%e(  ('& T%e'& T%e0(\@A@ 7rF5%  0(*& T%mm  &ww D@et5r%=r ,D  E 7; $a 0  w|e =r r̋W=rNet 8V Net 8Ve  @et5Net fV5&f 4% Lr F7 j 2԰w DC J.  E 78% $a N 2!f S%    Ӏwpu5&f %  F7 w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @W W-@DW Ae BWḁ.@e@- @DW@pHe _C̋@pHeA Be vC ̂ xNuuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ [ < w5 4@E%@EU5N&e TV x&e V Nf&e U%4 IN&e TV }&e V Nf&e U%  (Ne& Z  ff eee@ 4t@t"4 4t X X\_Ew N X@ XN X\ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  M ve@ 4tw"w D55ff %f&& "eff&e e &e JP 55 w&w"D(w5 5 w D5#5ff T %f&& eff&e *ew6&e .R'44  && ef&& Ve&e & :]%%U w D5_Jo5ff %f&& eff&e Ze L&e .R8f f ff&e V e 744  && ef&& Ve&e & :]%%UUw @@m e%fe Z  &e JP 55 3ff `%f&e@ &50c &e JP 55 3 T U44  && ef&& Ve&e & :]%%&_Ifffffe e _I&e % _2J_Ie_2J  mm@ e@ f& ef&& Vefe& :]%%_I N_,Iw @0 0 @0 N K7p7lH(ww D85_LNe& Zq fe Ve4-4-/44  &&  ef&& Ve&e & U%%&e Z &e JP 55 ewwL(w4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  M ve@ 4t4-4-/44  && ef&& Ve&e & U%%&e Z ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& Ve&e$& U%%&e$ Z `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& Ve&e$& U%%&e$ Z `Btp$t t"  ff Nef&& Ve&e$& :]%%Uw w r D5#5 5 wwP(wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& S% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5lX@Et5lx5lzu te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm T% a@ `` e w D a@@m e  w e  aAm HN@`@m &f T%  aN f`f T%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef ^% WU4 4  fef ^%5 w    6v&  @ppC`p   6@Cwzwtw D W & & Ve 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _W5uNfe & :]% _WbNe & Z  uN [)U5| m- 5 & :]%St% " Z U   & :]% S U _V @_Vw DE%%"5   & :]% U wv w ^D55@ W  X 3 X\ 4 4 4 4 4 ww~w  $5+ 6 &5e-pe % & N    JZ ww  5f JZ 7 f JZ 7wX@ m7%e w       JZ e-ww D 5 e %wb  5 e-Hw ^X Yww  N @]ww rDCDpC [ Z wZw FN X\wJ ~5 & E        ~5>wlYwfw Net@f [e  w6w.w  Pn(U7Bl(U78n(6l(.Ae vB7   % 55 a  a!PE -%l( w$ ] `e vWt vw@ `e @  ]%zve U?dd `e 7Rl(U?F̔ a78 02?*&U ew dDE wZw FD5 X\ 5N [!w5A vBB-  }ee@ !ۃ `!ւ ` `bmn& E%`mZ%w w7ҹ*'$!      7ظ& Aȸ& BF7!W-Jg7& & "e Ӌ  &7`& \e Nӕ-Hӕ0B~4ӕ.  ӕ0~ B~&7 & e ӕ-0 ӕ.ַ B~ӕeȷ ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & ze w5 5  W- W00~u5  .luBw* J@B V_`@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff e w5  @ 0   Wp `e0w  Uw]ww |  ^X7  F7 7 w`w L ^ Z @ 7J l@x( F>%5#f ~b  f ~b DN Cf&4Lj& ̥ ̥ 7()7& ~b  ̥̋ ̥ %N)& ~b   )w`w LwdwRw >D CKw4 ˋ 5 w DCB P  5 , :% & E& vV z   5 , @ :% & f E vV  (˥-%0     ,:% &  vV 8 5E& z   5 , @ :% & f E vV  ww Nefef 5& ree C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @w^w Jfff 5& eew8w $ fff 5& eeww  5 %O N  = P)555Ne5& ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/usr/adm/messagessyslog: bad fac/pri: %x<%d>%h %e %T %s[%d]%s /dev/console /dev/logSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDect x mn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %dd l v   . @ R ^ t  $ 3 B Z g } ) F W v 8On~ )Ab)8Lb:ORError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator (67&7D7b7778.8\8888SundayMondayTuesdayWednesdayThursdayFridaySaturdayJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%m/%d/%y %H:%M:%S%m/%d/%y PMAM%H:%M%I:%M:%S %p%H:%M:%S %m/%d/%y,h #+/37 ;TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02dDEHExE ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired T())_d_o_x`f`e_gv`c`s_l_L_u_D_O_X `U)/etc/hostsr# =(\0Vlꤓ09 ; = ? A R0ER0E0 % P e7cce7  /   7%  w !n @ ? ^ ff %5%  5`  (   % .Nnfer %"fer %5 Ner& %fe  @e5@et5@e)  7 ufete %@l0t 5fffff e Ner, % nNee @E% @E%``N  %Nn9fep %NnCfer %Nepfer NepferQ eNnafep %Nnkfer %Nepfer Nepfery e ww   w~ ww d @e5ff %wTw @  p  Nf  % n f V & .    N ww  @e5ff %ww   Nf  %   N ww  @e5f  wzw f   Nf  %  f | & .    w&w  @e5f ^ ww  *  Nf  %   ww  d . ww  :     ww w- @m7ȥ- > - 7%:f  (d \ V  f .   .       ?w ̥:7 *+n w-  f .   @m7.  9 E5 @@l ww "DC E5<E@e33. @;E  5 , @;% & fE  5  U3 3  wt(www TD LԋwLw 8De LN 4ee   4e Be v Nfe %ww -@ wN % w  BuNefef !%=@@wTЋ Ћ w " f  %  RP 4 4 ww D 4-&4-!4 4   &e & %4    wme   s lt  <nw >@5-E@BepNff !%5N @U@0 @0 =  Nff !%5@5 w@yw w 4$  @ w5 4@E%@EU5N&e   &e  Nf&e %4 IN&e   &e  Nf&e %  (Ne& d  ff eee@ 4t@t"4 4t R _ w nN R@ RN w^w JDff %5u4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4tww D55ff %f&& "eff&e e &e < 55 ww, wF5 5 w (D5#5ff T %f&& eff&e *ew&e '44  && ef&& e&e & %%U w ZD5_ o5ff %f&& eff&e Ze L&e 8f f ff&e V e 744  && ef&& e&e & %%UUwh @@m e%fe   &e < 55 3ff `%f&e@ &50c &e < 55 3   U44  && ef&& e&e & %%&_ fffffe e _ &e % _$_ e_$  mm@ e@ f& ef&& efe& %%_  _ w @0 0 @0 N 7f7b0 ww xD85_0[lꪜ09 ; = ? A R0ER0E0Ne& dq fe Ve4-4-/44  &&  ef&& e&e & %%&e  &e < 55 ew~wz4 w4 et 5-5-5 5 w bD4 4 @ A f&A@EE4tmm@ 4 t   ve@ 4t4-4-/44  && ef&& e&e & %%&e  ww |D4- 4-  wl & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& e&e$& %%&e$  `$BtA @@w rD4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& e&e$& %%&e$  `Btp$t t"  ff Nef&& e&e$& %%Uw( w  D5#5 5 ww8 w  @ a@ a@m5A a@5w D 5# aB- f a@m& % wn e aC-w B D@ A 5@u@e@ 5u   w uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l@Et5l5lu te%w 0 D5u-5 w @e@- @ a@ a@ a5@ a@@@m`&fNm % a@ `` e w p D a@@m e  wN e  aAm HN@`@m &f %  aN f`f %  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef !% U4 4  fef !%5 w>    6v&  @ppC`p   6@Cww7H Ћ PPЋ w FD:5UE5Hw* _t5uNfe & % _tbNe & d  uN )U5| m- 5 & %St%  p U   & % S U _2 @_6w DE%%"5   & % U wv w ^D55@   R 3  4 4 4 4 4 ww~w  $ 5+ &5e-ze % &      ww  5f  7d f  7wX@ m:78 .% e w        e-ww D  5 e % w  5 e-w  jww  N ww rDCDpC   wZw FN wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  V U7T U7V T Ae vBn7 p  f%` 55 a  a!PE -(%T  w$  `e vWt vw@ `e @  %e U? `e 7T U? a7 ?~zU ew dDZE wZw FD5  5N !w5A vBB-  }ee@ !ۃ `!ւ ` `m& E% m%w w74*'$!      7& Ar& BF7!TW-R%7@w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_^#@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E&  z   5 , @ :% & f E   (˥-%0     ,:% &   8 5E& z   5 , @ :% & f E   w/var/run//dev%s/dev.%sdev.tmp%s%sdbm_store %s%sdev.pag%sdev.tmp.pagrename %s to %s%sdev.dir%sdev.tmp.dirrename %s to %susage: dev_mkdb: illegal option -- : option requires an argument -- : Unknown error: %d"4DPbt%9Xgv >]z<l'A]u"6J]l 3LnRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator=951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired < ` ` "dp"o|"x:#fH#e:"g#c #sJ"lJ"L"u"Dt"O"X"U0el` (7 0F0F0domain your.domain server 192.168.251.1 0gl* R0R00 Ȱ e7cce7 / O  7% > xw {  w{Ne P4w { G  ` 57 7 ڀ x f  N v x 7 ~ mz  w"{w {  7 7 0" D F'&f ]% 7-7- 7~7z7  m-wzw z _7 >7 < &f ]% r  m- m& v% pf& R[%& ` 5 ~   & f   m-N vf` %~& %wyw ~yNe P@&f5f dsew^yw Jy7 ~Nfe $_%Ae@ w,y r~Nef 8 \~mA % w xNexfef|f JEeNex D'Br2@ wx w xe}w } @ ee@ f& pe5u7`}w`}w } &W-! & A@ee@ f& oe5u7`>}w`<}w 6}wxw w  @m  % e }w }e v@ 7`|w`|w |www w5 | Z7 |7 |||0|%  ds  eDe_h r yW  x%f  w|e _f%T  N D'7  N ds% x?{ e_f_fNefe & *h l eu_f   6 ds%_b  7:{_f  Nefe&  B l e7>{w<{_f   x& fefe&  s ef& zme7zwzb  _<  fefe d ef& lewfz6 3  _ 4z( _ _ _ 6z _ _ _w  x ̋_% E ds  xwye %%f ds Ne ds%@   ds  x  Ny  ds  x(y t (yy Ty Py  >y8y kef& ke7 ywy# x  d7x x x  67xwx:x ]~x: ] 7jx?fx bx )  x ( NB fY % fY V fY % fY j fY % fY ~ fY % fY  fY % fY  fY % fY  fY % fY "Lw .  g dse  mj-jwvew be ff ]%5"@B2,2, 2,  w*e@B2,@w d((j F%qj@`7:j wd.je<7$je7jw dWpmj@ 0 Wpmiif r%ei e0w *%  w^dw Jd  "Wpmi@pHWpmi zew % j wdw c i i    ix ii v[ef& e H   L ? h  ` R wncw Zc  wZcw Fc hh5h &Щ{ e@- X  %7 `he<7Vh7 Tm&hw he $hw h g - hh -hg &2 & ?%5x@@ `& @ <a&rt e5%<_ 6 X w.\w \u uumNff %5 @w[@ @w [ B0 v&e`et57 `E55  w-`:5`  ue `5  ff v&e5 5 te  %@ew-(`w [w Zfe   t@m  %t@m f& % %wZefft@m f& !ew lZfeff v&e )fe  t@a55  ff % %wZ  t@a55  N f fff !e %ނw YDE_b#^ v @^ EBtpP@!%@^ v @z^ EBtpP@A7-87-: 7-<37->. J^2E%$2^ v @^ EBtpP@a% %@ %e^w ^ wXw X] v A@a] Et0N7 ]7 ]n&%f .!% ]] v ] EtP@aN  |] t]$h] v A@aR] Et0B] v 0] Et@@AwXw W ] 7 ]@a $ ] v @\ EBtp@@aA P~b7 DE%@ %% $f .!%wxWw dWwt  t@m   @ D- jw>Ww *W   @m  % w e vw $u N ze -wVw V[l7   d %I7l zwVw V [Kfeff v&e %:D`e 'm . . v A@a@ EBt@0 6[ % [\  ds%wU v A@A@ EBt@0 Zw UwUw U  ff Mef&Z xte } C fZ rt%%D- C- 5fe f ffPZ e Z% T4Z  % H! B   7 wTw T6N t%@0Nfe t 5Ne '5@wTNe ?5Ne ?5Ne ?5Ne ?5Ne ?e5Ne $(w >Tf C& ]% f rw"Te̋w T @eA P~@e55 5 ! v5u5PuPNfe , & (uMuM ݀A@wSw |SDC, -, ,,,, ,,, ,"" wSw SwxN) fY 0 ` wRw R  ds  xwRw R   / 7   ds  x Z N;5 u  ff& D2e 7(fe |Ne %wRw QNf fe V]e>Nef * wQw Q%   * 7 wQw QN fe V]%Ne tfe {%Nfؐ {% +w^Qw JQN t&f I &f Pe% BN +w Qw Qfe + EF fe + Nefef eF7 wPA Ne  Ne ?w |P fe rt%% @wdPw PP = @0  %F  >w$Pw P 2%  fY  z2% 1& &2 wOw O De t4 tt 4 4 Ne&& ^% wO  eu @wN wNw POD̥: ̋̋wBOw .O C Wp De` ˋ5ˋ =K ˋˋ wNw N, $_%wN= ,@0 ,@0 ,:&fe ,% &fe ,%w LN  $ ~ ` 77 ~ w4Nw N jd v7 \wNw M J   H-5%%wMw M p  N& twM w M B  N& twM pw fM   N& twTM @w 6MD  x t $w Mw M ~/ f te  f t N& t 4 6wLw L    ` 7 zw]wLw vL  v7 7 ދwlLw XL   ` 7 r $_%5# f 0  wr f 0 5=   f 0 N ? A7$7"7 & 0  ̥̋ ̥ %½ & 0   w`Kw LKD CKwBK ˋ 5 w K   ` 7 zwKw J ~x v7 pwJw JDC  ̋̋wJw J >   ` 7* E Ľ $_%7:& P1 7:& P1  ?7ξ:& P1  & P1 ξ %\,& P1 ̋ ƾwJ%w~I*J whIw IR *5N b5N @wI}& ,%5u?  ds GNf X%@5fe@& r%u fef Pe _3N &w%0 Ne 65% v Xff t+%%=V %N N @ <,ff %  ds%w XA1`@fe@& r%ff %  ds%N R f {%5 N t ff {%N t f f {%N t f f {%fef rt%%_~6N X N &wN &w_83Ne 65 f A N fe V]%Ne t &fe ? &fef Fe% XNfe x  C r vf&A r t@aUU C r vf&A r t@aUU7  & & fe .Ne%  C r vf&A r t@a&50 2 L  ds  fefef Ae5N &w x X5 _4}N A5%%%_4  ds _4fef rt%%_4fe {% _4ff '%@_z2w LE5 5   `Y%5+N A5fef `:% %0v %N &w Z@N &wwDw D|DCe%@5̥.5e ̋    ` 5 Nff fef 8e N v QN v%G  A5 N :5|8fe| t  fe| t  fe| ` 5Ne~@ & 8y  @|p-5N vwCw tCBN@fe $_% YDe̥ ̥ ̋5e  ̥ ̥ ̥  ̥ ̥ 5̥ ̥ ̥ ̋ 5 N fef 9% NNf t wBw B% Nf t_Z:WNff ]% KNf t@@mȋ= : +A^ A %)7.^ ] 7  5e ̋@@m r t wAhwDAw A .  * L  wA  5 ff L% 50   8 w ZA  uN t5&f %5w.A 5  f t  0   w @ p  @e5ff l%5w@ 5  w-   4 w Z@ ̄Ƅ z  &  nd%7w.@  t 5 f ` 7h w ? N @ w4>  7  ^j~ j55 ff^ (e55D @ D4.& r%e& r%e& r%e& r%e7΁w .=  _? t_&?_*?%5 & f lt%5=` @5u fff xte5 #u 1f rt%50 :=N &wwx r 8 8 rd ( Ab 5 8u 4  Ab f&A@ 5u r  r   Ab @mAm@ 5u e4 tWpe2u4  AmA f&A@ 5u  AmA 5 u ܃@ 44 ttw#!w#\w#w |#De LN t4eeb .Y  t4e Be v Nfe _%w #w "->@ w"N V]%awD"w "u@t55@ 5Nefef ^% (3A@u5Btr2@ Aup fef ^% u-u-u-@w"w " fe ^Z@w! @pHA@twF!w ! z[!,& ]   w! 1& R[%7ep˕,Nf Z w ^!D t !     +  w*!e% - r<N r<&@&# V]e ~ ~w Nef [ w w D 5  =_& ]% `5ȥ= _ = @wB e  w " Nef F\@w w  f F\@w w D6 5B ʋA r e0@ A r 5X  B-ʥ/ʥ/ Nef ^,5@ 'Ne0 ^ %ʕ/  f lt% %^%^ wNef ^ҕaʋʥz5ʕaw  BuNefef \}%=@@wЋ Ћ   Ћ Ћ  Jҋ~ @@&wW f r @  W f r@  @ w D% 5     |@w4-  wSwmown^lw e& 7 7xgww ( & f _ew wyw&  4  b '     ` TW ~  s`K6!  w ~D85U5_`5P_`  m@e4 ,5Ne & 8y  uN |y4USt%x50 bv5, bv5& & rt% 45@e-4  % U5EU  wPE w .D & +   r= wB w5 a U5ff lt%ށ̥a &  xte 3     U̥r 33w F  uff6 Xe55 Dhfe& r%e  ̶h& r%e& r%e@̎h@A@ 7rxh5%  @\h& r%mNhmJh  wZw FD@et5r%=r 4D  nd 7";X   X |we =r r̋5=rNet t Net te  @et5Net t5&f 4% Wz e7 r Ww XDC R. Ը nd 7@%W   2!f Nr%  W z pWwu5&f % PWҴ e7 ʴ w 4$ |y W w5 4@E%@EU5N&e t V&e t Nf&e lt%4 IN&e t [&e t Nf&e lt%  (Ne& 8y  ff eee@ 4t@t"4 4t &w z_dw N &w@ &wN zwzw fDff %5u4 4 @ A f&A@EE4tmm@ 4 t  l ve@ 4tww D55ff %f&& "eff&e e &e n 55 weweTwb5 5 w DD5#T5ff T %f&& eff&e *ew&e p'44  && ef&& xte&e & {%%U w vD5_hSo5ff %f&& eff&e Ze L&e p8f f ff&e V e 744  && ef&& xte&e & {%%UURw @@m e%fe x  &e n 55 3ff `%f&e@ &50c &e n 55 3` ds U44  && ef&& xte&e & {%%&_hfffffe e _h&e % _h_he_h  mm@ e@ f& ef&& xtefe& {%%_h m_gw @0 0 @0 N j7a7aXww D85_kNe& 8yq fe Ve4-4-/44  &&  ef&& xte&e & rt%%&e x &e n 55 ew`w`\w4 et 5-5-5 5 w ~D4 4 @ A f&A@EE4tmm@ 4 t  l ve@ 4t4-4-/44  && ef&& xte&e & rt%%&e x ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& xte&e$& rt%%&e$ x `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& xte&e$& rt%%&e$ x `Btp$t t"  ff Nef&& xte&e$& {%%UwD w 0 D5#5 5 wL]wH]`w  @ a@ a@m5A a@5w D 5# aB- f a@m& Nr% w e aC-w ^ D@ A 5@u@e@ 5u   w, uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l6@Et5lV5lXu te%w L D5u-5 w2 @e@- @ a@ a@ a5@ a@@@m`&fNm r% a@ `` e w D a@@m e  wj e  aAm HN@`@m &f r%  aN f`f r%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw D5"E@e44fef \}% bvU4 4  fef \}%5 wZ    6v&  @ppC`p   6@Cw8w27$G Ћ P ы A@PЋ w FD:5UE5Hw* _Hv5uNfe & {% _HvbNe & 8y  uN |y)U5| m- 5 & {%St%  Dy U   & {% S U _u @_ uw DE%%"5   & {% U wv w ^D55@ bv  &w 3 z 4 4 4 4 4 ww~w  DU$x5+ XD &5e-U:De %h & T    x ww  5f x 7T f x 7wX@ mT7TxT%he w  lT ^T    x e-BTww D .Tx5 e %hw T  5 e-Sw v >xww  N {ww rDCDpC |y x wZw FN zwJ ~5 & E        ~5>wlYwfw Net@f vye  w6w.w  R~U7R|U7R~R|RAe vBR7 R  R%R 55 a  a!PE -|R%| w$ |{ `e vWt vwJR@ `e @  |{%"RRe U? R R `e 7Q|U?Q a7Q QQ?QQU ew dDQE wZw FD5 z 5N |y!w5A vBB-  }ee@ !ۃ `!ւ ` ` Qm& E%֠mР%w w7?*'$!     X 7N& A>& BF7! W-7 & & Ve Ӌ pt &7֟& e ğӕ-ӕ0B~ӕ.  ӕ0~ B~pt&7~ & e dӕ-0 Xӕ.L B~ӕe> ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & e w5 5  W- W00~u5  .luvBw* J@B V_(@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff e w5  @ 0   Wp `e0w " zw]D CKw4 ˋ 5 w D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff e A f&A@vee@ 5u 5 @5 W-@D5 Ae B5ḁ.@e@- @D5@pHe _,̋@pHeA Be vC ̂ xuuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw DCB P  5 , :% & E& t z   5 , @ :% & f E t  (˥-%0     ,:% &  t 8 5E& z   5 , @ :% & f E t  whw TNefef 5& e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @w*w fff 5& Xeww  fff 5& Xeww  5 %O N  = `555Ne5& ؇e555'0Ne5 B& ؇e57 Be0" 5%55 5 B5@B e` a=%`7F`w %5 B5Ne& ؇e55e0%7F`Jʕ0%`ʕ1  %`˕0 ʥ9 6@~ the epochrwCannot open %s level %c dump on %s %-16s %c %sUnknown intermediate format in %s, line %d /etc/dumpdates%16s %c %[^ ] N:wBzG/dev/rmt8/etc/dumpdatesMust specify a key. output filedensitysizetime of last dumpbad time "%s" number of blocks per filehonor levelbad key '%c%' Must specify disk or filesystem Unknown arguments to dump: %s You cannot use the T and u flags together. -standard outputDate of this level %c dump: %s Date of last level %c dump: %s Dumping %s (%s) to %s on host %s to %s Cannot open %s mapping (Pass I) [regular files] mapping (Pass II) [directories] estimated %ld tape blocks. estimated %ld tape blocks on %3.2f tape(s). dumping (Pass III) [directories] dumping (Pass IV) [regular files] DUMP: %ld tape blocks on %d tape(s) DUMP IS DONE DUMP IS DONE! bad '%c' (%s) value "%s" The '%c' flag (%s) requires an argument SIGHUP() try rewriting SIGTRAP() try rewriting SIGFPE() try rewriting SIGBUS() try rewriting SIGSEGV() ABORTING! SIGALRM() try rewriting SIGTERM() try rewriting Unknown signal, cannot recover Rewriting attempted as response to unknown signal. /rf|/dev/ttyrfopen on /dev/tty fails yes Yes no No "Yes" or "No"? NEEDS ATTENTION: %s: ("yes" or "no") Interrupt received. Do you want to abort dump?operatorNo entry in /etc/group for %s. operator/etc/utmprCannot open /etc/utmp ttydttyd/dev/w Message from the dump program to all operators at %d:%02d ... %3.2f%%%% done, finished in %d:%02d DUMP: Dump these file systems: Last dump(s) done (Dump '>' file systems): ??%c %8s (%6s) Last dump: Level %c, Date %s "z*Tape write error on %s Cannot recover Tape write error %ld feet into tape %d TAPE ERROR! Do you want to restart?This tape will rewind. After it is rewound, replace the faulty tape with a new one; this dump volume will be rewritten. Broken pipe DUMP: error writing command pipeClosing %s Change Tapes: Mount tape #%d CHANGE TAPES! Is the new tape mounted and ready to go?Do you want to abort?Context save fork fails in parent %d Parent %d waiting for child %d has another child %d return Child %d returns LOB status %o Bad return code from dump: %d Cannot open output "%s". Do you want to retry the open?Tape %d begins with blocks from ino %d The ENTIRE dump is aborted. /tmp/dumplockXXXXXXCould not create lockfile Could not reopen lockfile too many slaves, %d (recompile smaller) DUMP: slave couldn't reopen diskMaster/slave protocol botched. writeshort write: got %d instead of %d DUMP: error reading command pipecorrupted directory, inumber %u bread: lseek fails (This should not happen)bread from %s [block %ld]: c=0x%x, regc=0x%x, &c=0x%x, n=0x%x More than %d block read errors from %d DUMP IS AILING! This is an unrecoverable error. Do you want to attempt to continue?JanFebMarAprMayJunJulAugSepOctNovDecrdump: Lost connection to remote host. rootshelltcprdump: shell/tcp: unknown service rmtO%s %d closeC W%d write%s: %s Protocol to remote tape server botched (code %s?). Protocol to remote tape server botched (in rmtgets). /etc/fstabr/etc/servicesrr# ,/ /etc/grouprrsocket: All ports in use rcmd: socketconnect to address %s: Trying %s... %dwrite: setting up stderrselect: setting up stderrselect: protocol failure in circuit setup. acceptsocket: protocol failure in circuit setup. /etc/hosts.equivr/.rhostsr /etc/passwd/etc/passwd/etc/master.passwdr: : : : : : : : : : /etc/passwd/etc/master.passwdDLYrError 0Unknown hostHost name lookup failureUnknown server errorNo address associated with name: Unknown error %d.%d.%d.%djJjJtJPJPJPJPJPJPJPJPJPJPJPJPJPJ@J@JXJSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecmn%.3s %.3s%3d %02d:%02d:%02d %d GMTGMTlocaltime/etc/zoneinfo/GMTTZGMTGMT: Unknown error: %dv~".@Rdp6ETly;XiJa;St(;J^t*LaRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator,h TZNAMEMETMET DSTEETEET DSTASTADTESTEDTCSTCDTMSTMDTPSTPDTWETWET DSTESTESTCSTCSTWSTGMT%c%d:%02d. ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired d̰ͰT~d:~oF~xfe~g~c~s~l~L\~u`~D>~OJ~Xr~U*/etc/hostsr# ~΂=(\0lE$ R0ɯR0ɯ0setpgid: tcsetpgrp: Warning: no access to tty (%s). Thus no job control in this shell. logout exit You have %smail. %s in %s. tcsh: %s cd %s pushd %s dirs error id is %d %s. %d hits, %d misses, %d%% %s: shell built-in command. %s: Command not found. %s=%d %s=%s %s unlimited %ld %s %s: %s: Can't %s%s limit %6d %2d:%02d%cm %2d:%02d Reset tty pgrp from %d to %d Use "logout" to logout. Use "exit" to leave tcsh. pchild() Waiting... errno == %d BUG: waiting for background job! starting to sigpause for SIGCHLD on %d Exit %d BUG: process flushed twice [%d]%s %c %11s Exit %-18d Exit %-16d BUG: status=%-9o (core dumped) (wd: (wd now: %s: Already suspended %s: Already stopped %s: %s %d: %s wanttty %d tcsh: setpgid error. Warning: ridiculously long PATH truncated es->tms_utime %lu bs->tms_utime %lu es->tms_stime %lu bs->tms_stime %lu ms %lu e %lu b %lu t %lu %ld.%01ld%% %d.%01d %ld.%02ld new gl_p_c globsize=%d new increment, globsize=%d same gl_p_v globsize=%d gl_p_c= %d path is %s malloc size is %d copy is %s did globfree No help file for %s starting_a_command %d cmd_st:%s: word:%s: word: Sorry no globbing for commands yet.. tcsh: Internal match error. %s unreadable tcsh internal error: I don't know what I'm looking for! There are %d items, list them anyway? [n/y] %c Bad tw_command Hist_num = %d patlen = %d patbuf = "%s" tcsh: e_up_search_hist(): Hist_num < 0; resetting. Comparing with "%s" Vdrawing %6.6o '%c' Vdrawing %3.3o '%c' Vdraw: vcur_v overflow! Vcursor_v == %d > %d PromptBuf = :%s: InputBuf = :%s: litnum = %d, litptr = %x: vcur_v = %d, OldvcV = %d, cur_line = %d CursorH = %d, CursorV = %d, cur_h = %d, cur_v = %d str_insert() starting: %d at %d max %d, d == "%s" s == "%s"n str_insert() after insert: %d at %d max %d, d == "%s" str_insert() after copy: %d at %d max %d, d == "%s" str_delete() starting: %d at %d max %d, d == "%s" str_delete() after delete: %d at %d max %d, d == "%s" ofd %d, osb %d, ose %d, ols %d, oe %d nfd %d, nsb %d, nse %d, nls %d, ne %d old:"%s" new:"%s" ofd:"%s" nfd:"%s" ols:"%s" nls:"%s" *oe:%o,*ne:%o osb:"%s" ose:"%s" nsb:"%s" nse:"%s" ERROR: cannot insert in early first diff ERROR: cannot delete in first diff ERROR: cannot delete in second diff ERROR: cannot insert in late first diff ERROR: cannot insert in second diff Tcsh thinks your terminal has the following characteristics: It has %d columns and %d lines It has %s meta key It can%suse tabs %25s (%s) == %s (%s) == %s MoveToLine: where is ridiculous: %d MoveToChar: where is riduculous: %d so_write: n is riduculous: %d so: litnum %d, litptr %x ERROR: cannot delete DeleteChars: num is riduculous: %d ERROR: cannot insert StartInsert: num is riduculous: %d tcsh: Cannot open /etc/t_c_. tcsh: No entry for terminal type "%s" tcsh: using dumb terminal settings. tcsh: WARNING: Your terminal cannot move up. Editing may be odd for long lines. no clear EOL capability. no delete char capability. no insert char capability. Cursor > LastChar Cursor < InputBuf Cursor > InputLim LastChar > InputLim InputLim != &InputBuf[INBUFSIZ-2] (!DoingArg) && (Argument != 1) CcKeyMap[0] == 0 (maybe not inited) ERROR: illegal command from key 0%o yes *** editor fatal ERROR *** G_N_Char(): errno == %d CcKeyMap should be 256 entries, but is %d. CcAltMap should be 256 entries, but is %d. CcEmacsMap should be 256 entries, but is %d. CcViMap should be 256 entries, but is %d. CcViCmdMap should be 256 entries, but is %d. AddXkey: Null extended-key not allowed. AddXKeyCmd: Null extended-key not allowed. AddXKeyCmd: sequence-lead-in command not allowed DeleteXkey: Null extended-key not allowed. Unbound extended key "%s" Some extended keys too long for internal print buffer "%s..." En0lS$ R0ɯR0ɯ0umerate: BUG!! Null ptr passed ! memtop = %lx membot = %lx. nbytes=%d: Out of memory tcsh current memory allocation: free: used: Total in use: %d, total free: %d Allocated memory from 0x%lx to 0x%lx. Real top at 0x%lx Allocated memory from 0x%lx to 0x%lx (%ld). bad key specification -- null string bad key specification -- empty string Bad function-key specification. Null key not allowed bad key specification -- malformed hex number bad key specification -- malformed octal number bad key specification -- malformed decimal number Bad function-key specification. Null key not allowed bad key specification -- unknown name "%s" %s -> %s Bad command name: %s Something must follow: %c\n Octal constant does not fit in a char. Null string specification Standard key bindings Alternative key bindings Multi-character bindings %-15s-> is undefined %-15s-> %s %-4s to %-7s-> %s BUG!!! %s isn't bound to anything. CcKeyMap[%d] == %d CcAltMap[%d] == %d -a bind key in alternative key binding -s bind an out-string instad of a command -v initialized maps to default vi bindings -e initialized maps to default emacs bindings -d initialized maps to default bindings -l list available functions with descriptions -l list available functions -r remove the binding of in-string is printed or all bindings if in-strings is not given. %s %s %s is undefined %s %s %s..%s %s Couldn't get local chars. Couldn't set local chars. %s: %s. %s: %s: aliased to auto-logout Faulty alias 'precmd' removed. Faulty alias 'cwdcmd' removed. Faulty alias 'periodic' removed. parsing command line Do you really want to delete all files? [n/y] skipping deletion of files! command line now is: in one of the lists *cpu %d* *site %d* site: %s %d: Site not found setlocal: %s: %s sysname: %s nodename: %s release: %s version: %s machine: %s %6d %s our wait %d signal(SIGCHLD, pchild); queue SIGCHLD sigpause(%d) sigsetmask(0x%x) - sigprocmask failed, errno %d sigblock(0x%x) - sigprocmask failed, errno %d cannot stat %s. Please "unset watch". %s cannot be opened. Please "unset watch". %s/%s -> NULL backward: new: %s/%s wp: %s/%s %areplaced %s on %a%d:%02d%cm %a%d:%02d %a%s %d %a%02d/%02d/%02d %a%02d-%02d-%02d %alocal 0ltO W 000#!/bin/sh - # @(#)netstart 5.2 (Berkeley) 7/16/88 INET=`/etc/testnet` if [ $INET = YES ]; then echo Assuming NETWORKING system ... >/dev/console 2>&1 else echo Assuming non-networking system ... >/dev/console 2>&1 fi export INET # DON'T EVEN THINK ABOUT RUNNING ROUTED ON A PDP-11!!! Just set routedflags # to "NO" and set up a default gateway below. # routedflags=NO rwhod=YES named=NO # myname is my symbolic name # my-netmask is specified in /etc/networks # my-default-address should be set to some machine where you # want to send all your packets, by default. # hostname=your.hostname.here netmask=255.255.255.0 broadcast=192.168.251.255 default=192.168.251.1 hostname $hostname >/dev/console 2>&1 hostid $hostname >/dev/console 2>&1 if [ $INET = YES ]; then # /etc/ifconfig imp0 inet netmask $netmask $hostname broadcast $broadcast up -trailers >/dev/console 2>&1 # /etc/ifconfig en0 inet netmask $netmask $hostname broadcast $broadcast up -trailers >/dev/console 2>&1 # /etc/ifconfig ec0 inet netmask $netmask $hostname broadcast $broadcast up -trailers arp >/dev/console 2>&1 # /etc/ifconfig il0 inet netmask $netmask $hostname broadcast $broadcast up -trailers >/dev/console 2>&1 # /etc/ifconfig qe0 inet netmask $netmask $hostname broadcast $broadcast up -trailers >/dev/console 2>&1 # /etc/ifconfig sl0 inet 192.254.254.2 192.254.254.1 -arp -trailers >/dev/console 2>&1 # /etc/slattach /dev/ttyS6 9600 /etc/ifconfig lo0 inet localhost up -trailers >/dev/console 2>&1 /etc/route add $hostname localhost 0 >/dev/console 2>&1 /etc/route add default $default 1 >/dev/console 2>&1 fi 0lc B  0 0 0information 5221212 0lc  000root::0:1::0:0:The Man:/:/bin/csh daemon:*:1:1::::The devil himself:/:/bin/sh operator:*:2:5::::System &:/usr/guest/operator:/bin/csh bin:*:3:20::::Binaries Commands and Source:/:/bin/csh nobody:*:32767:31::::Nobody:/nonexistent:/bin/sh uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/usr/spool/uucppublic:/usr/lib/uucp/uucico sms1:\lWFeNqds9vRA:10:10::0:0:Steven M. Schultz:/user/sms1:/bin/csh ingres::39:74::0:0:INGRES Owner:/usr/ingres:/bin/csh 0l5h R0>R0>0  > e7cce7  / 0  7%  w ( %    @ 8 @ 2 @   @ e@& V @ 85 ff >eN w w p  f e wV =w w w 6 Nef V w2 w    85/f @Nevf& Z%@ 6   w v@ev5xt%t t@t @aAt AmpxNev   %ч Nfev       w  DCB̥:̋ ҕ/Ҕˋ ̋ w : ;ewH w Nf  w ~w& w 4De _< t4 t t4 4t Ne&& F% _<t 4     6t-t- t-t- t- t- 55 eAePPPP 5 5 V 55 Nefe Z% & `%5u7  && F%  fe Z%ff ,% fe& F%wH A@E f& w  |w$ w  D Lԋw w De LN 4ee   4e Be v Nfe %w w n -@ wh N % w < Nef R w6 w " D 5  =^& % `5ȥ= 8 = @we  w  BuNefef %=@@wЋ Ћ  Jҋ~ @@Swmownnlw e& 7 7gwbywZw D5"E@e44fef % U4 4  fef %5 wn Ћ w FD:5UE5Hw* _5uNfe & % _bNe &   uN )U5| m- 5 & %St% p U   & % S U _V @_Zw DE%%"5   & % U wv w ^D55@   v 3  4 4 4 4 4 ww~w  $5+ < &5e-Ve % & 4     ww  5f  7 f  7hwX@ m7% e w        e-ww D l5 e % wH  5 e-.w  ww  N ww rDCDpC  > wZw FN  wJ ~5 & E        ~5>wlYwfw Net@f e  w6w.w  6 U7( U7  Ae vB7   % 55 a  a!PE -%  w$  `e vWt vw@ `e @  %`\e U?JJ `e 78 U?, a7 ? U ew dDE wZw FD5   5N !w5A vBB-  }ee@ !ۃ `!ւ ` `Hm& E%m%w w7*'$!     0 7&& A& BF7!W-v7w 8uDAB %u f& & e w5 5  W- W00~u5  .lu Bw* J@B |_@  o x d u        ӕ- f&@Ew ӕ0 0l2h R0>R0>0E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff Fe w5  @ 0   Wp `e0eӕ?w DCB P  5 , :% & E& . z   5 , @ :% & f E .  (˥-%0     ,:% &  . 8 5E& z   5 , @ :% & f E .  w@(#) Copyright (c) 1988 The Regents of the University of California. All rights reserved. @(#)chroot.c 5.4 (Berkeley) 3/5/89usage: chroot newroot [command] SHELL/bin/sh-ichroot: %s: %s /bin/shPATH:/bin:/usr/binsh: Unknown error: %d,>NZl~ /Cbq*Hg(Fv1Kg ,@Tgv*=VxRError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator   dox^fle^g8cDsnlnLuDOXU0llirG R0R00 7 e7cce7* /   7%  X.w 1:u5 5 _@ȥ-_e@ȋ_d  xU eN H7F%cW t eN H7 %O1C eN H7%>B2U$ ew. eN H5%V  eN H7% l (  X. e _r%  X.  . N Br2@,, N v* *N "5=@fe@& "(%w Nf % X.%@ H7| x r  W &  0&e X.e&>: 6/7  X. . @r2p U7( | 5  (  X.@ %7  X.5fe^ e5fe8 e %7   X. e #  X.50fe e5 fe e @fe .  5u%% p9   X.8 pp fe" B% V  X.@f& % h (e ~ (%  (e ,_ 5 5 5 5 N  5 _fe  N f  NeF 0 5_Nfef n e5Ne 5u-u-Nef 4 %uuN  @  6 x@E%   > :S          , -V_r ʀ5 - ?%  ߮& ߢ *  @- X. -_Lw*w *5 fe .  C r vf&A r t@aUU 5 5 Ne& & fef .e Nef&  e 5@w*w ) u@e5@0 @ @ @p =Nm A1 e A1@0 @p@pfe  & f H H 4e 5-L   N4 2  e ,w)w (fe  Nfe  A@e@ f& 2 ef ff F ee@w(w (w( @ w p( u@Et5e@- @f& %f % w*(uDDm 5 5 Ae5@Et5@@m5@e @-'@ E% @/Nm A@,   @  e5@f& %@f& %&f e & N l && N e@f&ef eeu-_ w &u@Et55 @f& 6%"  @f& %@f& %&& % @f& %f/ %w&w %DC    ee@Bt  w%w % _ _ 7 @ _ .  _   v* _ 7 '  !fe %5.f   & Z* D R v* >ff %5ufE& A@  Ef& A@  Ef& A@  Ef& ?R @eRwv$w b$D  Z* Z*e  b  6w&$w $ bP : 7xr )w]Pw#w # \V ,7 N7 2w#w # < dP : 7( h h%5#ff   wPif   ̥ ̥ l&  5=  H7 7 D ̥̋ ̥ %o&    w"w "D CKw" ˋ 5 hw"w "D      + - ̥9 Wp @@`e̥0  wP"w 8"DeEE&E&E&r e w"}0lfirG R0R00wp!Wwj!w !fef 2%5 |w! ]w0!w*!w !D 3 z0EtU4 4t wp!w \!D  , & & :% 6/5 f& :%Uw,!iw w !D Lԋw !w De LN *4e~e$ n  *4e Be v Nfe b%w w p -@ wj N& %&awtww . BuNefef 2%=@@w Ћ Ћ   6v   6v   6vb"yw&  4  b '     ` TW ~  s`K6!  w D85U5_$5P_$ X mN@e4 ,5Ne & .  uN 6/4USt%5 ,5 ,5& & )% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff )%ށ̥a &  2*e 3     U̥r 33w   uff e55 DDfe& "(%eD  D>& "(%e@& "(%elv@A@ 7r`5%  lD& "(%m6m2  :ww D@et5r%=r D |  7; Z4 D  w|e =r r̋E =rNet Z* Net Z*e  @et5Net *5&f 4% X> 7 6 >w DC .   7% Z4 b 2!f '%    wpu5&f %  7 w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @E  W-@DE Ae BE ḁ.@e@- @DE @pHe _̋@pHeA Be vC ̂ x< uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ 6/ J w5 4@E%@EU5N&e v* f&e B* Nf&e )%4 IN&e v* k&e B* Nf&e )%  (Ne& .  ff eee@ 4t@t"4 4t , z0_w N ,@ ,N z0ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  " ve@ 4tw"w D55ff %f&& "eff&e e &e l$ 55 w@w<w5 5 w D5#5ff T %f&& eff&e *ew6&e P&'44  && ef&& 2*e&e & \1%%U w D5_$o5ff %f&& eff&e Ze L&e P&8f f ff&e V e 744  && ef&& 2*e&e & \1%%UU&w @@m e%fe .  &e l$ 55 3ff `%f&e@ &50c &e l$ 55 3p ( U44  && ef&& 2*e&e & \1%%&_fffffe e _&e % _T_e_T  mm@ e@ f& ef&& 2*efe& \1%%_ #_Nw @0 0 @0 N  77ww D85_!Ne& .q fe Ve4-4-/44  &&  ef&& 2*e&e & )%%&e . &e l$ 55 ewww4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  " ve@ 4t4-4-/44  && ef&& 2*e&e & )%%&e . ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& 2*e&e$& )%%&e$ . `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& 2*e&e$& )%%&e$ . `Btp$t t"  ff Nef&& 2*e&e$& \1%%Uw w r D5#5 5 wwwX  @ a@ a@m5A a@5w  D 5# aB- f a@m& '% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5lF @Et5lf 5lh u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm "(% a@ `` e w D a@@m e  w e  aAm HN@`@m &f "(%  aN f`f "(%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef 2% ,U4 4  fef 2%5 w    6v&  @ppC`p   6@Cwzwtw D , & & 2*e 4E05Ew7 Ћ P ы A@PЋ w FD:5UE5Hw* _,5uNfe & \1% _,bNe & .  uN 6/)U5| m- 5 & \1%St%  . U   & \1% S U _* @_*w DE%%"5   & \1% U wv w ^D55@ ,  , 3 z0 4 4 4 4 4 ww~w  $5+ D &5e-&e %x & h    l. ww  5f l. 7* f l. 7wX@ m7%xe w       l. e-ww D 5 e %xw|  5 e-bw , -ww  N b1ww rDCDpC 6/ . wZw FN z0wJ ~5 & E        ~5>wlYwfw Net@f 0/e  w6w.w  jU7\U7RPHAe vB47 6  ,%& 55 a  a!PE -% w$ 61 `e vWt vw@ `e @  61%e U?~~ `e 7lU?` a7R JL?D@U ew dD E wZw FD5 z0 5N 6/!w5A vBB-  }ee@ !ۃ `!ւ ` `|m:& E%,޷m&އ%w w7*'$!      7& A& BF7!vW-j77bw 8uDAB %u f& & e w5 5  W- W00~u5  .luBw* J@B |_3@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B | @  dA  fff e w5  @ 0   Wp `e0eӕ?w ^X )w]w|w h B< ,7 4  7 7 wLw 8   : 7 l h%5#f 5  f 5 JN f&:,$ ̥ ̥ 7 d7& 5  ̥̋ ̥ %& 5   ZwLw 8ww>w *D CKw ˋ 5 w DCB P  5 , :% & E& * z   5 , @ :% & f E *  (˥-%0     ,:% &  * 8 5E& z   5 , @ :% & f E *  wUsage: traceroute [-dnrv] [-w wait] [-m max_ttl] [-p port#] [-q nqueries] [-t tos] [-s src_addr] host [data size]  2V\^hr,|&4=DKPW_m{@(#)$Header: traceroute.c,v 1.17 89/02/28 21:01:13 van Exp $ (LBL)max ttl must be >1 port must be >0 nprobes must be >0 tos must be 0 to 255 wait must be >1 sec %s: unknown host %s traceroute: packet size must be 0 <= s < %ld traceroute: mallocicmpicmp: unknown protocol traceroute: icmp sockettraceroute: raw sockettraceroute: SO_SNDBUFtraceroute: unknown host %s traceroute: bind:traceroute to %s (%s) from %s, %d hops max, %d byte packets %2d %d ms ! !N !H !P !F !S *sendtotraceroute: wrote %s %d chars, ret=%d Echo ReplyICMP 1ICMP 2Dest UnreachableSource QuenchRedirectICMP 6ICMP 7EchoICMP 9ICMP 10Time ExceededParam ProblemTimestampTimestamp ReplyInfo RequestInfo ReplyOUT-OF-RANGEpacket too short (%d bytes) from %s %d bytes from %s to %s: icmp type %d (%s) code %d %2d: x%8.8lx %s %s (%s) %d bytes to %s%lu.%lu.%lu.%lu/etc/protocolsrr# %d.%d.%d.%d: Unknown error: %d<DNhx*6LXdv 2?Udp/No ' F V m   : \ q   $ : \ n  ' RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticator@j ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 3d2o 3x3f3e2g3c3s2l2L 3u$3D3O3X63UV/etc/hostsr# 0l?]  000localhost.arpalocalhost.arpalocalhost.arpa0l Ig i k m o S0]~S0]~0 :Z  e7cce7h /   7%  4-w n0AB r .B  5= w&% N'   4-e @ȥ-`n  x N`  %7hT  4-fe@ e [  ' N  N  +e@ %Nq  e%NH  w*/w /(f5 5 fe -  r f vf&l r t@aUU5 5     l 7 , _ $ Ne& & fe e _Nefe& f le 5 _%_ *N  +_ r f vf& r t@aUU?_̥ & } % l h #5   vee@ 5u     :   v5@u@e 5   e  _6 _6 _6 l   w,w ,ffe - N 5u5u%$%!N 5 N  '% wv,@fe@& &% 7{  '%{ x5x5̕>fe %   0fj e w +P w+w +@775 @t@mb`f& l%f& b %zE & AWtAa1v@t@mB@f& &%f&  %zE & AWtAa1 %@&$f& %f& 5n@*(f& %f& 5f@.,f& %f& 5^ \@ x5Z5-\5Z.\5Z+\5Z*\@77~ @\& % %@E%@Ne0+@70(72$ @77   %'  5n&5^&5f&@&" * E&@f& J%f@E&0 e wB)w .)@7j7f5 @t@mb`f& %f& AWtAa1r@t@mB@f& %f& AWtAa1 %@&$f& %f& 5j@*(f& ^%f& 5b@.,f& :%f& 5Z@ xlf %&R %@7J7FB< V%n  @@E&@&" x E& e@E@& J &5j& e @E%@Ne0@5052ff %  @:8f& %f&@64f& %f& e @f& %N@ f& %f@f& %f@E&@ E& e Q 5 @t@a0r&] e %d f 5 @t@a0&r e %y 5j&5Z&5b&{ e w%w % %  VNfe %5 @f& %w%.f   , & 6) @w N% De t4 tt 4 4 Ne&& % w%  eu @w $ <  f 6)e  f 6) N& 6) X  6w$w ~$   7nh (w] wb$w N$ RL \+7 D7  wD$w 0$ 2   7 r D%5#f  wJ f 5=  f N  x77:7&  ̥̋ ̥ %X&   2w8#w $#D CKw# ˋ 5 w "D      + - ̥9 Wp @@`e̥0  w"w "DeEE&E&E&Z Ve Zwb"}w!Ww!w :" fef 1%5 hw&" ]w!iw!w "D Lԋw!bwf!w !De LN d)4een `  d)4e Be v Nfe >%wn!w Z!-<@ wT!Nl V%lew aw w !u@t55@ 5Nefef % (3A0l Ig i k m o S0]~S0]~0@u5Btr2@ Aup fef % u-u-u-@wx w d BuNefef 1%=@@w8 Ћ Ћ  E6P6 EPSwBlw2 e& 7 7gwyw&  4  b '     ` TW ~  s`K6!  w D85U5_5P_  m@e4 ,5Ne & -  uN .4USt% 5 *5  *5& & (% 45@e-4  % U5EU  wE w D  +   r= wB w5 a U5ff (%ށ̥a &  )e 3     U̥r 33w   uff e55 DJfe& &%eJ  JD& &%eF& &%er@A@ 7r5%  rn& &%m`m\  @ww D@et5r%=r D   7t;V "4 0 F w|e =r r̋ =rNet 6) Net 6)e  @et5Net d)5&f 4%  7 w DC . .  7%t "4 N 2!f &%  D  2wpu5&f % $ 7  w ,D@e55 5  ̥0 ̥x̥X. 'Ae f&ffff `e A f&A@vee@ 5u 5 @  W-@D Ae B ḁ.@e@- @D @pHe _̋@pHeA Be vC ̂ x uuff %5uwA@Ef&A@vUU5uA@ f& A vf&A@vUU A vf& A vf&A@vUUUU BPw 4$ . w5 4@E%@EU5N&e R)  &e ) Nf&e (%4 IN&e R)  &e ) Nf&e (%  (Ne& -  ff eee@ 4t@t"4 4t + V/_w N +@ +N V/ww Dff %5u4 4 @ A f&A@EE4tmm@ 4 t  ve@ 4tw"w D55ff %f&& "eff&e e &e H# 55 wjwfw5 5 w D5#65ff T %f&& eff&e *ew6&e ,%'44  && ef&& )e&e & 80%%U w D5_fo5ff %f&& eff&e Ze L&e ,%8f f ff&e V e 744  && ef&& )e&e & 80%%UUw @@m e%fe -  &e H# 55 3ff `%f&e@ &50c &e H# 55 3   ' U44  && ef&& )e&e & 80%%&_fffffe e _&e % _0_e_0  mm@ e@ f& ef&& )efe& 80%%_ !_*w @0 0 @0 N 77ww D85_Ne& -q fe Ve4-4-/44  &&  ef&& )e&e & (%%&e - &e H# 55 ewww4 et 5-5-5 5 w D4 4 @ A f&A@EE4tmm@ 4 t  ve@ 4t4-4-/44  && ef&& )e&e & (%%&e - ww D4- 4-  w & & teB & & e5u ff >eC ff e5u4 t "-t t"  ff ef&& )e&e$& (%%&e$ - `$BtA @@w D4-  4- 4 4  & & deB & & e5u ff .eC ff e5u4 t "-t t"  ff ef&& )e&e$& (%%&e$ - `Btp$t t"  ff Nef&& )e&e$& 80%%Uw w r D5#5 5 w*w&wX  @ a@ a@m5A a@5w  D 5# aB- f a@m& &% w e aC-w D@ A 5@u@e@ 5u   wn uMuMA@v5u A@@ A f&A@EE  A@@]A]w 5 5 5 uD A@w C  E 5l @Et5l 5l u te%w D5u-5 wt @e@- @ a@ a@ a5@ a@@@m`&fNm &% a@ `` e w D a@@m e  w e  aAm HN@`@m &f &%  aN f`f &%  @A  v @A  R~55R 5& ER$ ~ER  ( R~55R 5& E R RRRRRR~5R`` b~55b 5& E b bbbbbb~5bw  D5"E@e44fef 1% *U4 4  fef 1%5 w    6v&  @ppC`p   6@Cwzwtw D * & & )e 4E05Ew7p Ћ P ы A@PЋ w FD:5UE5Hw* _*5uNfe & 80% _*bNe & -  uN .)U5| m- 5 & 80%St% | - U   & 80% S U _) @_)w DE%%"5   & 80% U wv w ^D55@ *  + 3 V/ 4 4 4 4 4 ww~w  $ 5+ &5e-e % &     H- ww  5f H- 7T f H- 7twX@ m*7( %e w       H- e-ww D  5 e %w  5 e-w \+ ,ww  N >0ww rDCDpC . - wZw FN V/wJ ~5 & E        ~5>wlYwfw Net@f .e  w6w.w  U7U7|zrAe vB^7 `  V%P 55 a  a!PE -% w$ 0 `e vWt vw@ `e @  0%e U? `e 7U? a7| tv?njU ew dDJE wZw FD5 V/ 5N .!w5A vBB-  }ee@ !ۃ `!ւ ` `m& E%޷mއ%w w7@*'$!     < 72& A"& BF7!W-H:7& & "e Ӌ  &7& \e ӕ-ӕ0B~ӕ.  ӕ0~ B~&7b & e Hӕ-0 <ӕ.0 B~ӕe" ӕ- ӕ+ r e0e0Sw 8uDAB %u f& & ze w5 5  W- W00~u5  .luBw* J@B V_3@  o x d u        ӕ- f&@Ew ӕ0 E r@A r  f  e0 9e'  Aҋ D~@B v @  A  fff e w5  @ 0   Wp `e0w  (w]Rww |  \+7 LF 7 >7 "w`w L C  7 l D%5#Ef |5  Hf |5 2N f&xjb ̥ ̥ 7Jj7DK& |5  ̥̋ ̥ %N& |5   `w`w LwwRw >D CKw4 ˋ 5 w DCB P  5 , :% & E& t) z   5 , @ :% & f E t)  (˥-%0     ,:% &  t) 8 5E& z   5 , @ :% & f E t)  ww Nefef 5& p8e C ӕ-B  `ȥ0 @@ % 2%. ӕ. B- ӕe @ 5ӕ-ӕ+A r e0A r e0@.  ̥0ӕ. ӕ0 B-ӕ. B- u-  ӕ0@ @-ӕ.. @w^w Jfff 5& 8ew8w $ fff 5& 8eww  5 %O N  = 555Ne5& ::e555'0Ne5 B& ::e57 Be0" 5%55 5 B5@B e a=%7w %5 B5Ne& ::e55e0%7`Jʕ0%ʕ1  %˕0 ʥ9 6@~ pvusage: %s [ -v ][ -n ] hosts... --- %s --- socketsetsockopt SO_RCVBUF --- %s --- ntpd(%d) - ntpdc(%d) version mismatch Address Reference Strat Poll Reach Delay Offset Disp (rem) Address (lcl) Strat Poll Reach Delay Offset Disp ========================================================================== Timed out waiting for replies %s: unknown ntpudpudp/ntp: service unknown, using default %d connectsend%c%-15.15s %-4.4s %-16.16s %-16.16s wildcard%2d %4d %03o %8.1f %8.1f %8.1f Neighbor address %s port:%d local address %s Reach: 0%o stratum: %d, precision: %d dispersion: %f, flags: %x, leap: %x Reference clock ID: %.4sReference clock ID: [%s] timestamp: %08lx.%08lx hpoll: %d, ppoll: %d, timer: %d, sent: %d received: %d Delay(ms) %7.2f Offset(ms) %7.2f delay: %f offset: %f dsp %f Malformed from address ???/etc/servicesrr# ,/ %d.%d.%d.%d: Unknown error: %d0BR^p3Gfu.Lk ,Jz 5 O k  # 0 D X k z  . A Z | RError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo childrenNo more processesNot enough memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument too largeResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorFv ((((( AAAAAABBBBBB =951-)%! 114r(G3fC!Y&d;You7VV0{- T;>/ 2/[1a<=f`vK_zlG$6w$C M760n!)Y6N1Vp&8)3H+]<ܝ51;7$+g) #n0%a3 $ۤ V02nD91}NR7#:86)W{9:2}xL'|~\/q.pag.dirndbm: split not paired 2d2o2x3f3e2gt3c3s2l2L2u2D2O2X3U\8/etc/hostsr# =(\0lE  R0jR0j0#!/bin/sh - # # Copyright (c) 1980 Regents of the University of California. # All rights reserved. The Berkeley software License Agreement # specifies the terms and conditions for redistribution. # # @(#)mklost+found.sh 5.1 (Berkeley) 5/28/85 # # modified for MAXNAMLEN of 63 - 'fsck' can grow lost+found by up to NDADDR # blocks now. mkdir lost+found cd lost+found echo creating slots... for i in 1 2 3 4 5 6 7 8 9 0 a b c d e f do cat ${i}XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX done echo removing dummy files... for i in 1 2 3 4 5 6 7 8 9 0 a b c d e f do rm ${i}X* done cd .. echo done ls -ld `pwd`/lost+found 0lm 0000l6 000/usr/crash0l `  %%0local7.debug /dev/null *.crit;*.err;kern.debug;auth.notice,local7.none /dev/console *.err;auth.notice;*.info;kern.debug;local3,local7,mail,daemon,lpr.none /usr/adm/messages lpr.debug /usr/adm/lpd-errs mail.debug /usr/spool/mqueue/syslog mark.debug;daemon.debug /usr/adm/daemonlog user.debug /usr/adm/debuglog *.alert;kern.err operator,root *.emerg * 0l$ O0 R0R00# /etc/map3270 (/usr/new/etc/map3270 before migration) # mail corrections and additions to "termcap" # # this file contains mappings between characters entered from the keyboard, # and 3270 keys, for use by programs (like tn3270) doing 3270 emulation # from unix. # # inside the single quotes, a caret ("^") introduces a control character # sequence (rub out = ^?, by the way). also inside the single quotes, # a backslash ('\') introduces an escaped character. Also, \n, \r, \t, # are all as in c, and \E is another way of representing escape. # # NOTE that while we are defining lots of function, much of that # function (ie: local editing keys) may not yet be available from # tn3270. 3a | adm3a { enter = '^m'; clear = '^z'; nl = '^n' | '^^'; tab = '^i'; btab = '^b'; left = '^h'; right = '^l'; up = '^k'; down = '^j'; home = '^@'; delete = '^d' | '^?'; eeof = '^e'; einp = '^w'; insrt = '\E '; dp = '^u'; fm = '^y'; # pf keys pfk1 = '\E1'; pfk2 = '\E2'; pfk3 = '\E3'; pfk4 = '\E4'; pfk5 = '\E5'; pfk6 = '\E6'; pfk7 = '\E7'; pfk8 = '\E8'; pfk9 = '\E9'; pfk10 = '\E0'; pfk11 = '\E:'; pfk12 = '\E-'; pfk13 = '^f13'; pfk14 = '^f14'; pfk15 = '^f15'; pfk16 = '^f16'; pfk17 = '^f17'; pfk18 = '^f18'; pfk19 = '^f19'; pfk20 = '^f20'; pfk21 = '^f21'; pfk22 = '^f22'; pfk23 = '^f23'; pfk24 = '^f24'; # program attention keys pa1 = '^p1'; pa2 = '^p2'; pa3 = '^p3'; # other keys cursel = '\E.'; # local control keys reset = '^t'; # well, there is a little confusion here... master_reset = '^g'; flinp = '^x'; reshow = '^v'; # redisplay screen escape = '^c'; # escape to telnet command mode # local editing keys settab = '\E;'; clrtab = '\E+'; setmrg = '\E('; sethom = '\E!'; coltab = '\Ei'; colbak = '\Eb'; indent = '\El'; undent = '\Eh'; } # end of adm3a 920c | tvi920c { # tvi920c definitions... # command keys enter = '^m'; clear = '^z'; # cursor movement keys nl = '^^'; tab = '^i'; btab = '^b'; left = '^h'; right = '^l'; up = '^k'; down = '^j'; home = '^@'; # edit control keys delete = '^?' | '^d'; eeof = '^e'; einp = '^w'; insrt = '\E '; dp = '^u'; fm = '^y'; # program function keys pfk1 = '^a@^m'; pfk2 = '^aA^m'; pfk3 = '^aB^m'; pfk4 = '^aC^m'; pfk5 = '^aD^m'; pfk6 = '^aE^m'; pfk7 = '^aF^m'; pfk8 = '^aG^m'; pfk9 = '^aH^m'; pfk10 = '^aI^m'; pfk11 = '^aJ^m' | '\E^a@^m'; pfk12 = '^aj^m' | '\E^aA^m'; pfk13 = '\E^aB^m'; pfk14 = '\E^aC^m'; pfk15 = '\E^aD^m'; pfk16 = '\E^aE^m'; pfk17 = '\E^aF^m'; pfk18 = '\E^aG^m'; pfk19 = '\E^aH^m'; pfk20 = '\E^aI^m'; pfk21 = '\E^a`^m'; pfk22 = '\E^aa^m'; pfk23 = '\E^ab^m'; pfk24 = '\E^ac^m'; # program attention keys pa1 = '^a`^m'; pa2 = '^aa^m'; pa3 = '^ab^m'; # miscellaneous 3270 keys cursel = '\E.'; # local control keys reset = '^t'; # there is some confusion here... master_reset = '^g'; flinp = '^x'; reshow = '^v'; escape = '^c'; # escape to telnet command mode # local editing keys settab = '\E;'; clrtab = '\E:'; setmrg = '\E*'; sethom = '\E!'; coltab = '\Ei' | '\EI'; colbak = '\Eb' | '\EB'; indent = '\El' | '\EL'; undent = '\Eh' | '\EH'; } # end of tvi920c table... 925 | tvi925 | 925vb | tvi925vb | televideo 925 { # command keys enter = '^m'; clear = '^z'; # cursor movement keys nl = '^j'; tab = '^i'; btab = '\EI'; left = '^h'; right = '^l'; up = '^k'; down = '^v'; home = '^^'; # edit control keys delete = '^?'; # that's rubout... eeof = '^e'; einp = '^w'; insrt = '\E ' | '\EW'; # program function keys pfk1 = '^a@^m'; pfk2 = '^aA^m'; pfk3 = '^aB^m'; pfk4 = '^aC^m'; pfk5 = '^aD^m'; pfk6 = '^aE^m'; pfk7 = '^aF^m'; pfk8 = '^aG^m'; pfk9 = '^aH^m'; pfk10 = '^aI^m'; pfk11 = '^aJ^m'; pfk12 = '\EQ'; pfk13 = '0l݁$ O0 R0R00\E^a@^m'; pfk14 = '\E^aA^m'; pfk15 = '\E^aB^m'; pfk16 = '\E^aC^m'; pfk17 = '\E^aD^m'; pfk18 = '\E^aE^m'; pfk19 = '\E^aF^m'; pfk20 = '\E^aG^m'; pfk21 = '\E^aH^m'; pfk22 = '\E^aI^m'; pfk23 = '\E^aJ^m'; pfk24 = '\E\EQ'; # program attention keys pa1 = '^a`^m'; pa2 = '^aa^m'; pa3 = '^ab^m'; # other keys # local control keys reset = '^t'; # again, there is some confusion here... master_reset = '^g'; flinp = '^x'; reshow = '^b'; escape = '^c'; # escape to telnet command mode # local editing keys settab = '\EY'; deltab = '\Ey'; clrtab = '\E:'; setmrg = '\ET'; sethom = '\Et'; coltab = '^p'; colbak = '^o'; indent = '\ER'; undent = '\EE'; } 924 | tvi924 { # command keys enter = '^m'; clear = '^z'; # cursor movement keys nl = '^j'; tab = '^i'; btab = '\EI'; left = '^h'; right = '^l'; up = '^k'; down = '^v'; home = '^^'; # edit control keys delete = '^?'; # that's rubout... eeof = '^e'; einp = '^w'; insrt = '\E ' | '\EW'; dp = '^u'; fm = '^y'; # program function keys pfk1 = '^a@^m'; pfk2 = '^aA^m'; pfk3 = '^aB^m'; pfk4 = '^aC^m'; pfk5 = '^aD^m'; pfk6 = '^aE^m'; pfk7 = '^aF^m'; pfk8 = '^aG^m'; pfk9 = '^aH^m'; pfk10 = '^aI^m'; pfk11 = '^aJ^m'; pfk12 = '^aK^m'; pfk13 = '\E^a@^m'; pfk14 = '\E^aA^m'; pfk15 = '\E^aB^m'; pfk16 = '\E^aC^m'; pfk17 = '\E^aD^m'; pfk18 = '\E^aE^m'; pfk19 = '\E^aF^m'; pfk20 = '\E^aG^m'; pfk21 = '\E^aH^m'; pfk22 = '\E^aI^m'; pfk23 = '\E^aJ^m'; pfk24 = '\E^aK^m'; # program attention keys pa1 = '^a`^m'; pa2 = '^aa^m'; pa3 = '^ab^m'; # other keys # local control keys reset = '^t'; # again, there is some confusion here... master_reset = '^g'; flinp = '^x'; reshow = '^b'; escape = '^c'; # escape to telnet command mode # local editing keys settab = '\EY'; deltab = '\Ey'; clrtab = '\E:'; setmrg = '\ET'; sethom = '\Et'; coltab = '^p'; colbak = '^o'; indent = '\ER'; undent = '\EE'; } #kb | h19 | heath | h19b | heathkit | heath-19 | z19 | zenith { kb | h19 | heath | h19b | heathkit | z19 | zenith { #coughs on heath-19 enter = '^m'; clear = '^z'; nl = '^n' | '^?'; tab = '^i'; btab = '^b'; left = '^h'; right = '^l'; up = '^k'; down = '^j'; home = '^@'; delete = '^d'; eeof = '^e'; einp = '^w'; insrt = '\E '; # pf keys pfk1 = '\E?p\E?q'; pfk2 = '\E?p\E?r'; pfk3 = '\E?p\E?s'; pfk4 = '\E?p\E?t'; pfk5 = '\E?p\E?u'; pfk6 = '\E?p\E?v'; pfk7 = '\E?p\E?w'; pfk8 = '\E?p\E?x'; pfk9 = '\E?p\E?y'; pfk10 = '\E?q\E?p'; pfk11 = '\E?q\E?q'; pfk12 = '\E?q\E?r'; pfk13 = '\E?q\E?s'; pfk14 = '\E?q\E?t'; pfk15 = '\E?q\E?u'; pfk16 = '\E?q\E?v'; pfk17 = '\E?q\E?w'; pfk18 = '\E?q\E?x'; pfk19 = '\E?q\E?y'; pfk20 = '\E?r\E?p'; pfk21 = '\E?r\E?q'; pfk22 = '\E?r\E?r'; pfk23 = '\E?r\E?s'; pfk24 = '\E?r\E?t'; # program attention keys pa1 = '\EP'; pa2 = '\EQ'; pa3 = '\ER'; # other keys # cursel = '\E.'; # find out what this does master_reset = '^g'; # local control keys reset = '^t'; # well, there is a little confusion here... flinp = '^x'; reshow = '^v'; # redisplay screen escape = '^c'; # escape to telnet command mode # local editing keys settab = '\E;'; clrtab = '\E:'; setmrg = '\E\''; sethom = '\E!'; coltab = '\Ei'; colbak = '\Eb'; indent = '\El'; undent = '\Eh'; } # end of h19 #co | c100 | concept | c100-4p | concept100 { co | c100 | concept | concept100 { # coughs on c100-4p enter = '^m'; clear = '^z' | '^\2'; nl = '^n'; tab = '^i'; btab = '^b'; left = '^h' | '\E>'; right = '^l' | '\E='; up = '^k' | '\E;'; down = '^j' | '\E<'; home = '\E?'; delete = '^d' | '^?' | '^\1'; eeof = '^e' | '^\3'; einp = '^w'; insrt = '^\0'; # pf keys pfk1 = '\E\E1' | '^\5'; pfk2 = '\E\E2' | '^\6'; pfk3 = '\E\E3' | '^\7'; pfk4 = '\E\E4' | '^\8'; pfk5 = '\E\E5' | '^\9'; pfk6 = '\E\E6' | '^\:'; pfk7 = '\E\E7' | '^\;'; pfk8 = '\E\E8' | '^\<'; pfk9 = '\E\E9' | '^\='; pfk10 = '\E\E0' | '^\>'; pfk11 = '\E\E-' | '^\?'; pfk12 = '^\@'; pfk13 = '^\A'; pfk14 = '^\B'; pfk15 = '^\)'; pfk16 = '^\*'; pfk17 = '^\+'; pfk18 = '^\,'; pfk19 = '^\-'; pfk20 = '^\.'; pfk21 = '^\/'; pfk22 = '^\C'; pfk23 = '^\D'; pfk24 = '^\E'; # program attention keys pa1 = '^\%'; pa2 = '^\&' | '\E+'; pa3 = '^\\''; # other keys cursel = '\E.'; aplon = '\E{'; aplend = '\E}'; aploff = '\E_'; master_reset = '^g'; # local control keys reset = '^t'; # well, there is a little confusion here... flinp = '^x'; reshow = '^v'; # redisplay screen escape = '^c'; # escape to telnet command mode # local editing keys settab = '\E\E;'; clrtab = '\E\E:'; setmrg = '\E\E*'; sethom = '\E\E!'; coltab = '\E\Ei'; colbak = '\E\Eb'; indent = '\E\El'; undent = '\E\Eh'; } # end of concept avt | vt100 | vt100nam | pt100 | vt125 | vt102 | direct831 { enter = '^m'; clear = '^z' | '\EOM'; # Keypad enter key nl = '^?'; tab = '^i'; btab = '^b'; left = '^h' | '\E[D' | '\EOD'; # Arrow key (application/numeric modes) right = '^l' | '\E[C' | '\EOC'; # Arrow key (application/numeric modes) up = '^k' | '\E[A' | '\EOA'; # Arrow key (application/numeric modes) down = '^j' | '\E[B' | '\EOB'; # Arrow key (application/numeric modes) home = '\EOn'; # Keypad period key delete = '^d'; eeof = '^e'; einp = '^w'; insrt = '^ '; # pfk keys # Keypad digits 1-9 correspond to pf keys 1-9 pfk1 = '\EOq' | '\E1'; pfk2 = '\EOr' | '\E2'; pfk3 = '\EOs' | '\E3'; pfk4 = '\EOt' | '\E4'; pfk5 = '\EOu' | '\E5'; pfk6 = '\EOv' | '\E6'; pfk7 = '\EOw' | '\E7'; pfk8 = '\EOx' | '\E8'; pfk9 = '\EOy' | '\E9'; # Keypad digits 0-9 prefixed by pf1 (gold key) correspond to pfk10-19 pfk10 = '\EOP\EOp' | '\E0'; pfk11 = '\EOP\EOq' | '\E-'; pfk12 = '\EOP\EOr' | '\E='; pfk13 = '\EOP\EOs' | '^f13'; pfk14 = '\EOP\EOt' | '^f14'; pfk15 = '\EOP\EOu' | '^f15'; pfk16 = '\EOP\EOv' | '^f16'; pfk17 = '\EOP\EOw' | '^f17'; pfk18 = '\EOP\EOx' | '^f18'; pfk19 = '\EOP\EOy' | '^f19'; # Keypad digits 0-9 prefixed by pf2 correspond to pfk20,21 pfk20 = '\EOQ\EOp' | '^f20'; pfk21 = '\EOQ\EOq' | '^f21'; # program attention keys pa1 = '\E\EOP' | '^p1'; # pa1 is Escape pf1 pa2 = '\E\EOQ' | '^p2'; # pa2 is Escape pf2 # local control keys reset = '^t'; # well, there is a little confusion here... flinp = '^x'; reshow = '^v'; # redisplay screen escape = '^c'; # escape to telnet command mode master_reset = '^g'; # local editing keys settab = '\E;'; # Escape key deltab = '\E\''; # Escape \ clrtab = '\E:'; # Escape : setmrg = '\E,'; # Escape , sethom = '\E.'; # Escape . coltab = '\E\E[B' | '\E\EOB'; # Escape down-arrow colbak = '\E\E[A' | '\E\EOA'; # Escape up-arrow indent = '\E\E[C' | '\E\EOC'; # Escape right-arrow undent = '\E\E[D' | '\E\EOD'; # Escape left-arrow } # end of vt100, etc. tvipt | vp | televideopt { enter = '^m'; clear = '^z'; nl = '^n'; tab = '^i'; btab = '^b'; left = '^h'; right = '^l'; up = '^k'; down = '^j'; home = '^^'; delete = '^?'; eeof = '^e'; einp = '^w'; insrt = '\E '; # pf keys pfk1 = '\E1' | '^A@^m'; pfk2 = '\E2' | '^AA^m'; pfk3 = '\E3' | '^AB^m'; pfk4 = '\E4' | '^AC^m'; pfk5 = '\E5' | '^AD^m'; pfk6 = '\E6' | '^AE^m'; pfk7 = '\E7' | '^AF^m'; pfk8 = '\E8'; pfk9 = '\E9'; pfk10 = '\E0'; pfk11 = '\E!' | '\E^A@^m'; pfk12 = '\E@' | '\E^AA^m'; pfk13 = '\E#' | '\E^AB^m'; pfk14 = '\E$' | '\E^AC^m'; pfk15 = '\E%' | '\E^AD^m'; pfk16 = '\E^AE^m' | '\E\^'; pfk17 = '\E&' | '\E^AF^m'; pfk18 = '\E*'; pfk19 = '\E('; pfk20 = '\E)'; # program attention keys pa1 = '^AG^m'; pa2 = '^AH^m'; pa3 = '^AI^m'; # other keys # # cursel = '\E.'; # local control keys reset = '^t'; # well, there is a little confusion here... master_reset = '^g'; flinp = '^x'; reshow = '^v'; # redisplay screen escape = '^c'; # escape to telnet command mode # local editing keys settab = '\E;'; clrtab = '\E:'; setmrg = '\E['; sethom = '\E+'; coltab = '\Ei' | '\EI'; colbak = '\Eb' | '\EB'; indent = '\El' | '\EL'; undent = '\Eh' | '\EH'; } # end of tvipt 0l2ߤ  $ß$Ú0uucp ingres root 0l  00046 0lZc  000localhost.arpa 00 l[  00000 l[  00000 l[  00000 l[  00000 l[  00000 l[  00000 l[  00000 l[  00000 l[  00000 l[  000